CTLA4 binders

11649290 · 2023-05-16

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention provides molecules, such as ISVDs and Nanobodies, that bind to CTLA4 or human serum albumin. These molecules have been engineered so as to reduce the incidence of binding by pre-existing antibodies in the bodies of a subject administered such a molecule. Methods for increasing immune response, treating cancer and/or treating an infectious disease with such molecules are provided.

Claims

1. A CTLA4 binder comprising an immunoglobulin single variable domain (ISVD) comprising the amino acid sequence: XVQLVESGGGVVQPGGSLRLSCAASGGTFSFYGMGWFRQAPGKEREFVADIRTSAGRTYY ADSVKGRFTISRDNSKNTVYLQMNSLRPEDTALYYCAAEPSGISGWDYWGQGTLVTVSS (SEQ ID NO: 60) that binds to human CTLA4 at one or more of the following residues: TABLE-US-00025 (SEQ ID NO: 118) VRVTVL; (SEQ ID NO: 119) ADSQVTEVC; and (SEQ ID NO: 120) CKVELMYPPPYYLG;

2. The CTLA4 binder of claim 1 fused to a half-life extender.

3. The CTLA4 binder of claim 2, wherein the half-life extender is an ISVD that binds to human serum albumin.

4. The CTLA4 binder of claim 3 wherein the ISVD that binds to human serum albumin is ALB11002 having the amino acid sequence set forth in SEQ ID NO: 66.

5. The CTLA4 binder of claim 1 comprising: an ISVD that binds to CTLA4 comprising the amino acid sequence set forth in SEQ ID NO: 60 wherein X is D or E; a peptide linker; an ISVD that binds to CTLA4 comprising the amino acid sequence set forth in SEQ ID NO: 60 wherein X is D or E; a peptide linker; a half-life extender; and, optionally, a C-terminal extension alanine.

6. The CTLA4 binder of claim 1 comprising: an ISVD that binds to CTLA4 comprising the amino acid sequence set forth in SEQ ID NO: 60 wherein X is D or E; a peptide linker; a half-life extender; and, optionally, a C-terminal extension alanine.

7. The CTLA4 binder of claim 5 wherein the peptide linker comprises the amino acid sequence GGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 65).

8. A CTLA4 binder comprising an immunoglobulin single variable domain (ISVD) comprising the amino acid sequence: TABLE-US-00026 (SEQ ID NO: 62) DVQLVESGGGVVQPGGSLRLSCAASGGTFSFYGMGWFRQAPGKEREFVA DIRTSAGRTYYADSVKGRFTISRDNSKNTVYLQMNSLRPEDTALYYCAA EPSGISGWDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGG GSGGGGSEVQLVESGGGVVQPGGSLRLSCAASGGTFSFYGMGWFRQAPG KEREFVADIRTSAGRTYYADSVKGRFTISRDNSKNTVYLQMNSLRPEDT ALYYCAAEPSGISGWDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSG GGGSGGGGSGGGGSEVQLVESGGGVVQPGNSLRLSCAASGFTFSSFGMS WVRQAPGKGLEWVSSISGSGSDTLYADSVKGRFTISRDNAKTTLYLQMN SLRPEDTALYYCTIGGSLSRSSQGTLVTVSSA that binds to human CTLA4 at one or more of the following residues: TABLE-US-00027 (SEQ ID NO: 118) VRVTVL; (SEQ ID NO: 119) ADSQVTEVC;  and (93-106 of SEQ ID NO: 120) CKVELMYPPPYYLG.

9. A CTLA4 binder comprising an immunoglobulin single variable domain (ISVD) comprising the amino acid sequence: TABLE-US-00028 (SEQ ID NO: 64) DVQLVESGGGVVQPGGSLRLSCAASGGTFSFYGMGWFRQAPGKEREFVA DIRTSAGRTYYADSVKGRFTISRDNSKNTVYLQMNSLRPEDTALYYCAA EPSGISGWDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGG GSGGGGSEVQLVESGGGVVQPGNSLRLSCAASGFTFSSFGMSWVRQAPG KGLEWVSSISGSGSDTLYADSVKGRFTISRDNAKTTLYLQMNSLRPEDT ALYYCTIGGSLSRSSQGTLVTVSSA that binds to human CTLA4 at one or more of the following residues: TABLE-US-00029 (SEQ ID NO: 118) VRVTVL; (SEQ ID NO: 119) ADSQVTEVC;  and (SEQ ID NO: 120) CKVELMYPPPYYLG. 

10. The CTLA4 binder of claim 1 which is multivalent.

11. A binder that cross-blocks a CTLA4 binder of claim 1 from binding to human CTLA4.

12. An injection device or vessel that comprises the CTLA4 binder of claim 1 optionally in association with a further therapeutic agent.

13. A method for preventing CTLA4 from binding to CD80 or CD86 comprising contacting CTLA4 with the CTLA4 binder of claim 1 optionally in association with a further therapeutic agent.

14. A method for enhancing an immune response in the body of a subject comprising administering an effective amount of the CTLA4 binder of claim 1 to the subject optionally in association with a further therapeutic agent.

Description

DESCRIPTION OF THE FIGURES

(1) FIG. 1. A table listing some of the amino acid positions that will be specifically referred to herein and their numbering according to some alternative numbering systems (such as Aho and IMGT)

(2) FIG. 2-1-2-5. CTLA4 binder sequences.

(3) FIG. 3 (A-B). Alignment of 11F1 sequence with that of the SEQ ID NOs: 8-43.

(4) FIG. 4. Predominant N-linked glycans for monoclonal antibodies produced in Chinese hamster ovary cells (CHO N-linked glycans) and in engineered yeast cells (engineered yeast N-linked glycans): squares: N-acetylglucosamine (GlcNac); circles: mannose (Man); diamonds: galactose (Gal); triangles: fucose (Fuc).

(5) FIG. 5 (A-B). bFACS analysis of Nanobody F023700912, F023700925 or control nanobody (IRR00051; anti-HER2/ERBB2 (bivalent anti-HER2 with 35GS connected to albumin binder)) binding to (A) Jurkat and (B) CHO-K1 cells expressing hCTLA4.

(6) FIG. 6 (A-B). Competition between Nanobody F023700912 or ipilimumab and (A) CD80 or (B) CD86 for binding to human CTLA4 expressed on CHO-K1 cells.

(7) FIG. 7 (A-H). Specificity assessment of Nanobody F023700912, F023700925 or control nanobody (IRR00051) for binding to BTLA, CD8, PD1, CTLA4, LAG3, CD28 or control cells. Binding of the Nanobodies was determined to (A) negative control L cells, (B) negative control CHO-K1 cells, (C) huCD28+ L cells, (D) huCD8alpha+ L cells, (E) huLag-3+ CHO-K1 cells, (F) huBTLA+ CHO-K1 cells, (G) huCTLA-4+ CHO-K cells, and (H) huPD-1+ CHO-K1 cells.

(8) FIG. 8 (A-B). Competition between Nanobody F023700906, F023701051, F02371054 or F023701061 and (A) human CD80 or (B) human CD86 for binding to human CTLA-4 expressed on CHO-K1 cells.

(9) FIG. 9 (A-S). Nanobody effect on panc 08.13 tumors in humanized mice. (A) average tumor volumes±SEM and (B) individual tumor volumes on day-37 in mice treated with isotype control, ipilimumab (N297A), ipilimumab, pembrolizumab, ipilimumab+pembrolizumab, F023700912 at 5 mpk dosage (CTLA4 Nab-5), F023700912 at 15 mpk dosage (CTLA4 Nab-15), or pembrolizumab+CTLA4 Nab-15; and tumor volumes in individual mice over the course of the experiment in mice treated with (C) isotype control antibody, (D) ipilimumab (N297A), (E) ipilimuamb, (F) pembrolizumab, (G) ipilimumab+pembrolizumab, (H) CTLA4 Nab-5, (I) CTLA4 Nab-15 or (J) CTLA4 Nab-15+pembrolizumab; (K-S) average (mean±SEM) and individual body weight changes in each treatment group.

(10) FIG. 10 (A-B). Serum preAb reactivity to F023700912 and F023700925 and a trivalent control Nanobody T013700112 (lacking mutations to reduce pre-existing antibody binding) by (A) healthy human subject sera and (B) cancer patient sera.

(11) FIG. 11. CTLA4 binder constructs.

(12) FIG. 12 (A-C). CTLA4 binder sequences.

(13) FIG. 13. Deuterium labeling difference heatmap of human CTLA4 binding by F023700912 CTLA4 binder.

DETAILED DESCRIPTION OF THE INVENTION

(14) The present invention provides ISVDs that comprise mutations which block reactivity of pre-existing antibodies (pre-antibodies) to neo-epitopes within the ISVDs. Neoepitopes are epitopes within a protein which are revealed when the protein is mutated (e.g., truncated) or its folding is altered. Pre-existing antibodies are antibodies existing in the body of a patient prior to receipt of an ISVD. The ISVDs of the present invention are based, in part, in llama antibodies whose C-terminal constant domains have been removed; thus, exposing the neo-epitopes in the C-terminus of the resulting VHH to pre-antibody binding. It has been discovered that the combination of mutations of residues 11 and 89 (e.g., L11V and 189L or V89L) led to a surprising lack of pre-antibody binding. Mutations in residue 112 have also been shown to remarkably reduce pre-antibody binding. Buyse & Boutton (WO2015/173325) included data showing that the combination of an L11V and V89L mutation provided a remarkable improvement in reducing pre-antibody binding compared to an L11V mutation alone or a V89L mutation alone. For example, Table H of Buyse & Boutton on page 97 showed comparative data for an ISVD with a V89L mutation alone (with or without C-terminal extension) and the same ISVD with a V89L mutation in combination with an L11V mutation (again, with or without a C-terminal extension). Also, although generated in two separate experiments, the data shown in Table H for the L11V/V89L combination as compared to the data given in Table B for an L11V mutation alone (in the same ISVD) showed that the pre-antibody binding reduction that is obtained by the L11V/V89L combination was greater than that for the L11V mutation alone. Since the llama antibody scaffold structure is known to be very highly conserved, the effect of the mutations at positions 11 and 89 is very likely to exist for any ISVD. Indeed, the effect was demonstrated, in FIG. 10, with the instant binders, F023700912 and F023700925, which were shown to exhibit very low levels of pre-antibody binding.

(15) In the present application, the amino acid residues/positions in an immunoglobulin heavy-chain variable domain will be indicated with the numbering according to Kabat. For the sake of convenience, FIG. 1 gives a table listing some of the amino acid positions that will be specifically referred to herein and their numbering according to some alternative numbering systems (such as Aho and IMGT. Note: unless explicitly indicated otherwise, for the present description and claims, Kabat numbering is decisive; other numbering systems are given for reference only).

(16) With regards to the CDRs, as is well-known in the art, there are multiple conventions to define and describe the CDRs of a VH or VHH fragment, such as the Kabat definition (which is based on sequence variability and is the most commonly used) and the Chotia definition (which is based on the location of the structural loop regions). Reference is for example made to the website www.boinf.org.uk/abs/. For the purposes of the present specification and claims, even though the CDRs according to Kabat may also be mentioned, the CDRs are most preferably defined on the basis of the Abm definition (which is based on Oxford Molecular's AbM antibody modelling software), as this is considered to be an optimal compromise between the Kabat and Chotia definitions. Reference is again made to the website www.bioinf.org.uk/abs/. See Sequences of Proteins of Immunological Interest, Kabat, et al.; National Institutes of Health, Bethesda, Md.; 5th ed.; NIH Publ. No. 91-3242 (1991); Kabat (1978) Adv. Prot. Chem. 32:1-75; Kabat, et al., (1977) J. Biol. Chem. 252:6609-6616; Chothia, et al., (1987) J Mol. Biol. 196:901-917 or Chothia, et al., (1989) Nature 342:878-883; Chothia & Lesk (1987) J. Mol. Biol. 196: 901-917; Elvin A. Kabat, Tai Te Wu, Carl Foeller, Harold M. Perry, Kay S. Gottesman (1991) Sequences of Proteins of Immunological Interest; Protein Sequence and Structure Analysis of Antibody Variable Domains. In: Antibody Engineering Lab Manual (Ed.: Duebel, S. and Kontermann, R., Springer-Verlag, Heidelberg). In an embodiment of the invention, CDR determination is according to Kabat, e.g., wherein FR1 of a VHH comprises the amino acid residues at positions 1-30, CDR1 of a VHH comprises the amino acid residues at positions 31-35, FR2 of a VHH comprises the amino acids at positions 36-49, CDR2 of a VHH comprises the amino acid residues at positions 50-65, FR3 of a VHH comprises the amino acid residues at positions 66-94, CDR3 of a VHH comprises the amino acid residues at positions 95-102, and FR4 of a VHH comprises the amino acid residues at positions 103-113.

(17) In an embodiment of the invention, CDRs are determined according to Kontermann and Diibel (Eds., Antibody Engineering, vol 2, Springer Verlag Heidelberg Berlin, Martin, Chapter 3, pp. 33-51, 2010).

(18) The term “immunoglobulin single variable domain” (also referred to as “ISV” or “ISVD”) is generally used to refer to immunoglobulin variable domains (which may be heavy chain or light chain domains, including VH, VHH or VL domains) that can form a functional antigen-binding site without interaction with another variable domain (e.g. without a VH/VL interaction as is required between the VH and VL domains of conventional 4-chain monoclonal antibody). Examples of ISVDs will be clear to the skilled person and for example include Nanobodies (including a VHH, a humanized VHH and/or a camelized VHs such as camelized human VHs), IgNAR, domains, (single domain) antibodies (such as dAbs™) that are VH domains or that are derived from a VH domain and (single domain) antibodies (such as dAbs™) that are VL domains or that are derived from a VL domain. ISVDs that are based on and/or derived from heavy chain variable domains (such as VH or VHH domains) are generally preferred. Most preferably, an ISVD will be a Nanobody. For example, F023700906 is an ISVD.

(19) The term “Nanobody” is generally as defined in WO 2008/020079 or WO 2009/138519, and thus in a specific aspect generally denotes a VHH, a humanized VHH or a camelized VH (such as a camelized human VH) or generally a sequence optimized VHH (such as e.g. optimized for chemical stability and/or solubility, maximum overlap with known human framework regions and maximum expression). It is noted that the terms Nanobody or Nanobodies are registered trademarks of Ablynx N. V. and thus may also be referred to as Nanobody® and/or Nanobodies®).

(20) A multispecific binder is a molecule that comprises a first CTLA4 binding moiety (e.g., an ISVD or a Nanobody) and one or more (e.g., 1, 2, 3, 4, 5) additional binding moieties (e.g., an ISVDs or Nanobodies) that bind to an epitope other than that of the first CTLA4 binding moiety (e.g., a different epitope of CTLA4, or to CD27, LAG3, PD1 or BTLA).

(21) A binding moiety or binding domain or binding unit is a molecule, such as an ISVD or Nanobody (e.g., any of SEQ ID NOs: 8-43 or 60), that binds to an antigen such as CTLA4. A binding moiety or binding domain or binding unit may be part of a larger molecule such as a multivalent or multispecific binder that includes more than one moiety, domain or unit which may comprises another functional element, such as, for example, a half-life extender (HLE), targeting unit and/or a small molecule such a polyethyleneglycol (PEG).

(22) A monovalent CTLA4 binder (e.g., ISVD such as a Nanobody) is a molecule that comprises a single antigen-binding domain. A bivalent CTLA4 binder (e.g., ISVD such as a Nanobody) comprises two antigen-binding domains. A multivalent CTLA4 binder comprises more than one antigen-binding domain (e.g., 1, 2, 3, 4, 5, 6, or 7).

(23) A monospecific CTLA4 binder (e.g., ISVD such as a Nanobody) binds a single antigen (CTLA4); a bispecific CTLA4 binder binds to two different antigens and a multispecific CTLA4 binder binds to more than one antigen.

(24) A biparatopic CTLA4 binder (e.g., ISVD such as a Nanobody) is monospecific but binds to two different epitopes of the same antigen. A multiparatopic CTLA4 binder binds the same antigen but to more than one epitope in the antigen.

(25) The term “half-life” as used herein in relation to a CTLA4 binder (e.g., ISVD such as a Nanobody) or other molecule can generally be defined as described in paragraph o) on page 57 of WO 2008/020079 and as mentioned therein refers to the time taken for the serum concentration of the amino acid sequence, CTLA4 binder, compound or polypeptide to be reduced by 50%, in vivo, for example due to degradation of the sequence or compound and/or clearance or sequestration of the sequence or compound by natural mechanisms. The in vivo half-life of an amino acid sequence, CTLA4 binder, compound or polypeptide of the invention can be determined in any manner known per se, such as by pharmacokinetic analysis. Suitable techniques will be clear to the person skilled in the art, and may for example generally be as described in paragraph o) on page 57 of WO 2008/020079. As also mentioned in paragraph o) on page 57 of WO 2008/020079, the half-life can be expressed using parameters such as the t½-alpha, t½-beta and the area under the curve (AUC). In this respect it should be noted that the term “half-life” as used herein in particular refers to the t½-beta or terminal half-life (in which the t½-alpha and/or the AUC or both may be kept out of considerations). Reference is for example made to the Experimental Part below, as well as to the standard handbooks, such as Kenneth, A et al: Chemical Stability of Pharmaceuticals: A Handbook for Pharmacists and Peters et al, Pharmacokinete analysis: A Practical Approach (1996). Reference is also made to “Pharmacokinetics”, M Gibaldi & D Perron, published by Marcel Dekker, 2nd Rev. edition (1982). Similarly, the terms “increase in half-life” or “increased half-life” are also as defined in paragraph o) on page 57 of WO 2008/020079 and in particular refer to an increase in the t½-beta, either with or without an increase in the t½-alpha and/or the AUC or both.

(26) When a term is not specifically defined herein, it has its usual meaning in the art, which will be clear to the skilled person. Reference is for example made to the standard handbooks, such as Sambrook et al, “Molecular Cloning: A Laboratory Manual” (2nd. Ed.), Vols. 1-3, Cold Spring Harbor Laboratory Press (1989); F. Ausubel et al, eds., “Current protocols in molecular biology”, Green Publishing and Wiley Interscience, New York (1987); Lewin, “Genes II”, John Wiley & Sons, New York, N.Y., (1985); Old et al., “Principles of Gene Manipulation: An Introduction to Genetic Engineering”, 2nd edition, University of California Press, Berkeley, Calif. (1981); Roitt et al., “Immunology” (6th. Ed.), Mosby/Elsevier, Edinburgh (2001); Roitt et al., Roitt's Essential Immunology, 10th Ed. Blackwell Publishing, U K (2001); and Janeway et al., “Immunobiology” (6th Ed.), Garland Science Publishing/Churchill Livingstone, New York (2005), as well as to the general background art cited herein.

(27) For a general description of multivalent and multispecific polypeptides containing one or more Nanobodies and their preparation, reference is also made to Conrath et al., J. Biol. Chem., Vol. 276, 10. 7346-7350, 2001; Muyldermans, Reviews in Molecular Biotechnology 74 (2001), 277-302; as well as to for example WO 1996/34103, WO 1999/23221, WO 2004/041862, WO 2006/122786, WO 2008/020079, WO 2008/142164 or WO 2009/068627.

(28) “Isolated” CTLA4 binders (e.g., ISVD such as a Nanobody), polypepotides, polynucleotides and vectors, are at least partially free of other biological molecules from the cells or cell culture from which they are produced. Such biological molecules include nucleic acids, proteins, lipids, carbohydrates, or other material such as cellular debris and growth medium. An “isolated” CTLA4 binder may further be at least partially free of expression system components such as biological molecules from a host cell or of the growth medium thereof. Generally, the term “isolated” is not intended to refer to a complete absence of such biological molecules or to an absence of water, buffers, or salts or to components of a pharmaceutical formulation that includes the antibodies or fragments.

(29) The phrase “control sequences” refers to polynucleotides necessary for the expression of an operably linked coding sequence in a particular host organism. The control sequences that are suitable for prokaryotes, for example, include a promoter, optionally an operator sequence, and a ribosome binding site. Eukaryotic cells are known to use promoters, polyadenylation signals, and enhancers.

(30) A nucleic acid or polynucleotide is “operably linked” when it is placed into a functional relationship with another polynucleotide. For example, DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation. Generally, but not always, “operably linked” means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.

(31) “Human serum albumin binders” or “HSA binders” of the present invention are any of the molecules described herein that bind to HSA (e.g., an ISVD such as a Nanobody) as well as any antibody or antigen-binding fragment thereof that binds to HSA and includes any of the HSA binding moieties described herein. An individual HSA binder may be referred to has a HSA binding moiety if it is part of a larger molecule, e.g., a multivalent molecule such as F023700912 or F023700914

(32) In general, the basic antibody structural unit comprises a tetramer. Each tetramer includes two identical pairs of polypeptide chains, each pair having one “light” (about 25 kDa) and one “heavy” chain (about 50-70 kDa). The amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The carboxy-terminal portion of the heavy chain may define a constant region primarily responsible for effector function. Typically, human light chains are classified as kappa and lambda light chains. Furthermore, human heavy chains are typically classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively. Within light and heavy chains, the variable and constant regions are joined by a “J” region of about 12 or more amino acids, with the heavy chain also including a “D” region of about 10 more amino acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989).

(33) Examples of antigen-binding fragments include, but are not limited to, Fab, Fab′, F(ab′).sub.2, and Fv fragments, and single-chain Fv molecules.

(34) The following properties are associated with the indicated mutations in the CTLA4 binder 11F01:

(35) E1D: Prevent pyroglutamic acid formation in the first amino acid of the construct E1

(36) L11V: Decrease pre-antibody binding

(37) A14P: Humanization

(38) Q45R: Mutated to increase stability

(39) A74S: Humanization

(40) K83R: Humanization

(41) 189L: Decrease pre-antibody binding

(42) M96P, Q or R: Prevent oxidation of M96

(43) Q108L: Humanization

(44) In an embodiment of the invention, CTLA4 is human CTLA4. In an embodiment of the invention, human CTLA4 comprises the amino acid sequence:

(45) TABLE-US-00002 (SEQ ID NO: 111) MACLGFQRHK AQLNLATRTW PCTLLFFLLF IPVFCKAMHV AQPAVVLASS RGIASFVCEY ASPGKATEVR VTVLRQADSQ VTEVCAATYM MGNELTFLDD SICTGTSSGN QVNLTIQGLR AMDTGLYICK VELMYPPPYY LGIGNGTQIY VIDPEPCPDS DFLLWILAAV SSGLFFYSFL LTAVSLSKML KKRSPLTTGV YVKMPPTEPE CEKQFQPYFI PIN

CTLA4 Binders

(46) The present invention aims to provide improved CTLA4 binders, in particular improved CTLA4 ISVDs and more in particular improved CTLA4 Nanobodies. CTLA4 binders of the present invention include polypeptides which are variants of polypeptides comprising the amino acid sequence of SEQ ID NO: 1 which is mutated at position such as 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112.

(47) A CTLA4 binder or CTLA4 ISVD or CTLA4 Nanobody refers to a binder, ISVD or Nanobody, respectively, that binds to CTLA4.

(48) The improved CTLA4 binders provided by the invention are also referred to herein as the “CTLA4 binders of the invention” or “CTLA4 binders”. These terms encompass any molecule comprising a molecule that is set forth herein which binds to CTLA4. For example, the terms include an ISVD that comprises an amino acid sequence set forth in a member selected from the group consisting of SEQ ID NOs: 8-43 and 60 as well as any polypeptide, Nanobody, ISVD, fusion protein, conventional antibody or antigen-binding fragment thereof that includes an amino acid sequence set forth in a member selected from the group consisting of SEQ ID NOs: 8-43 and 60; or any bispecific molecule (e.g., an ISVD) that comprises an amino acid sequence set forth in a member selected from the group consisting of SEQ ID NOs: 8-43 and 60, binds to CTLA4 and also binds to another antigen or another epitope such as CD27, LAG3, PD1, or BTLA. A CTLA4 binder of the present invention is F023700912 or F023700914.

(49) The scope of the present invention includes any CTLA4 binder comprising the arrangement of binding moieties set forth in FIG. 11, optionally lacking the FLAG3 and/or HIS6 tags; as well as any of the amino acid sequences set forth in FIG. 12.

(50) WO 2008/071447 describes Nanobodies that can bind to CTLA4 and uses thereof. SEQ ID NO: 1306 of WO 2008/071447 disclosed a CTLA4 specific Nanobody called 11F01, the sequence of which is given herein as SEQ ID NO: 1. This sequence (also referred to herein as “Reference A”) and its CDRs are also given in Table A-1 below.

(51) As further described herein, the CTLA4 binders of the invention which are, in an embodiment of the invention in multivalent and/or multispecific CTLA4 binders of the present invention (e.g., F023700914), preferably have the same combination of CDRs (i.e. CDR1, CDR2 and CDR3) as are present in 11F01 or in a binder comprising the sequence of 11F01 (SEQ ID NO: 1). See Table A-1.

(52) The present invention also includes CTLA4 binders which are variants of 11F01 which comprise an amino acid sequence as set forth below in Table A-2 below. The scope of the present invention includes CTLA4 binders that include CDR1, CDR2 and CDR3 of said varaints set forth below in Table A-2.

(53) In addition, the present invention multispecific and/or multivalent binders (e.g., F023700914) comprising a CTLA4 binding moiety that includes CDR1, CDR2 and CDR3 or the amino acid sequence of 11F01 or of one of its varaints set forth below in Table A-2.

(54) TABLE-US-00003 TABLE A-1 CTLA4 Nanobody 11F1 (11F01). SEQ ID NO Description Sequence 1 Reference A EVQLVESGGGLVQAGGSLRLSCAASGGT WO 2008/071447 FSFYGMGWFRQAPGKEQEFVADIRTSAG SEQ ID NO: 1306 RTYYADSVKGRFTISRDNAKNTVYLQMN (11F01 or SLKPEDTAVYYCAAEMSGISGWDYWGQG 4CTLA011F01) TQVTVSS

(55) TABLE-US-00004 TABLE A-2 Variant CTLA4 Nanobody 11F1. 60 11F01 (E1D, DVQLVESGGGVVQPGGSLRLSCAASGGTFSFYG L11V, A14P, MGWFRQAPGKEREFVADIRTSAGRTYYADSVKG Q45R, A74S, RFTISRDNSKNTVYLQMNSLRPEDTALYYCAAE K83R, V89L, PSGISGWDYWGQGTLVTVSS M96P, Q108L) (F023700906)  2 CDR1 (Kabat) FYGMG (amino acids 6-10 of SEQ ID NO: 5)  3 CDR2 (Kabat) DIRTSAGRTYYADSVKG  4 CDR3 EXSGISGWDY; wherein X is M or P (Kabat/Abm) (e.g., EmSGISGWDY (SEQ ID NO: 115) or EpSGISGWDY (SEQ ID NO: 116))  5 CDR1 (Abm) GGTFSFYGMG  6 CDR2 (Abm) DIRTSAGRTY (amino acids 1-10 of SEQ ID NO: 3)  7 CDR3 EXSGISGWDY; wherein X is M or P (Kabat/Abm) (e.g., EmSGSIGWDY (SEQ ID NO: 115) or EpSGSIGWDY (SEQ ID NO: 116)) Note: SEQ ID NO: 4 is identical to SEQ ID NO: 7 *CDRs underscored and/or bold

(56) Residue 1 of SEQ ID NO: 60 can be D or E. If residue 1 is D, the CTLA4 binder may be designated as 1D and if residue 1 is E, the CTLA4 binder may be designated as 1E.

(57) In an embodiment of the invention, a CTLA4 binder of the present invention comprises an N73X mutation wherein X is any amino acid other than N, e.g., S, V, G, R, Q, M, H, T, D, E, W, F, K, A, Y or P (or any amino acid other than N).

(58) The present invention includes CTLA4 binders comprising one, two or three of the CDRs of a CTLA4 binder wherein each comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid substitutions, e.g., conservative substitutions, and/or comprises 100, 99, 98, 97, 96 or 95% sequence identity relative to the CDRs that are in the CTLA4 binder sequences set forth of Table A-1 or A-2 (e.g., 11F01 (E1D, L11V, A14P, Q45R, A74S, K83R, V89L, M96P, Q108L) or 11F01), or are set forth in SEQ ID NOs: 2-7, wherein a CTLA4 binder having such CDRs retains the ability to bind to CTLA4.

(59) The Kabat residue numbers for certain residues of the CTLA4 binders (e.g., ISVD such as a Nanobody) that are based on Reference A which are set forth herein are shown in the sequence below:

(60) TABLE-US-00005 (SEQ ID NO: 1) custom character VQLVESGGGcustom character GGSLRLSCAAS custom character FYGMG custom character APGKEcustom character DIRTSAGRTYYADSVKG custom character KNTVYLQMcustom character custom character CAAEcustom character SGISGWDY custom character

(61) The Kabat residue numbers for certain residues of the CTLA4 binder 11F01 (E1D, L11V, A14P, Q45R, A74S, K83R, V89L, M96P, Q108L) which are set forth herein are shown in the sequence below:

(62) TABLE-US-00006 (SEQ ID NO: 117) custom character VQLVESGGG custom character VQcustom character GGSLRLSCAASGGTFSFYGMGWFRQAPG KE custom character EFVADIRTSAGRTYYADSVKGRFTISRDN custom character KNTVYLQMNS L custom character PEDTA custom character YYCAAE custom character SGISGWDYWGQGTcustom character VTVSS

(63) The present invention includes any CTLA4 binder comprising the amino acid sequence of SEQ ID NO: 60 or an amino acid sequence comprising 80% or more (e.g., 85%, 90%, 95%, 96%, 97%, 98% or 99%) amino acid sequence identity wherein the CTLA4 binder retains the ability to bind to CTLA4.

(64) The present invention includes embodiments wherein the CDR3 methionine of a CTLA4 binder, at Kabat position 96, is substituted with any amino acid such as Proline (but not with Cys, Asp or Asn), e.g., with any of the following amino acids: Leu, Ile, Val, Ala, Gly, Tyr, Trp, Phe, Glu, Gln, Ser, Thr, His, Arg, Lys or Pro.

(65) Some preferred, but non-limiting CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention are SEQ ID NO: 60 or are listed in FIG. 2 as SEQ ID NOs: 8-43. FIG. 3 shows an alignment of these sequences with Reference A (SEQ ID NO: 1). Of these CTLA4 binders, the binders of SEQ ID NOs:26-43 are examples of CTLA4 binders of the invention having a C-terminal alanine extension, i.e. an alanine residue at the C-terminal end of the ISVD-sequence (also sometimes referred to as “position 114”) compared to the usual C-terminal sequence VTVSS (SEQ ID NO: 57, as present in Reference A). As described in WO 2012/175741 (but also for example in WO 2013/024059 and PCT/EP2015/060643 (WO2015/173325)), this C-terminal alanine extension can prevent the binding of so-called “pre-existing antibodies” (assumed to be IgGs) to a putative epitope that is situated at the C-terminal region of the ISV. This epitope is assumed to include, among other residues, the surface-exposed amino acid residues of the C-terminal sequence VTVSS (SEQ ID NO: 57) as well as the amino acid residue at position 14 (and the amino acid residues next/close to the same in the amino acid sequence, such as positions 11, 13 and 15) and may also comprise the amino acid residue at position 83 (and the amino acid residues next/close to the same in the amino acid sequence, such as positions 82, 82a, 82b and 84) and/or the amino acid residue at position 108 (and the amino acid residues next/close to the same in the amino acid sequence, such as position 107).

(66) However, although the presence of such a C-terminal alanine (or a C-terminal extension generally) can greatly reduce (and in a lot of cases even essentially fully prevent) the binding of the “pre-existing antibodies” that can be found in the sera from a range of subjects (both healthy subjects as well as patients), it has been found that the sera from some subjects (such as the sera from patients with some immune diseases such as SLE) can contain pre-existing antibodies that can bind to the C-terminal region of an ISV (when such region is exposed) even when the ISV contains such a C-terminal alanine (or more generally, such C-terminal extension). Reference is again made to the co-pending non-prepublished PCT application PCT/EP2015/060643 (WO2015/173325) by Ablynx N. V. filed on May 13, 2015 and entitled “Improved immunoglobulin variable domains”.

(67) Accordingly, one specific objective of the invention is to provide CTLA4 binders (e.g., ISVD such as a Nanobody) that are improved variants of the CTLA4 Nanobody referred to herein as “Reference A” and that have reduced binding by so-called “pre-existing antibodies”, and in particular of the kind described in PCT/EP2015/060643 (WO2015/173325) (i.e. those pre-existing antibodies that can bind to an exposed C-terminal region of an ISV even in the presence of a C-terminal extension).

(68) The invention provides CTLA4 binders comprising amino acid sequences that are variants of the sequence of SEQ ID NO: 1 which comprise one or more of the following mutations compared to the sequence of SEQ ID NO: 1: 1D or 1E; 11V; 14P; 45R; 74S; 83R; 89L or 89T; 96P; or 108L;
for example, wherein the CTLA4 binder comprises one or more of the sets of mutations below: 89L in combination with 11V; 14P; 45R; 74S; 83R; 86P; 108L and 1E or 1D; 89L in combination with 11V; 89L in combination with 110K or 110Q; 89L in combination with 112K or 112Q; 89L in combination with 11V; 14P; 45R; 74S; 83R; 86P; 108L, 110K or 110Q and 1E or 1D; 89L in combination with 11V; 14P; 45R; 74S; 83R; 86P; 108L, 112K or 112Q and 1E or 1D; 89L in combination with 11V and 110K or 110Q; 89L in combination with 11V and 112K or 112Q; 11V in combination with 110K or 110Q; and/or 11V in combination with 112K or 112Q.

(69) In particular, in an embodiment of the invention, CTLA4 binders (e.g., ISVD such as a Nanobody) comprise: the amino acid at position 1 is preferably E or D; the amino acid at position 11 is preferably L or V; the amino acid at position 14 is preferably A or P; the amino acid at position 45 is preferably Q or R; the amino acid at position 74 is preferably A or S; the amino acid at position 83 is preferably K or R; the amino acid at position 89 is preferably T, V or L; the amino acid at position 96 is preferably M or P; the amino acid at position 108 is preferably Q or L; the amino acid residue at position 110 is preferably suitably chosen from T, K or Q; and the amino acid residue at position 112 is preferably suitably chosen from S, K or Q; such that, for example, one or more of the following is true: (i) position 89 is T; (ii) position 89 is L; (iii) position 1 is D or E, position 11 is V, position 14 is P, position 45 is R, position 74 is S, position 83 is R, position 89 is L, position 96 is P, and position 108 is L; (iv) position 89 is L and position 11 is V; (v) position 89 is L and position 110 is K or Q; (vi) position 89 is L and position 112 is K or Q; (vii) position 1 is D or E, position 11 is V, position 14 is P, position 45 is R, position 74 is S, position 83 is R, position 89 is L, position 96 is P, position 108 is L; and position 110 is K or Q; (viii) position 1 is D or E, position 11 is V, position 14 is P, position 45 is R, position 74 is S, position 83 is R, position 89 is L, position 96 is P, position 108 is L; and position 112 is K or Q; (ix) position 89 is L and position 11 is V and position 110 is K or Q; (x) position 89 is L and position 11 is V and position 112 is K or Q; (xi) position 11 is V and position 110 is K or Q; or (xii) position 11 is V and position 112 is K or Q.

(70) In particular embodiments, the CTLA4 binders (e.g., an ISVD such as a Nanobody) of the invention comprise amino acid sequences that are variants of SEQ ID NO: 1 in which position 89 is T or in which position 1 is D, position 11 is V, position 14 is P, position 45 is R, position 74 is S, position 83 is R, position 89 is L, position 96 is P and position 108 is L or in which position 11 is V and position 89 is L (optionally in suitable combination with a 110K or 110Q mutation and/or a 112K or 112Q mutation, and in particular in combination with a 110K or 110Q mutation) are particularly preferred. Even more preferred are amino acid sequences in which position 11 is V and position 89 is L, optionally with a 110K or 110Q mutation.

(71) As mentioned, the CTLA4 binders (e.g., ISVD such as a Nanobody) described herein can bind (and in particular, can specifically bind) to CTLA4. In an embodiment of the invention, CTLA4 binders can bind to CTLA4 and thereby prevent CD80, and CD86 on antigen-presenting cells from binding to CTLA-4 on T cells. In an embodiment of the invention, the resulting blockade of CTLA-4 signaling prolongs T-cell activation, restores T-cell proliferation, and thus amplifies T-cell-mediated immunity, which theoretically enhances the patient's capacity to mount an antitumor immune response.

(72) In an embodiment of the invention, a CTLA4 binder of the present invention, has one or more of the following properties: Binds to CTLA4 (e.g., human and/or cynomolgous monkey CTLA4 (CTLA4-Fc fusion protein), e.g., with a K.sub.D of about 1 nM (e.g., 1.2 nM); Binds to CTLA4 on the surface of a cell, e.g., a CHO cell expressing CTLA4; Blocks binding of CD80 or CD86 to CTLA4 (e.g., CTLA4 expressed on CHO cells); Does not bind to BTLA, CD8, PD1, LAG3, and/or CD28; Binds in vitro and/or in vivo to human, rhesus monkey and mouse serum albumin (when fused to one or more ALB 11002 binders); Inhibits tumor growth (e.g., of pancreatic tumors, e.g., human pancreatic tumors in a mouse harboring human immune cells)

(73) Table B lists some non-limiting possible combinations of the amino acid residues that can be present at positions 11, 89, 110 and 112 (of SEQ ID NO: 1) in the CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention.

(74) TABLE-US-00007 TABLE B Possible Combinations of Mutations at Amino  Acid Positions 11, 89, 110 and 112 in CTLA4  Binder Variants of SEQ ID NO: 1. POSITION 11 89 110 112 Combination L T T S L T T K L T T Q L T K S L T Q S L V T K L V T Q L V K S L V Q S L L T K L L T Q L L K S L L Q S V T T S V T T K V T T Q V T K S V T Q S V V T K V V T Q V V K S V V Q S V L T S V L T K V L T Q V L K S V L Q S

(75) The CTLA4 binders (e.g., ISVD such as a Nanobody) provided by the invention are further as described in the description, examples and figures herein, i.e. they have CDRs that are as described herein and have an overall degree of sequence identity (as defined herein) with the sequence of SEQ ID NO: 1 that is as disclosed herein and/or may have a limited number of “amino acid differences” (as described herein) with (one of) these reference sequences.

(76) The CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention preferably comprise the following CDRs (according to the Kabat convention): a CDR1 (according to Kabat) that comprises the amino acid sequence FYGMG (SEQ ID NO: 2); and a CDR2 (according to Kabat) that comprises the amino acid sequence DIRTSAGRTYYADSVKG (SEQ ID NO: 3); and a CDR3 (according to Kabat) that comprises the amino acid sequence EPSGISGWDY (SEQ ID NO: 116); optionally, wherein CDR1, CDR2 and/or CDR3 comprises 1, 2, 3, 4, 5, 5, 6, 7, 8, 9 or 10 substitutions, e.g., conservative substitutions.

(77) Alternatively, when the CDRs are given according to the Abm convention, the CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention preferably comprise the following CDRs: a CDR1 (according to Abm) that is the amino acid sequence GGTFSFYGMG (SEQ ID NO: 5); and a CDR2 (according to Abm) that is the amino acid sequence DIRTSAGRTY (SEQ ID NO: 6); and a CDR3 (according to Abm) that is the amino acid sequence EPSGISGWDY (SEQ ID NO: 116, which is the same as SEQ ID NO: 4 when X is P); optionally, wherein CDR1, CDR2 and/or CDR3 comprises 1, 2, 3, 4, 5, 5, 6, 7, 8, 9 or 10 substitutions, e.g., conservative substitutions.

(78) A CTLA4 binder (e.g., ISVD such as a Nanobody) of the invention, in an embodiment of the invention, has such CDRs and mutations at positions 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112, as discussed herein and, optionally: a degree of sequence identity with the amino acid sequence of SEQ ID NO: 1 of at least 85%, preferably at least 90%, more preferably at least 95% (in which the CDRs, any C-terminal extension that may be present, as well as the mutations at positions 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 required by the specific aspect involved are not taken into account for determining the degree of sequence identity) when the comparison is performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences (e.g., expect threshold: 10; word size: 3; max matches in a query range: 0; BLOSUM 62 matrix; gap costs: existence 11, extension 1; conditional compositional score matrix adjustment); and/or no more than 7, such as no more than 5, preferably no more than 3, such as only 3, 2 or 1 “amino acid differences” with the amino acid sequence of SEQ ID NO: 1 (in which said amino acid differences, if present, may be present in the frameworks and/or the CDRs but are preferably present only in the frameworks and not in the CDRs; not taking into account any C-terminal extension that may be present and not taking into account the mutations at positions 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 required by the specific aspect involved).

(79) The following references relate to BLAST algorithms often used for sequence analysis: BLAST ALGORITHMS: Altschul et al. (2005) FEBS J. 272(20): 5101-5109; Altschul, S. F., et al., (1990) J. Mol. Biol. 215:403-410; Gish, W., et al., (1993) Nature Genet. 3:266-272; Madden, T. L., et al., (1996) Meth. Enzymol. 266:131-141; Altschul, S. F., et al., (1997) Nucleic Acids Res. 25:3389-3402; Zhang, J., et al., (1997) Genome Res. 7:649-656; Wootton, J. C., et al., (1993) Comput. Chem. 17:149-163; Hancock, J. M. et al., (1994) Comput. Appl. Biosci. 10:67-70; ALIGNMENT SCORING SYSTEMS: Dayhoff, M. O., et al., “A model of evolutionary change in proteins.” in Atlas of Protein Sequence and Structure, (1978) vol. 5, suppl. 3. M. O. Dayhoff (ed.), pp. 345-352, Natl. Biomed. Res. Found., Washington, D.C.; Schwartz, R. M., et al., “Matrices for detecting distant relationships.” in Atlas of Protein Sequence and Structure, (1978) vol. 5, suppl. 3.” M. O. Dayhoff (ed.), pp. 353-358, Natl. Biomed. Res. Found., Washington, D.C.; Altschul, S. F., (1991) J. Mol. Biol. 219:555-565; States, D. J., et al., (1991) Methods 3:66-70; Henikoff, S., et al., (1992) Proc. Natl. Acad. Sci. USA 89:10915-10919; Altschul, S. F., et al., (1993) J. Mol. Evol. 36:290-300; ALIGNMENT STATISTICS: Karlin, S., et al., (1990) Proc. Natl. Acad. Sci. USA 87:2264-2268; Karlin, S., et al., (1993) Proc. Natl. Acad. Sci. USA 90:5873-5877; Dembo, A., et al., (1994) Ann. Prob. 22:2022-2039; and Altschul, S. F. “Evaluating the statistical significance of multiple distinct local alignments.” in Theoretical and Computational Methods in Genome Research (S. Suhai, ed.), (1997) pp. 1-14, Plenum, New York.

(80) With regards to the various aspects and preferred aspects of the CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention provided by the invention, when it comes to the degree of sequence identity with respect to SEQ ID NO: 1 and/or the number and kind of “amino acid differences” that may be present in such a binder of the invention (i.e. compared to the sequence of SEQ ID NO: 1), it should be noted that, when it is said that: (i) an amino acid sequence of the invention has a degree of sequence identity with the sequence of SEQ ID NO: 1 of at least 85%, preferably at least 90%, more preferably at least 95% (in which the CDRs, any C-terminal extension that may be present, as well as the mutations at positions 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 required by the specific aspect involved, are not taken into account for determining the degree of sequence identity) when the comparison is performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences (e.g., expect threshold: 10; word size: 3; max matches in a query range: 0; BLOSUM 62 matrix; gap costs: existence 11, extension 1; conditional compositional score matrix adjustment);
and/or when it is said that: (ii) an amino acid sequence of the invention has no more than 7, preferably no more than 5, such as only 3, 2 or 1 “amino acid differences” with the sequence of SEQ ID NO: 1 (again, not taking into account any C-terminal extension that may be present and not taking into account the mutations at positions 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 required by the specific aspect involved),
then this also includes sequences that have no amino acid differences with the sequence of SEQ ID NO: 1 other than the mutations at positions 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 required by the specific aspect involved) and any C-terminal extension that may be present.

(81) Thus, in one specific aspect of the invention, the CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention comprises the amino acid sequence of SEQ ID NO: 1 but wherein at least 1 amino acid mutation at position 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 is substituted (e.g., conservatively substituted) and may have 100% sequence identity with SEQ ID NO: 1 (including the CDRs, but not taking into account the mutation(s) or combination of mutations at positions 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 disclosed herein and/or any C-terminal extension that may be present) and/or may have no amino acid differences with SEQ ID NO: 1 (i.e., other than the mutation(s) or combination of mutations at positions 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 disclosed herein and any C-terminal extension that may be present).

(82) When any amino acid differences are present (i.e. besides any C-terminal extension and the mutations at positions 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 that are required by the specific aspect of the invention involved), these amino acid differences may be present in the CDRs and/or in the framework regions, but they are preferably present only in the framework regions (as defined by the Abm convention, i.e. not in the CDRs as defined according to the Abm convention), i.e. such that the CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention have the same CDRs (defined according to the Abm convention) as are present in SEQ ID NO: 1 or 60.

(83) Also, when a CTLA4 binder (e.g., ISVD such as a Nanobody) of the invention according to any aspect of the invention has one or more amino acid differences with the sequence of SEQ ID NO: 1 (besides the mutations at positions 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 that are required by the specific aspect involved), then some specific, but non-limiting examples of such mutations/amino acid differences that may be present (i.e. compared to the sequences of SEQ ID NO: 1) are for example E1D, P41A, P41L, P41S or P41T (and in particular P41A) and/or T87A (e.g., E1D (optional), L11V, A14P, Q45R, A74S, K83R, V89L, M96P and Q108L). Other examples of mutations are (a suitable combination of) one or more suitable “humanizing” substitutions such as Q108L; reference is for example made to WO 2009/138519 (or in the prior art cited in WO 2009/138519) and WO 2008/020079 (or in the prior art cited in WO 2008/020079), as well as Tables A-3 to A-8 from WO 2008/020079 (which are lists showing possible humanizing substitutions). Preferably, the CTLA4 binders of the invention contain at least a Q108L humanizing substitution.

(84) Also, when the CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention are present at and/or form the N-terminal part of the CTLA4 binder in which they are present, then they preferably contain a D at position 1 (i.e. an E1D mutation compared to Reference A). Some preferred but non-limiting examples of such N-terminal CTLA4 binders are given as SEQ ID NOs: 24 and 25 and 60. Accordingly, in a further aspect, the invention relates to a polypeptide of the invention (which is as further described herein) that has a CTLA4 binder of the invention (which is as further described herein) at its N-terminal end, wherein said CTLA4 binder of the invention has a D at position 1, and is preferably chosen from the CTLA4 binders of SEQ ID NOs: 24 and 25 and 60.

(85) Similarly, when a CTLA4 binder (e.g., ISVD such as a Nanobody) of the invention is used in monovalent format, it preferably has both a C-terminal extension X(n) as described herein and a D at position 1. Some preferred but non-limiting examples of such monovalent CTLA4 binders are given as SEQ ID NOs: 42 and 43. Accordingly, in a further aspect, the invention relates to a monovalent CTLA4 binder of the invention (which is as further described herein) that has a D at position 1 and a C-terminal extension X(n) (which is preferably a single Ala residue). In one specific aspect, said monovalent CTLA4 binder is chosen from SEQ ID NOs: 42 or 43.

(86) By means of preferred, but non-limiting, examples, SEQ ID NOs: 22-25 and 40-42 and 60 are examples of CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention having further amino acid differences with SEQ ID NO: 1, i.e. A14P, Q45R, A74S, K83R and/or Q108L (in addition, as indicated in the previous paragraphs, SEQ ID NOs: 24, 25, 42 and 43 also have a E1D mutation). Thus, in a specific aspect, the invention relates to CTLA4 binders of the invention (i.e. having mutations at positions 11, 89, 110 and/or 112 as described herein and also further being as described herein) that at least have a suitable combination of an optional E1D mutation, A14P mutation, a Q45R mutation, an A74S mutation, a K83R mutation and a Q108L mutation, and preferably a suitable combination of Q108L with any one of the other A14P, Q45R, A74S and K83R mutations, and preferably in combination with any two of these other mutations, more preferably with any three of these mutations (such as with the combination A14P, A74S and K83R or E1D, L11V, A14P, Q45R, A74S, K83R, V89L, M96P and Q108L), such as with all of these mutations (and again, when the CTLA4 binder is monovalent or present at the N-terminal end of a CTLA4 binder of the invention, preferably also an E1D mutation).

(87) The CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention, when they are used in a monovalent format and/or when a CTLA4 binding moiety is present at and/or forms the C-terminal end of the CTLA4 binder (or when they otherwise have an “exposed” C-terminal end in such a polypeptide, by which is generally meant that the C-terminal end of the ISVD is not associated with or linked to a constant domain (such as a CH1 domain); reference is again made to WO 2012/175741 and PCT/EP2015/060643 (WO 2015/173325)), preferably also have a C-terminal extension of the formula (X).sub.n, in which n is 1 to 10, preferably 1 to 5, such as 1, 2, 3, 4 or 5 (and preferably 1 or 2, such as 1); and each X is an (preferably naturally occurring) amino acid residue that is independently chosen from naturally occurring amino acid residues (although according to preferred one aspect, it does not comprise any cysteine residues), and preferably independently chosen from the group consisting of alanine (A), glycine (G), valine (V), leucine (L) or isoleucine (I).

(88) According to some preferred, but non-limiting examples of such C-terminal extensions X.sub.(n), X and n can be as follows: (a) n=1 and X=Ala; (b) n=2 and each X=Ala; (c) n=3 and each X=Ala; (d) n=2 and at least one X=Ala (with the remaining amino acid residue(s) X being independently chosen from any naturally occurring amino acid but preferably being independently chosen from Val, Leu and/or Ile); (e) n=3 and at least one X=Ala (with the remaining amino acid residue(s) X being independently chosen from any naturally occurring amino acid but preferably being independently chosen from Val, Leu and/or Ile); (f) n=3 and at least two X=Ala (with the remaining amino acid residue(s) X being independently chosen from any naturally occurring amino acid but preferably being independently chosen from Val, Leu and/or Ile); (g) n=1 and X=Gly; (h) n=2 and each X=Gly; (i) n=3 and each X=Gly; (j) n=2 and at least one X=Gly (with the remaining amino acid residue(s) X being independently chosen from any naturally occurring amino acid but preferably being independently chosen from Val, Leu and/or Ile); (k) n=3 and at least one X=Gly (with the remaining amino acid residue(s) X being independently chosen from any naturally occurring amino acid but preferably being independently chosen from Val, Leu and/or Ile); (l) n=3 and at least two X=Gly (with the remaining amino acid residue(s) X being independently chosen from any naturally occurring amino acid but preferably being independently chosen from Val, Leu and/or Ile); (m) n=2 and each X=Ala or Gly; (n) n=3 and each X=Ala or Gly; (o) n=3 and at least one X=Ala or Gly (with the remaining amino acid residue(s) X being independently chosen from any naturally occurring amino acid but preferably being independently chosen from Val, Leu and/or Ile); or (p) n=3 and at least two X=Ala or Gly (with the remaining amino acid residue(s) X being independently chosen from any naturally occurring amino acid but preferably being independently chosen from Val, Leu and/or Ile);
with aspects (a), (b), (c), (g), (h), (i), (m) and (n) being particularly preferred, with aspects in which n=1 or 2 being preferred and aspects in which n=1 being particularly preferred.

(89) It should also be noted that, preferably, any C-terminal extension present in a CTLA4 binder (e.g., ISVD such as a Nanobody) of the invention does not contain a (free) cysteine residue unless said cysteine residue is used or intended for further functionalization, for example for PEGylation.

(90) Some specific, but non-limiting examples of useful C-terminal extensions are the following amino acid sequences: A, AA, AAA, G, GG, GGG, AG, GA, AAG, AGG, AGA, GGA, GAA or GAG.

(91) When the CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention contain mutations at positions 110 or 112 (optionally in combination with mutations at position 1, 11, 14, 45, 74, 83, 89, 96 and/or 108 as described herein) (relative to the amino acid sequence of SEQ ID NO: 1), the C-terminal amino acid residues of framework 4 (starting from position 109) can, in an embodiment of the invention, be as set forth in SEQ ID NO: 1 but wherein the 5 C-terminal residues can be substituted as follows: (i) if no C-terminal extension is present: VTVKS (SEQ ID NO: 45), VTVQS (SEQ ID NO: 46), VKVSS (SEQ ID NO: 47) or VQVSS (SEQ ID NO: 48); or (ii) if a C-terminal extension is present: VTVKSX(n) (SEQ ID NO: 49), VTVQSX(n) (SEQ ID NO: 50), VKVSSX(n) (SEQ ID NO: 51) or VQVSSX(n) (SEQ ID NO: 52), such as VTVKSA (SEQ ID NO: 53), VTVQSA (SEQ ID NO: 54), VKVSSA (SEQ ID NO: 55) or VQVSSA (SEQ ID NO: 56).

(92) When the CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention do not contain mutations at positions 110 or 112 (but only mutations at position 1, 11, 14, 45, 74, 83, 89, 96 and/or 108 as described herein), the C-terminal amino acid residues of framework 4 (starting from position 109) can, in an embodiment of the invention, be as set forth in SEQ ID NO: 1 but wherein the 5 C-terminal residues can be substituted as follows: (i) when no C-terminal extension is present: VTVSS (SEQ ID NO: 57) (as in the sequence of SEQ ID NO: 1); or (ii) when a C-terminal extension is present: VTVSSX(n) (SEQ ID NO: 58) such as VTVSSA (SEQ ID NO: 59). In these C-terminal sequences, X and n are as defined herein for the C-terminal extensions.

(93) Some preferred but non-limiting examples of CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention are given in SEQ ID NOs: 9-43 and 60, and each of these sequences forms a further aspect of the invention (as do proteins, CTLA4 binders, polypeptides or other compounds or constructs that comprise one of these sequences). Of these, the CTLA4 binders of SEQ ID NOs: 9-25 and 60 do not have a C-terminal extension, and the CTLA4 binders of SEQ ID NOs: 26-43 contain a C-terminal alanine (which is a preferred but non-limiting example of a C-terminal extension as described herein).

(94) Examples of CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention comprise the amino acid sequences of SEQ ID NOs: 22, 23, 24, 25, 40, 41, 42, 43 and 60.

(95) Thus, in a first aspect, the invention relates to a CTLA4 binder (e.g., an immunoglobulin single variable domain such as a Nanobody) having: a CDR1 (according to Kabat) that is the amino acid sequence FYGMG (SEQ ID NO: 2); and a CDR2 (according to Kabat) that is the amino acid sequence DIRTSAGRTYYADSVKG (SEQ ID NO: 3); and a CDR3 (according to Kabat) that is the amino acid sequence EPSGISGWDY (SEQ ID NO: 116);
and having: a degree of sequence identity with the amino acid sequence of SEQ ID NO: 1 of at least 85%, preferably at least 90%, more preferably at least 95% (in which the CDRs, any C-terminal extension that may be present, as well as the mutations at positions 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 required by the specific aspect involved are not taken into account for determining the degree of sequence identity) when the comparison is performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences (e.g., expect threshold: 10; word size: 3; max matches in a query range: 0; BLOSUM 62 matrix; gap costs: existence 11, extension 1; conditional compositional score matrix adjustment); and/or;
and/or no more than 7, such as no more than 5, preferably no more than 3, such as only 3, 2 or 1 “amino acid differences” (as defined herein, and not taking into account any of the above-listed mutations at position(s) 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 that may be present and not taking into account any C-terminal extension that may be present) with the amino acid sequence of SEQ ID NO: 1 (in which said amino acid differences, if present, may be present in the frameworks and/or the CDRs but are preferably present only in the frameworks and not in the CDRs);
and optionally having: a C-terminal extension (X).sub.n, in which n is 1 to 10, preferably 1 to 5, such as 1, 2, 3, 4 or 5 (and preferably 1 or 2, such as 1); and each X is an (preferably naturally occurring) amino acid residue that is independently chosen, and preferably independently chosen from the group consisting of alanine (A), glycine (G), valine (V), leucine (L) or isoleucine (I);
wherein, in the amino acid sequence of the CTLA4 binder: the amino acid residue at position 1 is preferably chosen from E or D; the amino acid residue at position 11 is preferably chosen from L or V; the amino acid residue at position 14 is preferably chosen from A or P; the amino acid residue at position 45 is preferably chosen from Q or R; the amino acid residue at position 74 is preferably chosen from A or S; the amino acid residue at position 83 is preferably chosen from K or R; the amino acid residue at position 89 is preferably suitably chosen from T, V or L; the amino acid residue at position 96 is preferably chosen from M or P; the amino acid residue at position 108 is preferably chosen from Q or L; the amino acid residue at position 110 is preferably suitably chosen from T, K or Q; and/or the amino acid residue at position 112 is preferably suitably chosen from S, K or Q; such that, for example, one or more of the following is true: (i) position 1 is E or D; (ii) position 11 is V; (iii) position 14 is P; (iv) position 45 is R; (v) position 74 is S; (vi) position 83 is R; (vii) position 89 is T or L; (viii) position 96 is P; (ix) position 108 is L; and/or for example, wherein the CTLA4 binder comprises one or more of the sets of mutations below a. position 11 is V and position 110 is K or Q; b. position 11 is V and position 112 is K or Q. c. position 89 is L and position 11 is V; d. position 89 is L and position 110 is K or Q; e. position 89 is L and position 112 is K or Q; f. position 89 is L and position 11 is V and position 110 is K or Q; g. position 89 is L and position 11 is V and position 112 is K or Q; h. position 1 is E or D; position 11 is V; position 14 is P; position 45 is R; position 74 is S; position 83 is R; position 89 is L; position 96 is P; and position 108 is L; i. position 1 is E or D; position 11 is V; position 14 is P; position 45 is R; position 74 is S; position 83 is R; position 89 is L; position 96 is P; position 108 is L; and position 110 is K or Q; j. position 1 is E or D; position 11 is V; position 14 is P; position 45 is R; position 74 is S; position 83 is R; position 89 is L; position 96 is P; position 108 is L; and position 112 is K or Q; k. position 1 is E or D; position 11 is V; position 14 is P; position 45 is R; position 74 is S; position 83 is R; position 89 is L; position 96 is P; and position 108 is L.

(96) In a further aspect, the invention relates to a CTLA4 binder (e.g., an immunoglobulin single variable domain such as a Nanobody) having: a CDR1 (according to Kabat) that is the amino acid sequence FYGMG (SEQ ID NO: 2); and a CDR2 (according to Kabat) that is the amino acid sequence DIRTSAGRTYYADSVKG (SEQ ID NO: 3); and a CDR3 (according to Kabat) that is the amino acid sequence EPSGISGWDY (SEQ ID NO: 116.
and having: a degree of sequence identity with the amino acid sequence of SEQ ID NO: 1 of at least 85%, preferably at least 90%, more preferably at least 95% (in which the CDRs, any C-terminal extension that may be present, as well as the mutations at positions 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 required by the specific aspect involved are not taken into account for determining the degree of sequence identity) when the comparison is performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences (e.g., expect threshold: 10; word size: 3; max matches in a query range: 0; BLOSUM 62 matrix; gap costs: existence 11, extension 1; conditional compositional score matrix adjustment);
and/or no more than 7, such as no more than 5, preferably no more than 3, such as only 3, 2 or 1 “amino acid differences” (as defined herein, and not taking into account any of the above-listed mutations at position(s) 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 that may be present and not taking into account any C-terminal extension that may be present) with the amino acid sequence of SEQ ID NO: 1 (in which said amino acid differences, if present, may be present in the frameworks and/or the CDRs but are preferably present only in the frameworks and not in the CDRs);
and optionally having: a C-terminal extension (X).sub.n, in which n is 1 to 10, preferably 1 to 5, such as 1, 2, 3, 4 or 5 (and preferably 1 or 2, such as 1); and each X is an (preferably naturally occurring) amino acid residue that is independently chosen, and preferably independently chosen from the group consisting of alanine (A), glycine (G), valine (V), leucine (L) or isoleucine (I);
which CTLA4 binder (e.g., an immunoglobulin single variable domain such as a Nanobody) comprises one or more of the following amino acid residues (i.e. mutations compared to the amino acid sequence of SEQ ID NO: 1) at the positions mentioned (numbering according to Kabat): 1D or 1E; 11V; 14P; 45R; 74S; 83R; 89T or 89L; 96P; or 108L;
for example, wherein the CTLA4 binder comprises one or more of the sets of mutations below: 1D or 1E in combination with 11V; 14P; 45R; 74S; 83R; 89L; 96P; and 108L; 11V in combination with 110K or 110Q; 11V in combination with 112K or 112Q; 89L in combination with 11V; 89L in combination with 110K or 110Q; 89L in combination with 112K or 112Q; 1D or 1E in combination with 11V; 14P; 45R; 74S; 83R; 89L; 96P; 108L and 110K or 110Q; 1D or 1E in combination with 11V; 14P; 45R; 74S; 83R; 89L; 96P; 108L and 112K or 112Q; 89L in combination with 11V and 110K or 110Q; or 89L in combination with 11V and 112K or 112Q;

(97) As mentioned, when a CTLA4 binder (e.g., ISVD such as a Nanobody) of the invention is used in a monovalent format and/or wherein the CTLA4 binding moiety is present at the C-terminal end of a CTLA4 binder of the invention (as defined herein), the CTLA4 binder preferably has a C-terminal extension X(n), which C-terminal extension may be as described herein for the CTLA4 binders of the invention and/or as described in WO 2012/175741 or PCT/EP2015/060643 (WO2015/173325).

(98) Some preferred, but non-limiting examples of CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention are given in SEQ ID NOs: 8-43 or 60, and each of these amino acid sequences individually forms a further aspect of the invention.

(99) As mentioned, in the invention, amino acid sequences in which position 89 is T; or in which position 1 is E or D, position 11 is V, position 14 is P, position 45 is R, position 74 is S, position 83 is R, position 89 is L, position 96 is P and position 108 is L; or in which position 11 is V and position 89 is L (optionally in suitable combination with a 110K or 110Q mutation and/or a 112K or 112Q mutation, and in particular in combination with a 110K or 110Q mutation) are particularly preferred. Even more preferred are amino acid sequences in which position 11 is V and position 89 is L, optionally with a 110K or 110Q mutation.

(100) Thus, in one preferred aspect, the invention relates to a CTLA4 binder (e.g., an immunoglobulin single variable domain such as a Nanobody) having: a CDR1 (according to Kabat) that is the amino acid sequence FYGMG (SEQ ID NO: 2); and a CDR2 (according to Kabat) that is the amino acid sequence DIRTSAGRTYYADSVKG (SEQ ID NO: 3); and a CDR3 (according to Kabat) that is the amino acid sequence EPSGISGWDY (SEQ ID NO: 116;
and having: a degree of sequence identity with the amino acid sequence of SEQ ID NO: 1 of at least 85%, preferably at least 90%, more preferably at least 95% (in which the CDRs, any C-terminal extension that may be present, as well as the mutations at positions 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 required by the specific aspect involved are not taken into account for determining the degree of sequence identity), when the comparison is performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences (e.g., expect threshold: 10; word size: 3; max matches in a query range: 0; BLOSUM 62 matrix; gap costs: existence 11, extension 1; conditional compositional score matrix adjustment); and/or;
and/or no more than 7, such as no more than 5, preferably no more than 3, such as only 3, 2 or 1 “amino acid differences” (as defined herein, and not taking into account any of the above-listed mutations at position(s) 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 that may be present and not taking into account any C-terminal extension that may be present) with the amino acid sequence of SEQ ID NO: 1 (in which said amino acid differences, if present, may be present in the frameworks and/or the CDRs but are preferably present only in the frameworks and not in the CDRs);
and optionally having: a C-terminal extension (X).sub.n, in which n is 1 to 10, preferably 1 to 5, such as 1, 2, 3, 4 or 5 (and preferably 1 or 2, such as 1); and each X is an (preferably naturally occurring) amino acid residue that is independently chosen, and preferably independently chosen from the group consisting of alanine (A), glycine (G), valine (V), leucine (L) or isoleucine (I);
wherein, in the amino acid sequence of the CTLA4 binder: the amino acid residue at position 1 is preferably chosen from E or D; the amino acid residue at position 11 is preferably chosen from L or V; the amino acid residue at position 14 is preferably chosen from A or P; the amino acid residue at position 45 is preferably chosen from Q or R; the amino acid residue at position 74 is preferably chosen from A or S; the amino acid residue at position 83 is preferably chosen from K or R; the amino acid residue at position 89 is preferably chosen from T, L or V; the amino acid residue at position 96 is preferably chosen from M or P; the amino acid residue at position 108 is preferably chosen from L or Q; the amino acid residue at position 110 is preferably suitably chosen from T, K or Q (and is preferably T); and/or the amino acid residue at position 112 is preferably suitably chosen from S, K or Q (and is preferably S).

(101) In another preferred aspect, the invention relates to a CTLA4 binder (e.g., an immunoglobulin single variable domain such as a Nanobody) having: a CDR1 (according to Kabat) that is the amino acid sequence FYGMG (SEQ ID NO: 2); and a CDR2 (according to Kabat) that is the amino acid sequence DIRTSAGRTYYADSVKG (SEQ ID NO: 3); and a CDR3 (according to Kabat) that is the amino acid sequence EPSGISGWDY (SEQ ID NO: 116;
and having: a degree of sequence identity with the amino acid sequence of SEQ ID NO: 1 of at least 85%, preferably at least 90%, more preferably at least 95% (in which the CDRs, any C-terminal extension that may be present, as well as the mutations at positions 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 required by the specific aspect involved are not taken into account for determining the degree of sequence identity) when the comparison is performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences (e.g., expect threshold: 10; word size: 3; max matches in a query range: 0; BLOSUM 62 matrix; gap costs: existence 11, extension 1; conditional compositional score matrix adjustment);
and/or no more than 7, such as no more than 5, preferably no more than 3, such as only 3, 2 or 1 “amino acid differences” (as defined herein, and not taking into account any of the above-listed mutations at position(s) 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 that may be present and not taking into account any C-terminal extension that may be present) with the amino acid sequence of SEQ ID NO: 1 (in which said amino acid differences, if present, may be present in the frameworks and/or the CDRs but are preferably present only in the frameworks and not in the CDRs);
and optionally having: a C-terminal extension (X).sub.n, in which n is 1 to 10, preferably 1 to 5, such as 1, 2, 3, 4 or 5 (and preferably 1 or 2, such as 1); and each X is an (preferably naturally occurring) amino acid residue that is independently chosen, and preferably independently chosen from the group consisting of alanine (A), glycine (G), valine (V), leucine (L) or isoleucine (I);
in which, for example, the CTLA4 binder comprises one or more mutations according to the following: the amino acid residue at position 1 is E or D; the amino acid residue at position 11 is V; the amino acid residue at position 14 is P; the amino acid residue at position 45 is R; the amino acid residue at position 74 is S; the amino acid residue at position 83 is R; the amino acid residue at position 89 is L; the amino acid residue at position 96 is P; the amino acid residue at position 108 is L; the amino acid residue at position 110 is preferably chosen from T, K or Q; or the amino acid residue at position 112 is preferably chosen from S, K or Q.

(102) In one specific, but non-limiting aspect, the CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention comprise the one or more of following sets of mutations (i.e. mutations compared to the sequence of SEQ ID NO: 1) at the positions mentioned (numbering according to Kabat): 11V in combination with 89L; 11V in combination with 110K or 110Q; 11V in combination with 112K or 112Q; 11V in combination with 89L and 110K or 110Q; 11V in combination with 89L and 112K or 112Q; 11V in combination with 1D or 1E, 14P, 45R, 74S, 83R, 89L, 96P, 108L and 110K or 110Q; 11V in combination with 1D or 1E, 14P, 45R, 74S, 83R, 89L, 96P, 108L and 112K or 112Q; or 11V in combination with 1D or 1E, 14P, 45R, 74S, 83R, 89L, 96P and 108L.
and have CDRs which are in a CTLA4 binder of Table A, e.g., in SEQ ID NO: 1 or SEQ ID NO: 60 (e.g., according to Kabat) and have an overall degree of sequence identity with the amino acid sequence of SEQ ID NO: 1 that are as described herein.

(103) In another specific, but non-limiting aspect, the CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention comprise one or more of the following sets of mutations (i.e. mutations compared to the sequence of SEQ ID NO: 1) at the positions mentioned (numbering according to Kabat): 89L in combination with 11V; 89L in combination with 110K or 110Q; 89L in combination with 112K or 112Q; 89L in combination with 11V and 110K or 110Q; 89L in combination with 11V and 112K or 112Q; 89L in combination with 1D or 1E, 11V, 14P, 45R, 74S, 83R, 96P and 108L; 89L in combination with 1D or 1E, 11V, 14P, 45R, 74S, 83R, 96P, 108L and 110K or 110Q; or 89L in combination with 1D or 1E, 11V, 14P, 45R, 74S, 83R, 96P, 108L and 112K or 112Q,
and have CDRs which are in a CTLA4 binder of Table A, e.g., in SEQ ID NO: 1 or SEQ ID NO: 60 (e.g., according to Kabat) and have an overall degree of sequence identity with the amino acid sequence of SEQ ID NO: 1 that are as described herein.

(104) In another specific, but non-limiting aspect, the CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention comprise one or more of the following amino acid sets of mutations (i.e. mutations compared to the sequence of SEQ ID NO: 1) at the positions mentioned (numbering according to Kabat): 110K or 110Q in combination with 11V; 110K or 110Q in combination with 89L; 110K or 110Q in combination with 11V and 89L; 110K or 110Q in combination with 1D or 1E, 11V, 14P, 45R, 74S, 83R, 89L, 96P and 108L.
and have CDRs which are in a CTLA4 binder of Table A, e.g., in SEQ ID NO: 1 or SEQ ID NO: 60 (e.g., according to Kabat) and have an overall degree of sequence identity with the amino acid sequence of SEQ ID NO: 1 that are as described herein.

(105) In another specific, but non-limiting aspect, the CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention comprise one or more of the following sets of mutations (i.e. mutations compared to the sequence of SEQ ID NO: 1) at the positions mentioned (numbering according to Kabat): 112K or 112Q in combination with 11V; 112K or 112Q in combination with 89L; or 112K or 112Q in combination with 11V and 89L; or 112K or 112Q in combination with 1D or 1E, 11V, 14P, 45R, 74S, 83R, 89L, 96P and 108L.
and have CDRs which are in a CTLA4 binder of Table A, e.g., in SEQ ID NO: 1 or SEQ ID NO: 60 (e.g., according to Kabat) and have an overall degree of sequence identity with the amino acid sequence of SEQ ID NO: 1 that are as described herein.

(106) In another aspect, the CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention comprise a T at position 89 and have CDRs such as those set forth in SEQ ID NO: 60 (e.g., according to Kabat) and have an overall degree of sequence identity with the amino acid sequence of SEQ ID NO: 1 that are as described herein.

(107) In another aspect, the CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention comprise a V at position 11 and an L at position 89 and have CDRs such as those set forth in SEQ ID NO: 1 or 60 (e.g., according to Kabat) and have an overall degree of sequence identity with the amino acid sequence of SEQ ID NO: 1 that are as described herein.

(108) As mentioned, the CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention according to the above aspects preferably further contain a suitable combination of an E1D mutation, L11V mutation, A14P mutation, a Q45R mutation, an A74S mutation, a K83R mutation, a V89L mutation, an M96P mutation and a Q108L mutation, and, in an embodiment of the invention, a suitable combination of Q108L with any one of the other A14P, Q45R, A74S and K83R mutations, and, in an embodiment of the invention, in combination with any two of these other mutations, more preferably with any three of these mutations (such as with the combination A14P, A74S and K83R), such as with all four of these mutations (and again, when the CTLA4 binder is monovalent or present at the N-terminal end of a CTLA4 binder of the invention, preferably also an E1D mutation).

(109) In another aspect, the invention relates to a CTLA4 binder (e.g., an immunoglobulin single variable domain such as a Nanobody) having: a CDR1 (according to Abm) that is the amino acid sequence GGTFSFYGMG (SEQ ID NO: 5); and a CDR2 (according to Abm) that is the amino acid sequence DIRTSAGRTY (SEQ ID NO: 6); and a CDR3 (according to Abm) that is the amino acid sequence EPSGISGWDY (SEQ ID NO: 116;
and having: a degree of sequence identity with the amino acid sequence of SEQ ID NO: 1 of at least 85%, preferably at least 90%, more preferably at least 95% (in which the CDRs, any C-terminal extension that may be present, as well as the mutations at positions 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 required by the specific aspect involved are not taken into account for determining the degree of sequence identity) when the comparison is performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences (e.g., expect threshold: 10; word size: 3; max matches in a query range: 0; BLOSUM 62 matrix; gap costs: existence 11, extension 1; conditional compositional score matrix adjustment);
and/or no more than 7, such as no more than 5, preferably no more than 3, such as only 3, 2 or 1 “amino acid differences” (as defined herein, and not taking into account any of the above-listed mutations at position(s) 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 that may be present and not taking into account any C-terminal extension that may be present) with the amino acid sequence of SEQ ID NO: 1 (in which said amino acid differences, if present, may be present in the frameworks and/or the CDRs but are preferably present only in the frameworks and not in the CDRs);
and optionally having: a C-terminal extension (X).sub.n, in which n is 1 to 10, preferably 1 to 5, such as 1, 2, 3, 4 or 5 (and preferably 1 or 2, such as 1); and each X is an (preferably naturally occurring) amino acid residue that is independently chosen, and preferably independently chosen from the group consisting of alanine (A), glycine (G), valine (V), leucine (L) or isoleucine (I);
comprising an amino acid sequence wherein: the amino acid residue at position 1 is E or D; the amino acid residue at position 11 is L or V; the amino acid residue at position 14 is P; the amino acid residue at position 45 is R; the amino acid residue at position 74 is S; the amino acid residue at position 83 is R; the amino acid residue at position 89 is preferably chosen from T, V or L; the amino acid residue at position 96 is P; the amino acid residue at position 108 is L; the amino acid residue at position 110 is preferably chosen from T, K or Q; and the amino acid residue at position 112 is preferably chosen from S, K or Q; for example, such that one or more of the following is true: (i) position 1 is D or E; (ii) position 11 is V; (iii) position 14 is P; (iv) position 45 is R; (v) position 74 is S; (vi) position 83 is R; (vii) position 89 is L or T; (viii) position 96 is P; or (ix) position 108 is L.
for example, wherein the CTLA4 binder comprises one or more of the sets of mutations below: a. position 11 is V and position 110 is K or Q; b. position 11 is V and position 112 is K or Q; c. position 89 is L and position 11 is V; d. position 89 is L and position 110 is K or Q; e. position 89 is L and position 112 is K or Q; f. position 89 is L and position 11 is V and position 110 is K or Q; or g. position 89 is L and position 11 is V and position 112 is K or Q.

(110) In a further aspect, the invention relates to an CTLA4 binder (e.g., an immunoglobulin single variable domain such as a Nanobody) having: a CDR1 (according to Abm) that is the amino acid sequence GGTFSFYGMG (SEQ ID NO: 5); and a CDR2 (according to Abm) that is the amino acid sequence DIRTSAGRTY (SEQ ID NO: 6); and a CDR3 (according to Abm) that is the amino acid sequence EPSGISGWDY (SEQ ID NO: 116;
and having: a degree of sequence identity with the amino acid sequence of SEQ ID NO: 1 of at least 85%, preferably at least 90%, more preferably at least 95% (in which the CDRs, any C-terminal extension that may be present, as well as the mutations at positions 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 required by the specific aspect involved are not taken into account for determining the degree of sequence identity) when the comparison is performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences (e.g., expect threshold: 10; word size: 3; max matches in a query range: 0; BLOSUM 62 matrix; gap costs: existence 11, extension 1; conditional compositional score matrix adjustment);
and/or no more than 7, such as no more than 5, preferably no more than 3, such as only 3, 2 or 1 “amino acid differences” (as defined herein, and not taking into account any of the above-listed mutations at position(s) 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 that may be present and not taking into account any C-terminal extension that may be present) with the amino acid sequence of SEQ ID NO: 1 (in which said amino acid differences, if present, may be present in the frameworks and/or the CDRs but are preferably present only in the frameworks and not in the CDRs);
and optionally having: a C-terminal extension (X).sub.n, in which n is 1 to 10, preferably 1 to 5, such as 1, 2, 3, 4 or 5 (and preferably 1 or 2, such as 1); and each X is an (preferably naturally occurring) amino acid residue that is independently chosen, and preferably independently chosen from the group consisting of alanine (A), glycine (G), valine (V), leucine (L) or isoleucine (I);
which CTLA4 binder (e.g., an immunoglobulin single variable domain such as a Nanobody) comprises one or more of the following amino acid residues (i.e. mutations compared to the amino acid sequence of SEQ ID NO: 1) at the positions mentioned (numbering according to Kabat): 1D or 1E; 11V; 14P; 45R; 74S; 83R; 89L or 89T; 96P; or 108L;
for example, wherein the CTLA4 binder comprises one or more of the sets of mutations below: 11V in combination with 110K or 110Q; 11V in combination with 112K or 112Q; 89L in combination with 11V; 89L in combination with 110K or 110Q; 89L in combination with 112K or 112Q; 89L in combination with 11V and 110K or 110Q; or 89L in combination with 11V and 112K or 112Q.

(111) As mentioned, when a CTLA4 binder (e.g., ISVD such as a Nanobody) of the invention is used in a monovalent format and/or wherein the CTLA4 binding moiety is present at the C-terminal end of a CTLA4 binder of the invention (as defined herein), the CTLA4 binder preferably has a C-terminal extension X(n), which C-terminal extension may be as described herein for the CTLA4 binders of the invention and/or as described in WO 2012/175741 or PCT/EP2015/060643 (WO2015/173325).

(112) Some preferred, but non-limiting examples of CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention are given in SEQ ID NOs: 8-43 and 60, and each of these amino acid sequences individually forms a further aspect of the invention.

(113) As mentioned, in the invention, amino acid sequences in which position 89 is T; or in which position 1 is E or D, position 11 is V, position 14 is P, position 45 is R, position 74 is S, position 83 is R, position 89 is L, position 96 is P, or position 108 is L; or in which position 11 is V and position 89 is L (optionally in suitable combination with a 110K or 110Q mutation and/or a 112K or 112Q mutation, and in particular in combination with a 110K or 110Q mutation) are particularly preferred. Even more preferred are amino acid sequences in which position 11 is V and position 89 is L, optionally with a 110K or 110Q mutation.

(114) Thus, in one preferred aspect, the invention relates to a CTLA4 binder (e.g., an immunoglobulin single variable domain such as a Nanobody) having: a CDR1 (according to Abm) that is the amino acid sequence GGTFSFYGMG (SEQ ID NO: 5); and a CDR2 (according to Abm) that is the amino acid sequence DIRTSAGRTY (SEQ ID NO: 6); and a CDR3 (according to Abm) that is the amino acid sequence EPSGISGWDY (SEQ ID NO: 116;
and having: a degree of sequence identity with the amino acid sequence of SEQ ID NO: 1 of at least 85%, preferably at least 90%, more preferably at least 95% (in which the CDRs, any C-terminal extension that may be present, as well as the mutations at positions 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 required by the specific aspect involved are not taken into account for determining the degree of sequence identity) when the comparison is performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences (e.g., expect threshold: 10; word size: 3; max matches in a query range: 0; BLOSUM 62 matrix; gap costs: existence 11, extension 1; conditional compositional score matrix adjustment);
and/or no more than 7, such as no more than 5, preferably no more than 3, such as only 3, 2 or 1 “amino acid differences” (as defined herein, and not taking into account any of the above-listed mutations at position(s) 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 that may be present and not taking into account any C-terminal extension that may be present) with the amino acid sequence of SEQ ID NO: 1 (in which said amino acid differences, if present, may be present in the frameworks and/or the CDRs but are preferably present only in the frameworks and not in the CDRs);
and optionally having: a C-terminal extension (X).sub.n, in which n is 1 to 10, preferably 1 to 5, such as 1, 2, 3, 4 or 5 (and preferably 1 or 2, such as 1); and each X is an (preferably naturally occurring) amino acid residue that is independently chosen, and preferably independently chosen from the group consisting of alanine (A), glycine (G), valine (V), leucine (L) or isoleucine (I);
comprising an amino acid sequence having one or mutations (relative to the amino acid sequence of SEQ ID NO: 1) according to the following: the amino acid residue at position 1 is preferably chosen from E and D; the amino acid residue at position 11 is preferably chosen from L and V; the amino acid residue at position 14 is preferably chosen from A and P; the amino acid residue at position 45 is preferably chosen from Q and R; the amino acid residue at position 74 is preferably chosen from A and S; the amino acid residue at position 83 is preferably chosen from K and R; the amino acid residue at position 89 is preferably chosen from T, L and V; the amino acid residue at position 96 is preferably chosen from M or P; the amino acid residue at position 108 is preferably chosen from L or Q; the amino acid residue at position 110 is preferably chosen from T, K or Q (and is preferably T); and the amino acid residue at position 112 is preferably chosen from S, K or Q (and in preferably S).

(115) In another preferred aspect, the invention relates to a CTLA4 binder (e.g., an immunoglobulin single variable domain such as a Nanobody) having: a CDR1 (according to Abm) that is the amino acid sequence GGTFSFYGMG (SEQ ID NO: 5); and a CDR2 (according to Abm) that is the amino acid sequence DIRTSAGRTY (SEQ ID NO: 6); and a CDR3 (according to Abm) that is the amino acid sequence EPSGISGWDY (SEQ ID NO: 116;
and having: a degree of sequence identity with the amino acid sequence of SEQ ID NO: 1 of at least 85%, preferably at least 90%, more preferably at least 95% (in which the CDRs, any C-terminal extension that may be present, as well as the mutations at positions 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 required by the specific aspect involved are not taken into account for determining the degree of sequence identity) when the comparison is performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences (e.g., expect threshold: 10; word size: 3; max matches in a query range: 0; BLOSUM 62 matrix; gap costs: existence 11, extension 1; conditional compositional score matrix adjustment);
and/or no more than 7, such as no more than 5, preferably no more than 3, such as only 3, 2 or 1 “amino acid differences” (as defined herein, and not taking into account any of the above-listed mutations at position(s) 1, 11, 14, 45, 74, 83, 89, 96, 108, 110 and/or 112 that may be present and not taking into account any C-terminal extension that may be present) with the amino acid sequence of SEQ ID NO: 1 (in which said amino acid differences, if present, may be present in the frameworks and/or the CDRs but are preferably present only in the frameworks and not in the CDRs);
and optionally having: a C-terminal extension (X).sub.n, in which n is 1 to 10, preferably 1 to 5, such as 1, 2, 3, 4 or 5 (and preferably 1 or 2, such as 1); and each X is an (preferably naturally occurring) amino acid residue that is independently chosen, and preferably independently chosen from the group consisting of alanine (A), glycine (G), valine (V), leucine (L) or isoleucine (I);
in which the CTLA4 binder comprises one or more of the following mutations: the amino acid residue at position 1 is D or E; the amino acid residue at position 11 is V; the amino acid residue at position 14 is P; the amino acid residue at position 45 is R; the amino acid residue at position 74 is S; the amino acid residue at position 83 is R; the amino acid residue at position 89 is L; the amino acid residue at position 96 is P; the amino acid residue at position 108 is L; the amino acid residue at position 110 is preferably suitably chosen from T, K or Q; or the amino acid residue at position 112 is preferably suitably chosen from S, K or Q.

(116) In one specific, but non-limiting aspect, the CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention comprise the one or more of following sets of mutations (i.e. mutations compared to the sequence of SEQ ID NO: 1) at the positions mentioned (numbering according to Kabat): 11V in combination with 89L; 11V in combination with 1D, 14P, 45R, 74S, 83R, 89L, 96P, 108L; 11V in combination with 1E, 14P, 45R, 74S, 83R, 89L, 96P, 108L; 11V in combination with 110K or 110Q; 11V in combination with 110K or 110Q, and 1D or 1E and 14P, 45R, 74S, 83R, 89L, 96P, and 108L; 11V in combination with 112K or 112Q; 11V in combination with 112K or 112Q, and 1D or 1E and 14P, 45R, 74S, 83R, 89L, 96P, and 108L; 11V in combination with 89L and 110K or 110Q; or 11V in combination with 89L and 112K or 112Q, and have CDRs which are in a CTLA4 binder of Table A, e.g., in SEQ ID NO: 1 or SEQ ID NO: 60 (e.g., according to Abm) and have an overall degree of sequence identity with the amino acid sequence of SEQ ID NO: 1 that are as described herein.

(117) In another specific, but non-limiting aspect, the CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention comprise the following sets of mutations (i.e. mutations compared to the sequence of SEQ ID NO: 1) at the positions mentioned (numbering according to Kabat): 89L in combination with 11V; 89L in combination with 1D or 1E, 11V, 14P, 45R, 74S, 83R, 96P and 108L; 89L in combination with 110K or 110Q; 89L in combination with 110K or 110Q and 1D or 1E and 11V, 14P, 45R, 74S, 83R, 96P and 108L; 89L in combination with 112K or 112Q; 89L in combination with 112K or 112Q and 1D or 1E and 11V, 14P, 45R, 74S, 83R, 96P and 108L; 89L in combination with 11V and 110K or 110Q; or 89L in combination with 11V and 112K or 112Q;
and have CDRs which are in a CTLA4 binder of Table A, e.g., in SEQ ID NO: 1 or SEQ ID NO: 60 (e.g., according to Abm) and have an overall degree of sequence identity with the amino acid sequence of SEQ ID NO: 1 that are as described herein.

(118) In another specific, but non-limiting aspect, the CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention comprise the following sets of mutations (i.e. mutations compared to the sequence of SEQ ID NO: 1) at the positions mentioned (numbering according to Kabat): 110K or 110Q in combination with 11V; 110K or 110Q in combination with 89L; 110K or 110Q in combination with 11V and 89L; or 110K or 110Q in combination with 1D or 1E and 11V, 14P, 45R, 74S, 83R, 89L, 96P and 108L,
and have CDRs which are in a CTLA4 binder of Table A, e.g., in SEQ ID NO: 1 or SEQ ID NO: 60 (e.g., according to Abm) and have an overall degree of sequence identity with the amino acid sequence of SEQ ID NO: 1 that are as described herein.

(119) In another specific, but non-limiting aspect, the CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention comprise the following sets of mutations (i.e. mutations compared to the sequence of SEQ ID NO: 1) at the positions mentioned (numbering according to Kabat): 112K or 112Q in combination with 11V; 112K or 112Q in combination with 89L; 112K or 112Q in combination with 11V and 89L; or 112K or 112Q in combination with 1D or 1E and 11V, 14P, 45R, 74S, 83R, 89L, 96P and 108L,
and have CDRs which are in a CTLA4 binder of Table A, e.g., in SEQ ID NO: 1 or SEQ ID NO: 60 (e.g., according to Abm) and have an overall degree of sequence identity with the amino acid sequence of SEQ ID NO: 1 that are as described herein.

(120) In another aspect, the CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention comprise a T at position 89 and have CDRs such as those set forth in SEQ ID NO: 1 or 60 (e.g., according to Abm) and have an overall degree of sequence identity with the amino acid sequence of SEQ ID NO: 1 that are as described herein.

(121) In another aspect, the CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention comprise a V at position 11 and an L at position 89 and have CDRs such as those set forth in SEQ ID NO: 60 (e.g., according to Abm) and have an overall degree of sequence identity with the amino acid sequence of SEQ ID NO: 1 that are as described herein.

(122) As mentioned, the CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention according to the above aspects are preferably further such that they contain a suitable combination of an optional E1D mutation, an L11V mutation, A14P mutation, a Q45R mutation, an A74S mutation, a K83R mutation, a V89L mutation, an M96P mutation and a Q108L mutation, and preferably a suitable combination of Q108L with any one of the other A14P, Q45R, A74S and K83R mutations, and preferably in combination with any two of these other mutations, more preferably with any three of these mutations (such as with the combination A14P, A74S and K83R), such as with all of these mutations (and again, when the CTLA4 binder is monovalent or present at the N-terminal end of a CTLA4 binder of the invention, preferably also an E1D mutation). In an embodiment of the invention, the CTLA4 binders of the present invention comprise the mutations E1D (or lacking such a mutation, wherein residue 1 is E), L11V, A14P, Q45R, A74S, K83R, V89L, M96P, Q108L.

(123) In another specific, but non-limiting aspect, the invention relates to a CTLA4 binder (e.g., an immunoglobulin single variable domain such as a Nanobody) that is or essentially consists of an amino acid sequence chosen from one of the following amino acid sequences: SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43 or SEQ ID NO: 60.

(124) In another specific, but non-limiting aspect, the invention relates to a CTLA4 binder (e.g., an immunoglobulin single variable domain such as a Nanobody) that is or essentially consists of an amino acid sequence chosen from one of the following amino acid sequences: SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43 or SEQ ID NO: 60.

(125) Also, as already indicated herein, the amino acid residues of a CTLA4 binder (e.g., an ISVD such as a Nanobody) are numbered according to the general numbering for VHs given by Kabat et al. (“Sequence of proteins of immunological interest”, US Public Health Services, NIH Bethesda, Md., Publication No. 91), as applied to VHH domains from Camelids in the article of Riechmann and Muyldermans, J. Immunol. Methods 2000 Jun. 23; 240 (1-2): 185-195; or referred to herein. It should be noted that, as is well known in the art for VH domains and for VHH domains, the total number of amino acid residues in each of the CDRs may vary and may not correspond to the total number of amino acid residues indicated by the Kabat numbering (that is, one or more positions according to the Kabat numbering may not be occupied in the actual sequence, or the actual sequence may contain more amino acid residues than the number allowed for by the Kabat numbering). This means that, generally, the numbering according to Kabat may or may not correspond to the actual numbering of the amino acid residues in the actual sequence.

(126) Alternative methods for numbering the amino acid residues of VH domains, which methods can also be applied in an analogous manner to VHH domains from Camelids and to Nanobodies, are the method described by Chothia et al. (Nature 342, 877-883 (1989)), the so-called “AbM definition” and the so-called “contact definition”. However, in the present description, aspects and figures, the numbering according to Kabat as applied to VHH domains by Riechmann and Muyldermans will be followed, unless indicated otherwise.

(127) The invention also relates to CTLA4 binders (e.g., ISVD such as a Nanobody); to methods for expressing/producing the CTLA4 binders of the invention; to compositions and products (such as pharmaceutical compositions and products) that comprise the CTLA4 binders of the invention; to polynucleotides that encode the CTLA4 binders of the invention; and to uses (and in particular therapeutic, prophylactic and diagnostic uses) of the CTLA4 binders of the invention.

(128) These and other aspects, embodiments, advantages, applications and uses of the invention will become clear from the further description herein.

(129) Accordingly, in a further aspect, the invention relates to polypeptides or other chemical entities that comprise or essentially consist of at least one (such as one, two or three) CTLA4 binding moieties described herein. These molecules themselves may be referred to as “CTLA4 binders” or “compounds of the invention” or “polypeptides of the invention”.

(130) CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention can contain one or more other amino acid sequences, chemical entities or moieties. These other amino acid sequences, chemical entities or moieties can confer one or more desired properties to the resulting CTLA4 binders of the invention and/or can alter the properties of the resulting CTLA4 binders of the invention in a desired manner, for example to provide the resulting CTLA4 binders of the invention with a desired biological and/or therapeutic activity (for example, to provide the resulting CTLA4 binders of the invention with affinity and preferably potency against another therapeutically relevant target such that the resulting polypeptide becomes “bispecific” with respect to CTLA4 and that other therapeutically relevant target such as PD1, LAG3, BTLA and/or CD27), to provide a desired half-life and/or to otherwise modify or improve pharmacokinetic and/or pharmacodynamic properties, to target the CTLA4 binder to specific cells, tissues or organs (including cancer cells and cancer tissues), to provide a cytotoxic effect and/or to serve as a detectable tag or label. Some non-limiting examples of such other amino acid sequences, chemical entities or moieties are: one or more suitable linkers (such a 9GS, 15GS or 35GS linker (any combination of 9, 15 or 35 G and S amino acids such as, for example, GGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGS)) (SEQ ID NO: 65). In an embodiment of the invention, the linker is (GGGGS).sub.n(SEQ ID NO: 118), wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10; and/or one or more binding moieties, binding domains or binding units that are directed against a therapeutically relevant target other than CTLA4 (i.e. so as to provide a CTLA4 binder of the invention that is bispecific for both CTLA4 and the other therapeutically relevant target such as a different epitope of CTLA4, PD1, CD27, LAG3, BTLA, TIM3, ICOS, B7-H3, B7-H4, CD137, GITR, PD-L1, PD-L2, ILT1, ILT2 CEACAM1, CEACAM5, TIM3, TIGIT, VISTA, ILT3, ILT4, ILT5, ILT6, ILT7, ILT8, CD40, OX40, CD137, KIR2DL1, KIR2DL2, KIR2DL3, KIR2DL4, KIR2DL5A, KIR2DL5B, KIR3DL1, KIR3DL2, KIR3DL3, NKG2A, NKG2C, NKG2E, IL-10, IL-17, TSLP)) and/or one or more binding domains or binding units that provide for an increase in half-life (for example, a binding domain or binding unit that can bind against a serum protein such as serum albumin); and/or one or more binding moieties, binding domains or binding units that target the CTLA4 binder (e.g., ISVD such as a Nanobody) to a desired cell, tissue or organ (such as a cancer cell); and/or one or more binding moieties, binding domains or binding units that provide for increased specificity against CTLA4 (usually, these will be able to bind to CTLA4 but will generally by themselves essentially not be functional against CTLA4); and/or a binding moiety, binding domain, binding unit or other chemical entity that allows for the CTLA4 binder to be internalized into a (desired) cell (for example, an internalizing anti-EGFR Nanobody as described in WO 2005/044858); and/or a moiety that improves half-life such as a suitable polyethyleneglycol group (i.e. PEGylation) or an amino acid sequence that provides for increased half-life such as human serum albumin or a suitable fragment thereof (i.e. albumin fusion) or for example a serum albumin binding peptide as described in WO 2008/068280; and/or a payload such as a cytotoxic payload; and/or a detectable label or tag, such as a radiolabel or fluorescent label; and/or a tag that can help with immobilization, detection and/or purification of the CTLA4 binder, such as a HIS or FLAG3 tag; and/or a tag that can be functionalized, such as a C-terminal GGC or GGGC tag; and/or a C-terminal extension X(n), which may be as further described herein for the CTLA4 binders of the invention and/or as described in WO 2012/175741 or PCT/EP2015/060643 (WO2015/173325).

(131) CTLA4 binders (e.g., ISVD such as a Nanobody) that also contain one or more parts or fragments of a (preferably human) conventional antibody (such as an Fc part or a functional fragment thereof or one or more constant domains) and/or from a Camelid heavy-chain only antibody (such as one or more constant domains) are part of the present invention.

Multispecific Binders

(132) The present invention includes CTLA4 binders that may be fused in a single multivalent (e.g., multispecific) molecule that also binds to CTLA4 or to another polypeptide and, in an embodiment of the invention, such binders are linked to one or more half-life extenders that increases the half-life of the binders in the body of a subject (e.g., comprising the amino acid sequence set forth in SEQ ID NO: 62 or 64). In an embodiment of the invention, the half-life extender is an ISVD (e.g., a Nanobody) that specifically binds to human serum albumin (HSA), e.g., ALB 11002. In an embodiment of the invention, the multispecific binder is F023700912 or F023700914 as described herein.

(133) A polypeptide may be “fused to” another molecule either directly, with no linker, or through a linker such as a peptide linker, e.g., 35GS.

(134) Multispecific binders may include a CTLA4 binder as well as a one or more binders that bind to an additional antigen such as CD27, PD1, LAG3, BTLA, TIM3, ICOS, B7-H3, B7-H4, CD137, GITR, PD-L1, PD-L2, ILT1, ILT2 CEACAM1, CEACAM5, TIM3, TIGIT, VISTA, ILT3, ILT4, ILT5, ILT6, ILT7, ILT8, CD40, OX40, CD137, KIR2DL1, KIR2DL2, KIR2DL3, KIR2DL4, KIR2DL5A, KIR2DL5B, KIR3DL1, KIR3DL2, KIR3DL3, NKG2A, NKG2C, NKG2E, IL-10, IL-17 or TSLP.

(135) For some specific but non-limiting examples of such ISVD-based or Nanobody-based biologicals, reference is to the various applications by Ablynx N. V., such as for example and without limitation WO 2004/062551, WO 2006/122825, WO 2008/020079 and WO 2009/068627, as well as for example, and without limitation, to applications such as WO 2006/038027, WO 2006/059108, WO 2007/063308, WO 2007/063311, WO 2007/066016 and WO 2007/085814. Also, as further described herein, a further moiety, which may be part of a molecule set forth in the applications mentioned above, may be an ISVD or Nanobody as described herein, directed against a (human) serum protein such as (human) serum albumin, and such an ISVD or Nanobody (e.g., ALB 11002) may also find therapeutic uses, in particular in and/or for extending the half-life of the CTLA4 binders (and polypeptides comprising the same) that are described herein. Reference is for example made to WO 2004/041865, WO 2006/122787 and WO 2012/175400, which generally describe the use of serum-albumin binding Nanobodies for half-life extension. WO 2009/138519 (or in the prior art cited in WO 2009/138519) or WO 2008/020079 (or in the prior art cited in WO 2008/020079) are incorporated by reference. Also, where a method or technique is not specifically described herein, it can, in an embodiment of the invention, be performed as described in WO 2009/138519 (or in the prior art cited in WO 2009/138519) or WO 2008/020079 (or in the prior art cited in WO 2008/020079).

(136) When the CTLA4 binders (e.g., ISVD such as a Nanobody) contain one or more further binding moieties, binding domains or binding units (e.g. a further essentially non-functional binding domain or binding unit against CTLA4 that provides for increased specificity against CTLA4, a binding moiety, binding domain or binding unit against a therapeutic target other than CTLA4, a binding moiety, binding domain or binding unit against a target such as human serum albumin that provides for increased half-life, and/or a binding moiety, binding domain or binding unit that targets the CTLA4 binder to a specific cell, tissue or organ and/or that allows for the CTLA4 binder to be internalized into a cell), these other binding moieties, binding domains or binding units preferably comprise one or more ISVDs, and more preferably are all ISVDs. For example and without limitation, these one or more further binding domains or binding units can be one or more Nanobodies (including a VHH, a humanized VHH and/or a camelized VHs such as camelized human VHs), a (single domain) antibody that is a VH domain or that is derived from a VH domain, a dAb that is or essentially consists of a VH domain or that is derived from a VH domain, or even a (single) domain antibody or a dAb that is or essentially consists of VL domain. In particular, these one or more binding domains or binding units, when present, may comprise one or more Nanobodies, and more in particular are all Nanobodies.

(137) When a CTLA4 binder of the invention has an ISVD at its C-terminal end (which C-terminal ISVD may be a CTLA4 binding moiety described herein or may for example be, if present in the CTLA4 binder, a further essentially non-functional ISVD against CTLA4 that provides for increased specificity against CTLA4, an ISVD against a therapeutic target other than CTLA4, an ISVD against a target such as human serum albumin that provides for increased half-life, or an ISVD that targets the CTLA4 binder to a specific cell, tissue or organ and/or that allows for the CTLA4 binder to be internalized into a cell), then the CTLA4 binding moiety (i.e. said C-terminal ISVD) preferably has a C-terminal extension X(n), which C-terminal extension may be as described herein for the CTLA4 binders of the invention and/or as described in WO 2012/175741 or PCT/EP2015/060643 (WO2015/173325).

(138) When a CTLA4 binder (e.g., ISVD such as a Nanobody) contains, in addition to the one or more CTLA4 binding moieties described herein, any further ISVDs (which one or more further ISVDs may, as mentioned, be a further essentially non-functional ISVD against CTLA4 that provides for increased specificity against CTLA4, an ISVD against a therapeutic target other than CTLA4, an ISVD against a target such as human serum albumin that provides for increased half-life, and/or an ISVD that targets the CTLA4 binder to a specific cell, tissue or organ and/or that allows for the CTLA4 binder to be internalized into a cell), and where such further ISVDs are Nanobodies or are ISVDs that are, that essentially consist of and/or that are derived from VH sequences, then according to a preferred aspect of the invention said one or more (and preferably all) further ISVDs present in the CTLA4 binder will contain within their sequence one or more framework mutations that reduce binding by pre-existing antibodies. In particular, according to this aspect of the invention, such further ISVDs may contain (a suitable combination of) amino acid residues/mutations at positions 11, 89, 110 and/or 112 that are as described in PCT/EP2015/060643 (WO2015/173325) and/or that essentially are as described herein for the CTLA4 binders of the invention. In one specific aspect, when the CTLA4 binder has such an ISVD at its C-terminal end (i.e. does not have CTLA4 binding moiety of the invention at its C-terminal end), then at least said ISVD that is present at and/or forms the C-terminal end has such framework mutations that reduce binding by pre-existing antibodies (and said C-terminal ISVD will preferably also have a C-terminal extension X(n) as described herein).

(139) As mentioned, when the CTLA4 binder (e.g., ISVD such as a Nanobody) is to have an increased half-life (i.e. compared to the monovalent CTLA4 binder of the invention), the CTLA4 binder preferably contains at least one (such as one) ISVD (and in particular Nanobody) that provides for such increased half-life. Such an ISVD will usually be directed against a suitable serum protein such as transferrin and in particular against (human) serum albumin. In particular, such an ISVD or Nanobody may be a (single) domain antibody or dAb against human serum albumin as described in for example EP 2 139 918, WO 2011/006915, WO 2012/175400, WO 2014/111550 and may in particular be a serum albumin binding Nanobody as described in WO 2004/041865, WO 2006/122787, WO 2012/175400 or PCT/EP2015/060643 (WO2015/173325). Particularly preferred serum albumin binding ISVDs are the Nanobody Alb-1 (see WO 2006/122787) or its humanized variants such as Alb-8 (WO 2006/122787, SEQ ID NO: 62), Alb-23 (WO 2012/175400, SEQ ID NO: 1) and other humanized (and preferably also sequence-optimized) variants of Alb-1 and/or variants of Alb-8 or Alb-23 (or more generally ISVDs that have essentially the same CDRs as Alb-1, Alb-8 and Alb-23).

(140) In an embodiment of the invention, the ISVD (e.g., Nanobody) is ALB 11002 which binds to human serum albumin. ALB 11002 is summarized below in Table C.

(141) The present invention includes CTLA4 binders comprising an HSA binder of the invention, for example, having the same combination of CDRs (i.e. CDR1, CDR2 and CDR3) as are present in ALB 11002 or in a binder comprising the sequence of SEQ ID NO: 66. See Table C.

(142) TABLE-US-00008 TABLE C Human Serum Albumin (HSA) Binder ALB11002 SEQ ID NO Description Sequence 66 ALB11002 EVQLVESGGG XVQPGNSLRL SCAASGFTFS SFGMSWVRQA PGKGLEWVSS ISGSGSDTLY ADSVKGRFTI SRDNAKTTLY LQMNSLRPED TAXYYCTIGG SLSRSSQGTL VTVSSA; wherein X at residues 11 and 93 are L or V; for example, EVQLVESGGGVVQPGNSLRLSCAASGF TFSSFGMSWVRQAPGKGLEWVSSISGSGS DTLYADSVKGRFTISRDNAKTTLYLQMNSLR PEDTALYYCTIGGSLSRSSQGTLVTVSS (SEQ ID NO: 112) 67 CDR1 GFTFSSFGMS or SFGMS (SEQ ID NO: 113; amino acids 6-10 of SEQ ID NO: 67) 68 CDR2 SISGSGSDTLYADSVKG or SISGSGSDTL (SEQ ID NO: 114; amino acids 1-10   of SEQ ID NO: 68) 69 CDR3 GGSLSR

(143) Optionally, ALB 11002 lacks the C-terminal Alanine. In an embodiment of the invention, the HSA binder comprises the amino acid sequence of SEQ ID NO: 66 but including a mutatoin at position 1, 1, 89, 110 or 112, e.g., comprising a set of mutations set forth in Table C herein.

(144) Residue 1 of SEQ ID NO: 66 can be D or E. If residue 1 is D, the HSA binder may be designated as 1D and if residue 1 is E, the HSA binder may be designated as 1E.

(145) The present invention includes HSA binders comprising one, two or three of the CDRs of a HSA binder wherein each comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid substitutions, e.g., conservative substitutions, and/or comprises 100, 99, 98, 97, 96 or 95% sequence identity relative to the CDRs that are in the HSA binder sequences set forth of Table C or are set forth in SEQ ID NOs: 67-69, wherein an HSA binder having such CDRs retains the ability to bind to HSA.

(146) In an embodiment of the invention, the half-life extender is an anti-HSA ISVD (e.g., a Nanobody) comprising: a CDR1 that comprises the amino acid sequence GFTFSSFGMS (SEQ ID NO: 67); and a CDR2 that comprises the amino acid sequence SISGSGSDTL (SEQ ID NO: 114; and a CDR3 that comprises the amino acid sequence GGSLSR (SEQ ID NO: 69);
and, optionally, having: a degree of sequence identity with the amino acid sequence of SEQ ID NO: 66 (in which any C-terminal extension that may be present as well as the CDRs are not taken into account for determining the degree of sequence identity) of at least 85%, preferably at least 90%, more preferably at least 95% (in which the CDRs, any C-terminal extension that may be present, as well as the mutations at positions 1, 11, 89, 110 and/or 112 required by the specific aspect involved are not taken into account for determining the degree of sequence identity);
and/or no more than 7, such as no more than 5, preferably no more than 3, such as only 3, 2 or 1 “amino acid differences” (as defined herein, and not taking into account any of the above-listed mutations at position(s) 1, 11, 89, 110 and/or 112 that may be present and not taking into account any C-terminal extension that may be present) with the amino acid sequence of SEQ ID NO: 66 (in which said amino acid differences, if present, may be present in the frameworks and/or the CDRs but are preferably present only in the frameworks and not in the CDRs);
and optionally having: a C-terminal extension (X).sub.n, in which n is 1 to 10, preferably 1 to 5, such as 1, 2, 3, 4 or 5 (and preferably 1 or 2, such as 1); and each X is an (preferably naturally occurring) amino acid residue that is independently chosen, and preferably independently chosen from the group consisting of alanine (A), glycine (G), valine (V), leucine (L) or isoleucine (I).

(147) Again, as mentioned, such a serum albumin binding ISVD, when present, may contain within its sequence one or more framework mutations that reduce binding by pre-existing antibodies. In particular, when such a serum albumin binding ISVD is a Nanobody or a (single) domain antibody that is, essentially consist of and/or is derived from a VH domain, the serum albumin binding ISVD may contain (a suitable combination of) amino acid residues/mutations at positions 11, 89, 110 and/or 112 that are as described in PCT/EP2015/060643 (WO2015/173325) and/or that essentially are as described herein for the CTLA4 binders of the invention. For example, PCT/EP2015/060643 (WO2015/173325) describes a number of variants of Alb-1, Alb-8 and Alb-23 that contain amino acid residues/mutations at positions 11, 89, 110 and/or 112 that reduce binding by pre-existing antibodies that can be used in the CTLA4 binders of the invention.

(148) Again, when such a serum albumin binding ISVD is present at the C-terminal end of a CTLA4 binder (e.g., ISVD such as a Nanobody) of the invention, the serum albumin binding ISVD (and as a result, the CTLA4 binder of the invention) preferably has a C-terminal extension X.sub.(n), which C-terminal extension may be as described herein for the CTLA4 binders of the invention and/or as described in WO 2012/175741 or PCT/EP2015/060643 (WO2015/173325). It also preferably has mutations that reduce the binding of pre-existing antibodies, like (a suitable combination of) the amino acid residues/mutations at positions 11, 89, 110 and/or 112 described in PCT/EP2015/060643 (WO2015/173325).

(149) However, as mentioned, other means of increasing the half-life of a CTLA4 binder of the invention (such as PEGylation, fusion to human albumin or a suitable fragment thereof, or the use of a suitable serum albumin-binding peptide), are also included in the scope of the invention.

(150) Generally, when a CTLA4 binder (e.g., ISVD such as a Nanobody) of the invention has increased half-life (e.g. through the presence of a half-life increasing ISVD or any other suitable way of increasing half-life), the resulting CTLA4 binder preferably has a half-life (as defined herein) that is at least 2 times, preferably at least 5 times, for example at least 10 times or more than 20 times, greater than the half-life of the monovalent CTLA4 binder of the invention (as measured in either in man and/or a suitable animal model, such as mouse or cynomolgus monkey). In particular, a CTLA4 binder of the invention preferably has a half-life (as defined herein) in human subjects of at least 1 day, preferably at least 3 days, more preferably at least 7 days, such as at least 10 days.

(151) It will be clear from the disclosure herein that CTLA4 binder of the invention (e.g., that are based on one or more ISVDs such as Nanobodies) can have different “formats”, i.e. essentially be monovalent, bivalent or trivalent, can be monospecific, bispecific, trispecific etc., and can be biparatopic (as defined herein and in for example WO 2009/068625). For example, a CTLA4 binder of the invention can be: (essentially) monovalent, i.e. (essentially) comprising a single CTLA4 binding moiety of the invention. As mentioned, when used in monovalent format, a CTLA4 binder of the invention preferably has a C-terminal extension X(n) as further described herein. Such a CTLA4 binder of the invention may also be half-life extended; (essentially) bivalent or trivalent and monospecific. Such a CTLA4 binder of the invention will comprise two or more binding moieties (e.g., ISVDs) against CTLA4, which may be the same or different and when different may be directed against the same epitope on CTLA4 or against different epitopes on CTLA4 (in the latter case, so as to provide a biparatopic or multiparatopic CTLA4 binder of the invention). Such a CTLA4 binder of the invention may also be half-life extended; (essentially) bivalent, trivalent (or multivalent) and bispecific or trispecific (or multispecific). Such a CTLA4 binder of the invention will be directed against CTLA4 and at least one other target. As described herein, said other target may for example be another therapeutically relevant target (i.e. other than CTLA4), such as, for example, PD1, LAG3, BTLA and/or CD27, so as to provide a CTLA4 binder that is bispecific with regards to CTLA4 and said other therapeutic target. Said other target may also be a target that provides for increased half-life (such as human serum albumin), so as to provide a CTLA4 binder of the invention that has increased half-life. As also mentioned herein, such other target may allow also for the CTLA4 binder of the invention to be targeted to specific cells, tissues or organs or may allow for the CTLA4 binder of the invention to be internalized into a cell. It is also possible to combine these approaches/ISVDs, for example to provide a CTLA4 binder of the invention that is bispecific for CTLA4 and for at least one other therapeutically relevant target and that is half-life extended.

(152) Again, preferably, when these CTLA4 binder (e.g., ISVD such as a Nanobody) of the invention contain one or more binding moieties (e.g., ISVDs) other than the at least one CTLA4 binder of the invention, at least one and preferably all of these other ISVDs will contain within its sequence one or more framework mutations that reduce binding by pre-existing antibodies (such as, in particular, a combination of amino acid residues/mutations at positions 11, 89, 110 and/or 112 that is as described herein for the CTLA4 binders of the invention and/or as generally described in PCT/EP2015/060643 (WO2015/173325)). Also, when such CTLA4 binder of the invention have a CTLA4 binding moiety at their C-terminal end, then said C-terminal CTLA4 binding moiety (and as a result, the CTLA4 binder of the invention) will preferably have a C-terminal extension X(n) as described herein. Similarly, when such CTLA4 binder of the invention have another ISVD at their C-terminal end (i.e. not a CTLA4 binding moiety of the invention, but for example a half-life extending ISVD), then said C-terminal ISVD (and as a result, the CTLA4 binder of the invention) will preferably have a C-terminal extension X(n) as described herein and/or will contain within its sequence one or more framework mutations that reduce binding by pre-existing antibodies (again, as further described herein and in PCT/EP2015/060643 (WO2015/173325)).

(153) As will be clear to the skilled person, when a CTLA4 binder (e.g., ISVD such as a Nanobody) of the invention is intended for topical use (i.e. on the skin or in the eye) or is for example meant to have a (localized) therapeutic action somewhere in for example the GI tract (i.e. after oral administration or administration by suppository) or in the lungs (i.e. after administration by inhalation) or is otherwise meant to be directly applied to its intended place of action (for example, by direct injection), a CTLA4 binder of the invention may not require half-life extension. Also, for treatment of certain acute conditions or indications, it may be preferable not to have a prolonged half-life. In these cases, the use of a monovalent CTLA4 binder of the invention or of a CTLA4 binder of the invention (comprising the CTLA4 binding moiety of the invention) without half-life extension (for example, a CTLA4 binder of the invention that is bivalent or biparatopic with respect to CTLA4) is preferred.

(154) Some preferred, but non-limiting examples of such CTLA4 binder (e.g., ISVD such as a Nanobody) of the invention are schematically represented in Table C-1 below, and each of these forms a further aspect of the invention. Other examples of suitable CTLA4 binders of the invention without half-life extension will be clear to the skilled person based on the disclosure herein.

(155) TABLE-US-00009 TABLE C-1 Schematic representation of some CTLA4 binders of the invention without a half-life extending ISVD. [CTLA4 binding moiety] [CTLA4 binding moiety]-X(n) [CTLA4 binding moiety]-[CTLA4 binding moiety] [CTLA4 binding moiety]-[CTLA4 binding moiety]-X(n) [CTLA4 binding moiety]-[Other] [CTLA4 binding moiety]-[Other]-X(n) [Other]-[CTLA4 binding moiety] [Other]-[CTLA4 binding moiety]-X(n) [CTLA4 binding moiety]-[Targeting unit] [Targeting unit]-[CTLA4 binding moiety] [CTLA4 binding moiety]-[Targeting unit]-X(n) [Targeting unit]-[CTLA4 binding moiety]-X(n) [CTLA4 binding moiety]-[CTLA4 binding moiety]-[Targeting unit] [CTLA4 binding moiety]-[CTLA4 binding moiety]-[Targeting unit]-X(n) [Targeting unit]-[CTLA4 binding moiety]-[CTLA4 binding moiety] [Targeting unit]-[CTLA4 binding moiety]-[CTLA4 binding moiety]-X(n) Legend: “[CTLA4 binding moiety]” represents a CTLA4 binding domain or unit (e.g., an ISVD such as a Nanobody), e.g., 11F01 (E1D, L11V, A14P, Q45R, A74S, K83R, V89L, M96P, Q108L). “-” represents either a direct covalent linkage or a suitable linker, such as a 9GS, 15GS or 35GS linker “X(n)” represents a C-terminal extension as defined herein such as a single alanine residue. “[Other]” represents a binding domain or binding unit (e.g., an ISVD such as a Nanobody) against CTLA4 different from the CTLA4 binding moiety or against a different antigen such as PD1, LAG3, CD27 and/or BTLA. “[Targeting unit]” represents a binding domain or binding unit (e.g., an ISVD such as a Nanobody) that targets the CTLA4 binder of the invention to a specific cell, tissue or organ

(156) As will be clear to the skilled person, when a CTLA4 binder (e.g., ISVD such as a Nanobody) of the invention is intended for systemic administration and/or for prevention and/or treatment of a chronic disease or disorder, it will usually be preferred that said CTLA4 binder of the invention has increased half-life (as defined herein). More preferably, such a CTLA4 binder of the invention will contain a half-life extending ISVD such as, preferably, an ISVD and in particular a Nanobody binding to human serum albumin (as described herein).

(157) Some preferred, but non-limiting examples of such CTLA4 binders (e.g., ISVD such as a Nanobody) of the invention are schematically represented in Table C-2 below, and each of these forms a further aspect of the invention. Other examples of suitable CTLA4 binder of the invention with half-life extension will be clear to the skilled person based on the disclosure herein. Generally, for CTLA4 binder of the invention with half-life extension, the presence of a C-terminal extension is much preferred.

(158) TABLE-US-00010 TABLE C-2 Schematic Representation of Some CTLA4 Binders of the Invention with a Half Life Extending ISVD. [CTLA4 binding moiety]-[HLE] [HLE]-[CTLA4 binding moiety] [CTLA4 binding moiety]-[HLE]-X(n) [HLE]-[CTLA4 binding moiety]-X(n) [CTLA4 binding moiety]-[CTLA4 binding moiety]-[HLE] [CTLA4 binding moiety]-[HLE]-[CTLA4 binding moiety] [HLE]-[CTLA4 binding moiety]-[CTLA4 binding moiety] [CTLA4 binding moiety]-[CTLA4 binding moiety]-[HLE]-X(n) [CTLA4 binding moiety]-[HLE]-[CTLA4 binding moiety]-X(n) [HLE]-[CTLA4 binding moiety]-[CTLA4 binding moiety]-X(n) [CTLA4 binding moiety]-[Other]-[HLE] [CTLA4 binding moiety]-[HLE]-[Other] [HLE]-[CTLA4 binding moiety]-[Other] [HLE]-[Other]-[CTLA4 binding moiety] [Other]-[CTLA4 binding moiety]-[HLE] [Other]-[HLE]-[CTLA4 binding moiety] [CTLA4 binding moiety]-[Other]-[HLE]-X(n) [CTLA4 binding moiety]-[HLE]-[Other]-X(n) [HLE]-[CTLA4 binding moiety]-[Other]-X(n) [HLE]-[Other]-[CTLA4 binding moiety]-X(n) [Other]-[CTLA4 binding moiety]-[HLE]-X(n) [Other]-[HLE]-[CTLA4 binding moiety]-X(n) [CTLA4 binding moiety]-[Targeting unit]-[HLE] [CTLA4 binding moiety]-[HLE]-[Targeting unit] [HLE]-[CTLA4 binding moiety]-[Targeting unit] [Targeting unit]-[CTLA4 binding moiety]-[HLE] [Targeting unit]-[HLE]-[CTLA4 binding moiety] [HLE]-[Targeting unit]-[CTLA4 binding moiety] [CTLA4 binding moiety]-[Targeting unit]-[HLE]-X(n) [CTLA4 binding moiety]-[HLE]-[Targeting unit]-X(n) [HLE]-[CTLA4 binding moiety]-[Targeting unit]-X(n) [Targeting unit]-[CTLA4 binding moiety]-[HLE]-X(n) [Targeting unit]-[HLE]-[CTLA4 binding moiety]-X(n) [HLE]-[Targeting unit]-[CTLA4 binding moiety]-X(n) [CTLA4 binding moiety]-[CTLA4 binding moiety]-[Targeting unit]-[HLE] [CTLA4 binding moiety]-[CTLA4 binding moiety]-[HLE]-[Targeting unit] [CTLA4 binding moiety]-[HLE]-[CTLA4 binding moiety]-[Targeting unit] [HLE]-[CTLA4 binding moiety]-[CTLA4 binding moiety]-[Targeting unit] [CTLA4 binding moiety]-[CTLA4 binding moiety]- [Targeting unit]-[HLE]-X(n) [CTLA4 binding moiety]-[CTLA4 binding moiety]-[HLE]- [Targeting unit]-X(n) [CTLA4 binding moiety]-[HLE]-[CTLA4 binding moiety]- [Targeting unit]-X(n) [HLE]-[CTLA4 binding moiety]-[CTLA4 binding moiety]- [Targeting unit]-X(n) [Targeting unit]-[CTLA4 binding moiety]-[CTLA4 binding moiety]-[HLE] [Targeting unit]-[CTLA4 binding moiety]-[HLE]-[CTLA4 binding moiety] [Targeting unit]-[HLE]-[CTLA4 binding moiety]-[CTLA4 binding moiety] [HLE]-[Targeting unit]-[CTLA4 binding moiety]-[CTLA4 binding moiety] [Targeting unit]-[CTLA4 binding moiety]-[CTLA4 binding moiety]- [HLE]-X(n) [Targeting unit]-[CTLA4 binding moiety]-[HLE]- [CTLA4 binding moiety]-X(n) [Targeting unit]-[HLE]-[CTLA4 binding moiety]- [CTLA4 binding moiety]-X(n) [HLE]-[Targeting unit]-[CTLA4 binding moiety]- [CTLA4 binding moiety]-X(n) Legend: “[CTLA4 binding moiety]” represents a CTLA4 binding unit or domain (e.g., an ISVD such as a Nanobody), e.g., 11F01 (E1D, L11V, A14P, Q45R, A74S, K83R, V89L, M96P, Q108L). “-” represents either a direct covalent linkage or a suitable linker, such as a 9GS, 15GS or 35GS linker “X(n)” represents a C-terminal extension as defined herein such as a single alanine residue. “[HLE]” represents a half-life extending binding domain or binding unit (and in particular a half-life extending ISVD), such as an ISVD (and in particular Nanobody) against (human) serum albumin, e.g., ALB11002; “[Other]” represents a binding domain or binding unit (and in particular ISVD such as a Nanobody) against CTLA4 different from the “CTLA4 binding moiety” or against another antigen such as PD1, LAG3, CD27 and/or BTLA. “[Targeting unit]” represents a binding domain or binding unit (and in particular ISVD such as a Nanobody) that targets the CTLA4 binder to a specific cell, tissue or organ

(159) The present invention also provides a CTLA4 ISVD, F023700912, comprising amino acid sequence:

(160) TABLE-US-00011 DVQLVESGGGVVQPGGSLRLSCAASGGTFSFYGMG WFRQAPGKEREEVADIRTSAGRTYYADSVKGRFTISRDNSKNTVYLQMNSLRPEDTALYY embedded image VQLVESGGGVVQPGGSLRLSCAASGGTFSFYGMGWFRQAPGKEREEVADIRTSAGRTYYA embedded image embedded image TFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGRFTISRDNAKTTLYLQMNSLR PEDTALYYCTIGGSLSRSSQGTLVTVSSA
(SEQ ID NO: 62; 35GS linkers underscored with dotted line; CDRs underscored and/or bold). Optionally, the first residue of any binder moiety in the molecule is substituted with a D or an E as appropriate.

(161) Optionally, the CTLA4 ISVD comprises a signal peptide such as:

(162) TABLE-US-00012 (SEQ ID NO: 70) MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEGDFDVAVLPFSNSTN NGLLFINTTIASIAAKEEGVSLEKR F023700912 can be encoded by a polynucleotide comprising the following nucleotides: gacgtgcaat tggtggagtc tgggggagga gtggtgcagc cggggggctc tctgagactc 60 tcctgtgcag cctctggtgg caccttcagt ttctatggca tgggctggtt ccgccaggct 120 ccagggaagg agcgcgagtt tgtagcagat attagaacca gtgctggtag gacatactat 180 gcagactccg tgaagggccg attcaccatc tccagagaca acagcaagaa cacggtgtat 240 ctgcaaatga acagcctgcg ccctgaggac acggccctgt attactgtgc agcagagcca 300 agtggaataa gtggttggga ctactggggc caggggaccc tggtcacggt ctcctccgga 360 ggcggtgggt caggtggcgg aggcagcggt ggaggaggta gtggcggtgg cggtagtggg 420 ggtggaggca gcggaggcgg aggcagtggg ggcggtggat ccgaggtgca gttggtggag 480 tctgggggag gagtggtgca gccggggggc tctctgagac tctcctgtgc agcctctggt 540 ggcaccttca gtttctatgg catgggctgg ttccgccagg ctccagggaa ggagcgcgag 600 tttgtagcag atattagaac cagtgctggt aggacatact atgcagactc cgtgaagggc 660 cgattcacca tctccagaga caacagcaag aacacggtgt atctgcaaat gaacagcctg 720 cgccctgagg acacggccct gtattactgt gcagcagagc caagtggaat aagtggttgg 780 gactactggg gccaggggac cctggtcacg gtctcgagcg gaggcggtgg gtcaggtggc 840 ggaggcagcg gtggaggagg tagtggcggt ggcggtagtg ggggtggagg cagcggaggc 900 ggaggcagtg ggggcggtgg ctcagaggta caactagtgg agtctggagg tggcgttgtg 960 caaccgggta acagtctgcg ccttagctgc gcagcgtctg gctttacctt cagctccttt 1020 ggcatgagct gggttcgcca ggctccggga aaaggactgg aatgggtttc gtctattagc 1080 ggcagtggta gcgatacgct ctacgcggac tccgtgaagg gccgtttcac catctcccgc 1140 gataacgcca aaactacact gtatctgcaa atgaatagcc tgcgtcctga agatacggcc 1200 ctgtattact gtactattgg tggctcgtta agccgttctt cacagggtac cctggtcacc 1260 gtctcctcag cg 1272
(SEQ ID NO: 61; optionally lacking the signal sequence of nucleotides 1-255)

(163) F023700912 comprises the following moieties: CTLA4 binder 11F01(E1D,L11V,A14P,Q45R,A74S,K83R,V89L,M96P,Q108L) 35 GS linker CTLA4 binder 11F01(L11V,A14P,Q45R,A74S,K83R,V89L,M96P,Q108L) 35 GS linker Human serum albumin binder ALB 11002; C-terminal extension alanine.

(164) For example: CTLA4 binder SEQ ID NO: 60 35GS linker SEQ ID NO: 65 CTLA4 binder SEQ ID NO: 60 (DIE) 35GS linker SEQ ID NO: 65 Human serum albumin binder SEQ ID NO: 66 Alanine

(165) (the present invention includes any binder including such an arrangement of moieties)

(166) The present invention also provides a CTLA4 ISVD, F023700914, comprising amino acid sequence:

(167) TABLE-US-00013 DVQLVESGGGVVQPGGSLRLSCAASGGTFSFYGMG WERQAPGKEREEVADIRTSAGRTYYADSVKGRFTISRDNSKNTVYLQMNSLRPEDTALYY embedded image VQLVESGGGVVQPGNSLRLSCAASGETFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYA DSVKGRFTISRDNAKTTLYLQMNSLRPEDTALYYCTIGGSLSRSSQGTLVTVSSA
(SEQ ID NO: 64; 35GS linker underscored with dotted line; CDRs underscored and/or bold). Optionally, the first residue of any binder moiety in the molecule is substituted with a D or an E as appropriate.

(168) Optionally, the CTLA4 ISVD comprises a signal peptide such as:

(169) TABLE-US-00014 (SEQ ID NO: 70) MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEGDFD VAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKR

(170) F023700914 can be encoded by a polynucleotide comprising the following nucleotides:

(171) TABLE-US-00015 gacgtgcaat tggtggagtc tgggggagga gtggtgcagc cggggggctc tctgagactc 60 tcctgtgcag cctctggtgg caccttcagt ttctatggca tgggctggtt ccgccaggct 120 ccagggaagg agcgcgagtt tgtagcagat attagaacca gtgctggtag gacatactat 180 gcagactccg tgaagggccg attcaccatc tccagagaca acagcaagaa cacggtgtat 240 ctgcaaatga acagcctgcg ccctgaggac acggccctgt attactgtgc agcagagcca 300 agtggaataa gtggttggga ctactggggc caggggaccc tggtcacggt ctcctccgga 360 ggcggtgggt caggtggcgg aggcagcggt ggaggaggta gtggcggtgg cggtagtggg 420 ggtggaggca gcggaggcgg aggcagtggg ggcggtggat ccgaggtgca gttggtggag 480 tctggaggtg gcgttgtgca accgggtaac agtctgcgcc ttagctgcgc agcgtctggc 540 tttaccttca gctcctttgg catgagctgg gttcgccagg ctccgggaaa aggactggaa 600 tgggtttcgt ctattagcgg cagtggtagc gatacgctct acgcggactc cgtgaagggc 660 cgtttcacca tctcccgcga taacgccaaa actacactgt atctgcaaat gaatagcctg 720 cgtcctgaag atacggccct gtattactgt actattggtg gctcgttaag ccgttcttca 780 cagggtaccc tggtcaccgt ctcctcagcg 810
(SEQ ID NO: 63; optionally lacking the signal sequence of nucleotides 1-255)

(172) F023700914 comprises the following moieties: CTLA4 binder 11F01 (E1D,L11V,A14P,Q45R,A74S,K83R,V89L,M96P,Q108L); 35 GS linker; Human serum albumin binder ALB 11002; C-terminal extension alanine.
For example: CTLA4 binder SEQ ID NO: 60 35GS linker SEQ ID NO: 65 Human serum albumin binder SEQ ID NO: 66 Alanine
(the present invention includes any binder including such an arrangement of moieties)

(173) The present invention includes any multispecific CTLA4 binder comprising the amino acid sequence of SEQ ID NO: 62 or 64 or an amino acid sequence comprising 80% or more (e.g., 85%, 90%, 95%, 96%, 97%, 98% or 99%) amino acid sequence identity wherein the CTLA4 binder retains the ability to bind to CTLA4 and, optionally, HSA.

Epitope Binding and Cross-Blocking

(174) The present invention provides CTLA4 binders set forth herein (e.g., F023700912 or F023700914) as well as binders, e.g., comprising CTLA4 ISVDs (e.g., Nanobodies) that bind to the same CTLA4 epitope of such binders. For example, the present invention includes binders that bind to human CTLA4 by contacting the same residues as F023700912 or F023700914. For example, the present invention provides binders that bind to human CTLA4 at residues VRVTVL (SEQ ID NO: 118; amino acids 33-38 of SEQ ID NO: 110), ADSQVTEVC (SEQ ID NO: 119; amino acids 41-49 of SEQ ID NO: 110) and CKVELMYPPPYYLG (SEQ ID NO: 120; amino acids 93-106 of SEQ ID NO: 110), e.g., all three sites, of human CTLA4. In an embodiment of the invention, the binder demonstrates binding to human CTLA4 at these residues in a hydrogen-deuterium exchange assay, e.g., protects the residues from exchange of hydrogen for deuterium in the presence of deuterium such as D.sub.2O, e.g., as represented by a binding heat map essentially as set forth in FIG. 13.

(175) The present invention includes a CTLA4 binder (e.g., F023700912 or F023700914 or 11F01 or any of its variants set forth herein) that is bound to a polypeptide that comprises the peptide sequences VRVTVL (SEQ ID NO: 118; amino acids 33-38 of SEQ ID NO: 110), ADSQVTEVC (SEQ ID NO: 119; amino acids 41-49 of SEQ ID NO: 110) and CKVELMYPPPYYLG (SEQ ID NO: 120; amino acids 93-106 of SEQ ID NO: 110), for example, CTLA4. Optionally, the polypeptide is on the surface of a cell, e.g., a T-cell and the polypeptide is bound by the CTLA4 binder.

(176) The present invention also provides cross-blocking binders that are able to cross-block binding of any of the binders disclosed herein (e.g., F023700912 or F023700914). Such cross-blocking binders may be any molecule that exhibits such cross-blocking, e.g., an ISVD, Nanobody, antibody or antigen-binding fragment thereof.

(177) In general, a binder (e.g., ISVD such as Nanobody) or antibody or antigen-binding fragment thereof that “cross-blocks” a reference binder refers to a binder (e.g., ISVD such as Nanobody) or antibody or antigen-binding fragment thereof that blocks binding of the reference binder to its antigen in a competition assay by 50% or more, and conversely, the reference binder blocks binding of the binder (e.g., ISVD such as Nanobody) or antibody or antigen-binding fragment thereof to its antigen in a competition assay by 50% or more. Cross-blocking can be determined any assay known in the art, including surface plasmon resonance (SPR), ELISA and flow cytometry.

(178) In an embodiment of the invention, cross-blocking is determined by use of a Biacore assay. For convenience, reference is made to two binders, however, the scope of the present invention includes antibodies and antigen binding fragments thereof, e.g., Fab fragments, that cross-block a binder of the present invention. A Biacore machine (for example the Biacore 3000) is operated in line with the manufacturer's recommendations.

(179) Thus, in one cross-blocking assay, CTLA4 is coupled to a CM5 Biacore chip using standard amine coupling chemistry to generate a CTLA4-coated surface. For example, 200-800 resonance units of CTLA4 would be coupled to the chip (or any amount that gives easily measurable levels of binding but that is readily saturable by the concentrations of test reagent being used).

(180) The two binders (termed A* and B*) to be assessed for their ability to cross-block each other are mixed at a one to one molar ratio of binding sites in a suitable buffer to create the test mixture.

(181) The concentration of each binder in the test mix should be high enough to readily saturate the binding sites for that binder on the CTLA4 molecules captured on the Biacore chip. The binders in the mixture are at the same molar concentration.

(182) Separate solutions containing binder A* alone and binder B* alone are also prepared. Binder A* and binder B* in these solutions should be in the same buffer and at the same concentration as in the test mix.

(183) The test mixture is passed over the CTLA4-coated Biacore chip and the total amount of binding recorded. The chip is then treated in such a way as to remove the bound binders without damaging the chip-bound CTLA4. In an embodiment of the invention, this is done by treating the chip with 30 mM HCl for 60 seconds.

(184) The solution of binder A* alone is then passed over the CTLA4-coated surface and the amount of binding recorded. The chip is again treated to remove all of the bound binder without damaging the chip-bound CTLA4.

(185) The solution of binder B* alone is then passed over the CTLA4-coated surface and the amount of binding recorded.

(186) The maximum theoretical binding of the mixture of binder A* and binder B* is next calculated, and is the sum of the binding of each binder when passed over the CTLA4 surface alone. If the actual recorded binding of the mixture is less than this theoretical maximum, then the two binders are cross-blocking each other.

(187) Thus, in general, a cross-blocking binder according to the invention is one which will bind to CTLA4 in the above Biacore cross-blocking assay such that, during the assay and in the presence of a second binder, the recorded binding is between, for example, 80% and 0.1% (e.g., 80% to 4%) of the maximum theoretical binding, for example between 75% and 0.1% (e.g., 75% to 4%) of the maximum theoretical binding, for example, between 70% and 0.1% (e.g., 70% to 4%) of maximum theoretical binding (as just defined above) of the two binders in combination.

(188) In an embodiment of the invention, an ELISA assay is used for determining whether a CTLA4 binder cross-blocks or is capable of cross-blocking according to the invention.

(189) The general principal of the assay is to have an CTLA4 binder coated onto the wells of an ELISA plate. An excess amount of a second, potentially cross-blocking, CTLA4 binder is added in solution (i.e., not bound to the ELISA plate). A limited amount of CTLA4 is then added to the wells. The coated binder and the binder in solution compete for binding of the limited number of CTLA4 molecules. The plate is washed to remove CTLA4 that has not been bound by the coated binder and to also remove the second, solution phase binder as well as any complexes formed between the second, solution phase binder and CTLA4. The amount of bound CTLA4 is then measured using an appropriate CTLA4 detection reagent. A binder in solution that is able to cross-block the coated binder will be able to cause a decrease in the number of CTLA4 molecules that the coated binder can bind relative to the number of CTLA4 molecules that the coated binder can bind in the absence of the second, solution phase, binder.

Expression Methods

(190) The present invention includes recombinant methods for making an CTLA4 binders (e.g., an ISVD such as a Nanobody) of the present invention (e.g., F023700912 or F023700914) comprising (i) introducing a polynucleotide encoding the amino acid sequence of said CTLA4 binder, for example, wherein the polynucleotide is in a vector and/or is operably linked to a promoter; (ii) culturing the host cell (e.g., CHO or Pichia or Pichia pastoris) under condition favorable to expression of the polynucleotide and, (iii) optionally, isolating the CTLA4 binder from the host cell and/or medium in which the host cell is grown. See e.g., WO 04/041862, WO 2006/122786, WO 2008/020079, WO 2008/142164 or WO 2009/068627.

(191) The invention also relates to polynucleotides that encode CTLA4 binders of the present invention (e.g., an ISVD such as a Nanobody) as described herein (e.g., F023700912 or F023700914). The polynucleotides may, in an embodiment of the invention, be operably linked to one or more control sequences. The polynucleotide may be in the form of a plasmid or vector. Again, such polynucleotides can be generally as described in the published patent applications of Ablynx N. V., such as for example WO 04/041862, WO 2006/122786, WO 2008/020079, WO 2008/142164 or WO 2009/068627.

(192) The invention also relates to hosts or host cells that contain such polynucleotides, vectors, and/or CTLA4 binders described herein (e.g., F023700912 or F023700914). Again, such host cells can be generally as described in the published patent applications of Ablynx N. V., such as for example WO 04/041862, WO 2006/122786, WO 2008/020079, WO 2008/142164 or WO 2009/068627. Examples of specific host cells are discussed below.

(193) Eukaryotic and prokaryotic host cells, including mammalian cells as hosts for expression of the CTLA4 binder (e.g., ISVD such as a Nanobody) are well known in the art and include many immortalized cell lines available from the American Type Culture Collection (ATCC). These include, inter alia, Chinese hamster ovary (CHO) cells, NSO, SP2 cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), A549 cells, 3T3 cells, HEK-293 cells and a number of other cell lines. Mammalian host cells include human, mouse, rat, dog, monkey, pig, goat, bovine, horse and hamster cells. Cell lines of particular preference are selected through determining which cell lines have high expression levels. Other cell lines that may be used are insect cell lines (e.g., Spodoptera frugiperda or Trichoplusia ni), amphibian cells, bacterial cells, plant cells and fungal cells. Fungal cells include yeast and filamentous fungus cells including, for example, Pichia pastoris, Pichia finlandica, Pichia trehalophila, Pichia koclamae, Pichia membranaefaciens, Pichia minuta (Ogataea minuta, Pichia lindneri), Pichia opuntiae, Pichia thermotolerans, Pichia salictaria, Pichia guercuum, Pichia pijperi, Pichia stiptis, Pichia methanolica, Pichia sp., Saccharomyces cerevisiae, Saccharomyces sp., Hansenula polymorpha, Kluyveromyces sp., Kluyveromyces lactis, Candida albicans, Aspergillus nidulans, Aspergillus niger, Aspergillus oryzae, Trichoderma reesei, Chrysosporium lucknowense, Fusarium sp., Fusarium gramineum, Fusarium venenatum, Physcomitrella patens and Neurospora crassa. Pichia sp., any Saccharomyces sp., Hansenula polymorpha, any Kluyveromyces sp., Candida albicans, any Aspergillus sp., Trichoderma reesei, Chrysosporium lucknowense, any Fusarium sp., Yarrowia lipolytica, and Neurospora crassa. The present invention includes any host cell (e.g., a CHO cell or Pichia cell, e.g., Pichia pastoris) containing an CTLA4 binder of the present invention (e.g., F023700912 or F023700914) or containing a polynucleotide encoding such a binder or containing a vector that contains the polynucleotide.

(194) Further, expression of a CTLA4 binder (e.g., an ISVD such as a Nanobody) from production cell lines can be enhanced using a number of known techniques. For example, the glutamine synthetase gene expression system (the GS system) is a common approach for enhancing expression under certain conditions. The GS system is discussed in whole or part in connection with European Patent Nos. 0 216 846, 0 256 055, and 0 323 997 and European Patent Application No. 89303964.4. Thus, in an embodiment of the invention, the mammalian host cells (e.g., CHO) lack a glutamine synthetase gene and are grown in the absence of glutamine in the medium wherein, however, the polynucleotide encoding the immunoglobulin chain comprises a glutamine synthetase gene which complements the lack of the gene in the host cell. Such host cells containing the binder or polynucleotide or vector as discussed herein as well as expression methods, as discussed herein, for making the binder using such a host cell are part of the present invention.

(195) The present invention includes methods for purifying a CTLA4 binder (e.g., ISVD such as a Nanobody) comprising introducing a sample (e.g., culture medium, cell lysate or cell lysate fraction, e.g., a soluble fraction of the lysate) comprising the CTLA4 binder to a purification medium (e.g., cation-exchange medium, anion-exchange medium, hydrophobic exchange medium, affinity purification medium (e.g., protein-A, protein-G, protein-A/G, protein-L)) and either collecting purified CTLA4 binder from the flow-through fraction of said sample that does not bind to the medium; or, discarding the flow-through fraction and eluting bound CTLA4 binder from the medium and collecting the eluate. In an embodiment of the invention, the medium is in a column to which the sample is applied. In an embodiment of the invention, the purification method is conducted following recombinant expression of the antibody or fragment in a host cell, e.g., wherein the host cell is first lysed and, optionally, the lysate is purified of insoluble materials prior to purification on a medium; or wherein the CTLA4 binder is secreted into the culture medium by the host cell and the medium or a fraction thereof is applied to the purification medium.

(196) In general, glycoproteins produced in a particular cell line or transgenic animal will have a glycosylation pattern that is characteristic for glycoproteins produced in the cell line or transgenic animal. Therefore, the particular glycosylation pattern of a CTLA4 binder (e.g., ISVD such as a Nanobody) will depend on the particular cell line or transgenic animal used to produce the CTLA4 binder. CTLA4 binders comprising only non-fucosylated N-glycans are part of the present invention and may be advantageous, because non-fucosylated antibodies have been shown to typically exhibit more potent efficacy than their fucosylated counterparts both in vitro and in vivo (See for example, Shinkawa et al., J. Biol. Chem. 278: 3466-3473 (2003); U.S. Pat. Nos. 6,946,292 and 7,214,775). These CTLA4 binders with non-fucosylated N-glycans are not likely to be immunogenic because their carbohydrate structures are a normal component of the population that exists in human serum IgG.

(197) The present invention includes CTLA4 binders comprising N-linked glycans that are typically added to immunoglobulins produced in Chinese hamster ovary cells (CHO N-linked glycans) or to engineered yeast cells (engineered yeast N-linked glycans), such as, for example, Pichia pastoris. For example, in an embodiment of the invention, the CTLA4 binder (e.g., ISVD such as a Nanobody) comprises one or more of the “engineered yeast N-linked glycans” or “CHO N-linked glycans” that are set forth in FIG. 4 (e.g., G0 and/or G0-F and/or G1 and/or G1-F and/or G2-F and/or Man5). In an embodiment of the invention, the CTLA4 binder comprises the engineered yeast N-linked glycans, i.e., G0 and/or G1 and/or G2, optionally, further including Man5. In an embodiment of the invention, the CTLA4 binders comprise the CHO N-linked glycans, i.e., G0-F, G1-F and G2-F, optionally, further including G0 and/or G1 and/or G2 and/or Man5. In an embodiment of the invention, about 80% to about 95% (e.g., about 80-90%, about 85%, about 90% or about 95%) of all N-linked glycans on the CTLA4 binders are engineered yeast N-linked glycans or CHO N-linked glycans. See Nett et al. Yeast. 28(3): 237-252 (2011); Hamilton et al. Science. 313(5792): 1441-1443 (2006); Hamilton et al. Curr Opin Biotechnol. 18(5): 387-392 (2007). For example, in an embodiment of the invention, an engineered yeast cell is GFI5.0 or YGLY8316 or strains set forth in U.S. Pat. No. 7,795,002 or Zha et al. Methods Mol Biol. 988:31-43 (2013). See also international patent application publication no. WO2013/066765.

Combinations

(198) In particular embodiments, the CTLA4 binders (e.g., ISVD such as a Nanobody) of the present invention may be used alone, or in association with other, further therapeutic agents and/or therapeutic procedures, for treating or preventing any disease such as cancer, e.g., as discussed herein, in a subject in need of such treatment or prevention. Compositions or kits, e.g., pharmaceutical compositions comprising a pharmaceutically acceptable carrier, comprising such CTLA4 binders in association with further therapeutic agents are also part of the present invention.

(199) The term “in association with” indicates that the components, a CTLA4 binder (e.g., ISVD such as a Nanobody) of the present invention along with another agent such as pembrolizumab or nivolumab, can be formulated into a single composition, e.g., for simultaneous delivery, or formulated separately into two or more compositions (e.g., a kit). Each component can be administered to a subject at a different time than when the other component is administered; for example, each administration may be given non-simultaneously (e.g., separately or sequentially) at intervals over a given period of time. Moreover, the separate components may be administered to a subject by the same or by a different route (e.g., wherein a CTLA4 binder of the present invention is administered parenterally and paclitaxel is administered orally).

(200) In particular embodiments, the CTLA4 binders (e.g., ISVD such as a Nanobody) may be used in association with an anti-cancer therapeutic agent or immunomodulatory drug such as an immunomodulatory receptor inhibitor, e.g., an antibody or antigen-binding fragment thereof that specifically binds to the receptor.

(201) In an embodiment of the invention, a CTLA4 binder (e.g., ISVD such as a Nanobody) is in association with one or more of an inhibitors (e.g., a small organic molecule or an antibody or antigen-binding fragment thereof) such as: an MTOR (mammalian target of rapamycin) inhibitor, a cytotoxic agent, a platinum agent a BRAF inhibitor, a CDK4/6 inhibitor an EGFR inhibitor, a VEGF inhibitor, a microtubule stabilizer, a taxane, a CD20 inhibitor, a CD52 inhibitor, a CD30 inhibitor, a RANK (Receptor activator of nuclear factor kappa-B) inhibitor, a RANKL (Receptor activator of nuclear factor kappa-B ligand) inhibitor, an ERK inhibitor, a MAP Kinase inhibitor, an AKT inhibitor, a MEK inhibitor, a PI3K inhibitor, a HER1 inhibitor, a HER2 inhibitor, a HER3 inhibitor, a HER4 inhibitor, a Bcl2 inhibitor, a CD22 inhibitor, a CD79b inhibitor, an ErbB2 inhibitor, or a farnesyl protein transferase inhibitor.

(202) In an embodiment of the invention, a CTLA4 binder (e.g., ISVD such as a Nanobody) is in association with one or more of: anti-CTLA4 antibodies or antigen-binding fragments thereof (e.g., ipilimumab), anti-PD1 antibody or antigen-binding fragment thereof (e.g., pembrolizumab, nivolumab, CT-011), anti-PDL1, anti-CTLA4, anti-TIM3, anti-CS1, (e.g., elotuzumab), anti-KIR2DL1/2/3 (e.g., lirilumab), anti-CD27, anti-CD137 (e.g., urelumab), anti-GITR (e.g., TRX518), anti-PD-L1 (e.g., BMS-936559, MSB0010718C or MPDL3280A), anti-PD-L2, anti-ILT1, anti-ILT2, anti-ILT3, anti-ILT4, anti-ILT5, anti-ILT6, anti-ILT7, anti-ILT8, anti-CD40, anti-OX40, anti-CD137, anti-KIR2DL1, anti-KIR2DL2/3, anti-KIR2DL4, anti-KIR2DL5A, anti-KIR2DL5B, anti-KIR3DL1, anti-KIR3DL2, anti-KIR3DL3, anti-NKG2A, anti-NKG2C, anti-NKG2E, or any small organic molecule inhibitor of such targets; IL-10, anti-IL 10, anti-TSLP (thymic stromal lymphopoietin) or PEGylated IL-10.

(203) In an embodiment of the invention, the molecular weight of the polyethylene glycol (PEG) moiety, on a PEGylated IL-10 molecule, is about 12,000 daltons or about 20,000 daltons.

(204) In an embodiment of the invention, PEGylated IL-10 (e.g., PEGylated human IL-10) comprises one or more polyethylene glycol molecules covalently attached via a linker (e.g., C.sub.2-12 alkyl such as —CH.sub.2CH.sub.2CH.sub.2—) to a single amino acid residue of a single subunit of IL-10, wherein said amino acid residue is the alpha amino group of the N-terminal amino acid residue or the epsilon amino group of a lysine residue. In an embodiment of the invention PEGylated IL-10 is: (PEG).sub.b-L-NH-IL-10; wherein b is 1-9 and L is a C.sub.2-12 alkyl linker moiety covalently attached to a nitrogen (N) of the single amino acid residue of the IL-10. In an embodiment of the invention, the IL-10 of PEGylated IL-10 has the formula: [X—O(CH.sub.2CH.sub.2O).sub.n].sub.b-L-NH-IL-10, wherein X is H or C.sub.1-4 alkyl; n is 20 to 2300; b is 1 to 9; and L is a C.sub.1-11 alkyl linker moiety which is covalently attached to the nitrogen (N) of the alpha amino group at the amino terminus of one IL-10 subunit; provided that when b is greater than 1, the total of n does not exceed 2300. See U.S. Pat. No. 7,052,686.

(205) In an embodiment of the invention, the anti-IL-10 antibody or antigen-binding fragment thereof (e.g., humanized antibody) comprises the CDRs set forth below:

(206) TABLE-US-00016 CDR-L1: (SEQ ID NO: 71) KTSQNIFENLA; CDR-L2: (SEQ ID NO: 72) NASPLQA; CDR-L3: (SEQ ID NO: 73) HQYYSGYT; CDR-H1: (SEQ ID NO: 74) GFTFSDYHMA; CDR-H2: (SEQ ID NO: 75) SITLDATYTYYRDSVRG; CDR-H3: (SEQ ID NO: 76) HRGFSVWLDY; (See U.S. Pat. No. 7,662,379)

(207) In an embodiment of the invention, the anti-TSLP antibody or antigen-binding fragment thereof (e.g., humanized antibody) comprises the CDRs set forth below:

(208) TABLE-US-00017 CDR-H1: (SEQ ID NO: 77) GYIFTDYAMH; CDR-H2: (SEQ ID NO: 78) TFIPLLDTSDYNQNFK; CDR-H3: (SEQ ID NO: 79) MGVTHSYVMDA; CDR-Ll: (SEQ ID NO: 80) RASQPISISVH; CDR-L2: (SEQ ID NO: 81) FASQSIS; CDR-L3: (SEQ ID NO: 82) QQTFSLPYT; (see WO2008/76321)

(209) In an embodiment of the invention, the anti-CD27 antibody or antigen-binding fragment thereof (e.g., humanized antibody) comprises the CDRs set forth below:

(210) TABLE-US-00018 CDR-H1: (SEQ ID NO: 83) GFIIKATYMH; CDR-H2: (SEQ ID NO: 84) RIDPANGETKYDPKFQV; CDR-H3: (SEQ ID NO: 85) YAWYFDV; CDR-L1: (SEQ ID NO: 86) RASENIYSFLA; CDR-L2: (SEQ ID NO: 87) HAKTLAE; CDR-L3: (SEQ ID NO: 88) QHYYGSPLT; (See WO2012/04367).

(211) Thus, the present invention includes compositions comprising a CTLA4 binder (e.g., ISVD such as a Nanobody) in association with pembrolizumab; as well as methods for treating or preventing cancer in a subject comprising administering an effective amount of the CTLA4 binder in association with pembrolizumab (e.g., pembrolizumab dosed at 200 mg once every three weeks) to the subject. Optionally, the subject is also administered in association with a another further therapeutic agent.

(212) In an embodiment of the invention, a CTLA4 binder (e.g., ISVD such as a Nanobody) is in association with a pembrolizumab antibody which comprises an immunoglobulin heavy chain (or CDR-H1, CDR-H2 and CDR-H3 thereof) comprising the amino acid sequence: QVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTNFNEKFKNRVTLTTDSSTTT AYMELKSLQFDDTAVYYCARRDYRFDMGFDYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEP VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEF LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQD WLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN YKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK; (SEQ ID NO: 89) and an immunoglobulin light chain (or CDR-L1, CDR-L2 and CDR-L3 thereof) comprising the amino acid sequence:

(213) TABLE-US-00019 (SEQ ID NO: 90) EIVLTQSPATLSLSPGERATLSCRASKGVSTSGYSYLHWYQQKPGQAPR LLIYLASYLESGVPARFSGSGSGTDFTLTISSLEPEDFAVYYCQHSRDL PLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPRE AKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVY ACEVTHQGLSSPVTKSFNRGEC.

(214) In an embodiment of the invention, a CTLA4 binder (e.g., ISVD such as a Nanobody) is in association with an antibody comprising an immunoglobulin heavy chain (or CDR-H1, CDR-H2 and CDR-H3 thereof) comprising the amino acid sequence: QVQLVESGGGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDNSKNT LFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV LDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK (SEQ ID NO: 91); and an immunoglobulin light chain (or CDR-L1, CDR-L2 and CDR-L3 thereof) comprising the amino acid sequence:

(215) TABLE-US-00020 (SEQ ID NO: 92) EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIY DASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQSSNWPRTF GQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQ WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV THQGLSSPVTKSFNRGEC.

(216) In an embodiment of the invention, a CTLA4 binder is in association with any one or more of: 13-cis-retinoic acid, 3-[5-(methyl sulfonylpiperadinemethyl)-indolyl]-quinolone, 4-hydroxytamoxifen, 5-deooxyuridine, 5′-deoxy-5-fluorouridine, 5-fluorouracil, 6-mecaptopurine, 7-hydroxystaurosporine, A-443654, abirateroneacetate, abraxane, ABT-578, acolbifene, ADS-100380, aflibercept, ALT-110, altretamine, amifostine, aminoglutethimide, amrubicin, amsacrine, anagrelide, anastrozole, angiostatin, AP-23573, ARQ-197, arzoxifene, AS-252424, AS-605240, asparaginase, ATI3387, AT-9263, atrasentan, axitinib, AZD1152, Bacillus Calmette-Guerin (BCG) vaccine, batabulin, BC-210, besodutox, bevacizumab, BGJ398, bicalutamide, Bio111, BIO1140, BKM120, bleomycin, BMS-214662, BMS-247550, BMS-275291, BMS-310705, bortezimib, buserelin, busulfan, calcitriol, camptothecin, canertinib, capecitabine, carboplatin, carmustine, CC8490, CEA (recombinant vaccinia-carcinoembryonic antigen vaccine), cediranib, CG-1521, CG-781, chlamydocin, chlorambucil, chlorotoxin, cilengitide, cimitidine, cisplatin, cladribine, clodronate, cobimetnib, COL-3, CP-724714, cyclophosphamide, cyproterone, cyproteroneacetate, cytarabine, cytosinearabinoside, dabrafenib, dacarbazine, dacinostat, dactinomycin, dalotuzumab, danusertib, dasatanib, daunorubicin, decatanib, deguelin, denileukin, deoxycoformycin, depsipeptide, diarylpropionitrile, diethylstilbestrol, diftitox, DNE03, docetaxel, dovitinib, doxorubicin, droloxifene, edotecarin, yttrium-90 labeled-edotreotide, edotreotide, EKB-569, EMD121974, encorafenib, endostatin, enzalutamide, enzastaurin, epirubicin, epithilone B, ERA-923, erbitux, erlotinib, estradiol, estramustine, etoposide, everolimus, exemestane, ficlatuzumab, finasteride, flavopiridol, floxuridine, fludarabine, fludrocortisone, fluoxymesterone, flutamide, FOLFOX regimen, fulvestrant, galeterone, ganetespib, gefitinib, gemcitabine, gimatecan, glucopyranosyl lipid A, goserelin, goserelin acetate, gossypol, GSK461364, GSK690693, HMR-3339, hydroxyprogesteronecaproate, hydroxyurea, IC87114, idarubicin, idoxyfene, ifosfamide, IM862, imatinib, IMC-1C11, imiquimod, INC280, INCB24360, INO1001, interferon, interleukin-2, interleukin-12, ipilimumab, irinotecan, JNJ-16241199, ketoconazole, KRX-0402, lapatinib, lasofoxifene, LEE011, letrozole, leucovorin, leuprolide, leuprolide acetate, levamisole, liposome entrapped paclitaxel, lomustine, lonafarnib, lucanthone, LY292223, LY292696, LY293646, LY293684, LY294002, LY317615, LY3009120, marimastat, mechlorethamine, medroxyprogesteroneacetate, megestrolacetate, MEK162, melphalan, mercaptopurine, mesna, methotrexate, mithramycin, mitomycin, mitotane, mitoxantrone, a suspension of heat killed Mycobacterium obuense, tozasertib, MLN8054, natitoclax, neovastat, Neratinib, neuradiab, nilotinib, nilutimide, nolatrexed, NVP-BEZ235, oblimersen, octreotide, ofatumumab, oregovomab, ornatuzumab, orteronel, oxaliplatin, paclitaxel, palbociclib, pamidronate, panitumumab, pazopanib, PD0325901, PD184352, PEG-interferon, pemetrexed, pentostatin, perifosine, phenylalaninemustard, PI-103, pictilisib, PIK-75, pipendoxifene, PKI-166, plicamycin, poly-ICLC, porfimer, prednisone, procarbazine, progestins, PSK protein bound polysaccharide (derived from Basidiomycete coriolus versicolor), PLX8394, PX-866, R-763, raloxifene, raltitrexed, razoxin, ridaforolimus, rituximab, romidepsin, RTA744, rubitecan, scriptaid, Sdx102, seliciclib, selumetinib, semaxanib, SF1126, sirolimus, SN36093, sorafenib, spironolactone, squalamine, SR13668, streptozocin, SU6668, suberoylanalide hydroxamic acid, sunitinib, synthetic estrogen, talampanel, talimogene laherparepvec, tamoxifen, temozolomide, temsirolimus, teniposide, tesmilifene, testosterone, tetrandrine, TGX-221, thalidomide, 6-thioguanine, thiotepa, ticilimumab, tipifarnib, tivozanib, TKI-258, TLK286, TNF D (tumor necrosis factor alpha), topotecan, toremifene citrate, trabectedin, trametinib, trastuzumab, tretinoin, trichostatin A, triciribinephosphate monohydrate, triptorelin pamoate, TSE-424, uracil mustard, valproic acid, valrubicin, vandetanib, vatalanib, VEGF trap, vemurafenib, vinblastine, vincristine, vindesine, vinorelbine, vitaxin, vitespan, vorinostat, VX-745, wortmannin, Xr311, Z-100 hot water extract of Bacillus tuberculosis, zanolimumab, ZK186619, ZK-304709, ZM336372 or ZSTK474.

(217) In an embodiment of the invention, a CTLA4 binder (e.g., ISVD such as a Nanobody) is in association with one or more antiemetics including, but not limited to: casopitant (GlaxoSmithKline), Netupitant (MGI-Helsinn) and other NK-1 receptor antagonists, palonosetron (sold as Aloxi by MGI Pharma), aprepitant (sold as Emend by Merck and Co.; Rahway, N.J.), diphenhydramine (sold as Benadryl® by Pfizer; New York, N.Y.), hydroxyzine (sold as Atarax® by Pfizer; New York, N.Y.), metoclopramide (sold as Reglan® by AH Robins Co.; Richmond, Va.), lorazepam (sold as Ativan® by Wyeth; Madison, N.J.), alprazolam (sold as Xanax® by Pfizer; New York, N.Y.), haloperidol (sold as Haldol® by Ortho-McNeil; Raritan, N.J.), droperidol (Inapsine®), dronabinol (sold as Marinol® by Solvay Pharmaceuticals, Inc.; Marietta, Ga.), dexamethasone (sold as Decadron® by Merck and Co.; Rahway, N.J.), methylprednisolone (sold as Medrol® by Pfizer; New York, N.Y.), prochlorperazine (sold as Compazine® by Glaxosmithkline; Research Triangle Park, N.C.), granisetron (sold as Kytril® by Hoffmann-La Roche Inc.; Nutley, N.J.), ondansetron (sold as Zofran® by Glaxosmithkline; Research Triangle Park, N.C.), dolasetron (sold as Anzemet® by Sanofi-Aventis; New York, N.Y.), tropisetron (sold as Navoban® by Novartis; East Hanover, N.J.).

(218) Other side effects of cancer treatment include red and white blood cell deficiency. Accordingly, in an embodiment of the invention, a CTLA4 binder (e.g., ISVD such as a Nanobody) is in association with an agent which treats or prevents such a deficiency, such as, e.g., filgrastim, PEG-filgrastim, erythropoietin, epoetin alfa or darbepoetin alfa.

(219) In an embodiment of the invention, a CTLA4 binder (e.g., ISVD such as a Nanobody) is in association with a vaccine. In an embodiment of the invention, the vaccine is an anti-cancer vaccine, a peptide vaccine or a DNA vaccine. For example, in an embodiment of the invention, the vaccine is a tumor cell (e.g., an irradiated tumor cell) or a dendritic cell (e.g., a dendritic cell pulsed with a tumor peptide).

(220) In an embodiment of the invention, a CTLA4 binder (e.g., ISVD such as a Nanobody) is administered in association with a therapeutic procedure. A therapeutic procedure is one or more steps carried out by a physician or clinician in treating a subject which is intended to alleviate one or more symptoms (e.g., of cancer and/or infectious disease) in the treated subject, whether by inducing the regression or elimination of such symptoms or by inhibiting the progression of such symptom(s), e.g., cancer symptoms such as tumor growth or metastasis, by any clinically measurable degree.

(221) In an embodiment of the invention, a therapeutic procedure is anti-cancer radiation therapy. For example, in an embodiment of the invention, the radiation therapy is external beam therapy (EBT): a method for delivering a beam of high-energy X-rays to the location of the tumor. The beam is generated outside the patient (e.g., by a linear accelerator) and is targeted at the tumor site. These X-rays can destroy the cancer cells and careful treatment planning allows the surrounding normal tissues to be spared. No radioactive sources are placed inside the patient's body. In an embodiment of the invention, the radiation therapy is proton beam therapy: a type of conformal therapy that bombards the diseased tissue with protons instead of X-rays. In an embodiment of the invention, the radiation therapy is conformal external beam radiation therapy: a procedure that uses advanced technology to tailor the radiation therapy to an individual's body structures.

(222) In an embodiment of the invention, the radiation therapy is brachytherapy: the temporary placement of radioactive materials within the body, usually employed to give an extra dose—or boost—of radiation to an area.

(223) In an embodiment of the invention, a surgical procedure administered in association with a CTLA4 binder (e.g., ISVD such as a Nanobody) is surgical tumorectomy.

Therapeutic Uses

(224) The invention includes a method for the preventing and/or treating at least one disease or disorder that can be prevented or treated by the use of a CTLA4 binder (e.g., ISVD such as a Nanobody) of the present invention, optionally in association with a further therapeutic agent or therapeutic procedure, which method comprises administering, to a subject in need thereof, a pharmaceutically active amount of the CTLA4 binder, and/or of a pharmaceutical composition comprising the same.

(225) “Treat” or “treating” means to administer a CTLA4 binder (e.g., ISVD such as a Nanobody) of the present invention, to a subject (e.g., a mammal such as a human) having one or more symptoms of a disease for which the CTLA4 binders are effective, e.g., in the treatment of a subject having cancer or an infectious disease, or being suspected of having cancer or infectious disease, for which the agent has therapeutic activity. Typically, the CTLA4 binder is administered in an “effective amount” or “effective dose” which will alleviate one or more symptoms (e.g., of cancer or infectious disease) in the treated subject or population, whether by inducing the regression or elimination of such symptoms or by inhibiting the progression of such symptom(s), e.g., cancer symptoms such as tumor growth or metastasis, by any clinically measurable degree. The effective amount of the CTLA4 binder may vary according to factors such as the disease stage, age, and weight of the patient, and the ability of the drug to elicit a desired response in the subject.

(226) The subject to be treated may be any warm-blooded animal, but is in particular a mammal, and more in particular a human being. As will be clear to the skilled person, the subject to be treated will in particular be a person suffering from, or at risk from, the diseases and disorders mentioned herein. Generally, the treatment regimen will be followed until the desired therapeutic effect is achieved and/or for as long as the desired therapeutic effect is to be maintained. Again, this can be determined by the clinician.

(227) The CTLA4 binders (e.g., ISVD such as a Nanobody), polypeptides, compounds, and polynucleotides (e.g., vectors) described herein are preferably administered to the circulation. As such, they can be administered in any suitable manner that allows the CTLA4 binders, polypeptides, compounds, and polynucleotides to enter the circulation, such as intravenously, via injection or infusion, or in any other suitable manner (including oral administration, subcutaneous administration, intramuscular administration, administration through the skin, intranasal administration, administration via the lungs, etc.) that allows the CTLA4 binders, polypeptides, compounds, and polynucleotides to enter the circulation. Suitable methods and routes of administration will be clear to the skilled person, again for example also from the teaching of the published patent applications of Ablynx N. V., such as for example WO 04/041862, WO 2006/122786, WO 2008/020079, WO 2008/142164 or WO 2009/068627.

(228) To prepare pharmaceutical or sterile compositions of the CTLA4 binders (e.g., ISVD such as a Nanobody) of the present invention, the CTLA4 binders is admixed with a pharmaceutically acceptable carrier or excipient. See, e.g., Remington's Pharmaceutical Sciences and U.S. Pharmacopeia: National Formulary, Mack Publishing Company, Easton, Pa. (1984) or Remington's Pharmaceutical Sciences. Such compositions are part of the present invention.

(229) The scope of the present invention includes dessicated, e.g., freeze-dried, compositions comprising an CTLA4 binders (e.g., ISVD such as a Nanobody) or a pharmaceutical composition thereof that includes a pharmaceutically acceptable carrier but substantially lacks water.

(230) Formulations of therapeutic and diagnostic agents may be prepared by mixing with acceptable carriers, excipients, or stabilizers in the form of, e.g., lyophilized powders, slurries, aqueous solutions or suspensions (see, e.g., Hardman, et al. (2001) Goodman and Gilman's The Pharmacological Basis of Therapeutics, McGraw-Hill, New York, N.Y.; Gennaro (2000) Remington: The Science and Practice of Pharmacy, Lippincott, Williams, and Wilkins, New York, N.Y.; Avis, et al. (eds.) (1993) Pharmaceutical Dosage Forms: Parenteral Medications, Marcel Dekker, NY; Lieberman, et al. (eds.) (1990) Pharmaceutical Dosage Forms: Tablets, Marcel Dekker, NY; Lieberman, et al. (eds.) (1990) Pharmaceutical Dosage Forms: Disperse Systems, Marcel Dekker, NY; Weiner and Kotkoskie (2000) Excipient Toxicity and Safety, Marcel Dekker, Inc., New York, N.Y.).

(231) Generally, for the prevention and/or treatment of the diseases and disorders mentioned herein and depending on the specific disease or disorder to be treated, the potency and/or the half-life of the specific fusion proteins or constructs to be used, the specific route of administration and the specific pharmaceutical formulation or composition used, the Nanobodies and polypeptides of the invention will generally be administered in an amount between 1 gram and 0.01 microgram per kg body weight per day, preferably between 0.1 gram and 0.1 microgram per kg body weight per day, such as about 1, 10, 100 or 1000 microgram per kg body weight per day, either continuously (e.g., by infusion), as a single daily dose or as multiple divided doses during the day. The clinician will generally be able to determine a suitable daily dose, depending on the factors mentioned herein. It will also be clear that in specific cases, the clinician may choose to deviate from these amounts, for example on the basis of the factors cited above and his expert judgment. Generally, some guidance on the amounts to be administered can be obtained from the amounts usually administered for comparable conventional antibodies or antibody fragments against the same target administered via essentially the same route, taking into account however differences in affinity/avidity, efficacy, biodistribution, half-life and similar factors well known to the skilled person.

(232) The mode of administration of a CTLA4 binder (e.g., ISVD such as a Nanobody) to a subject can vary. Routes of administration include oral, rectal, transmucosal, intestinal, parenteral; intramuscular, subcutaneous, intradermal, intramedullary, intrathecal, direct intraventricular, intravenous, intraperitoneal, intranasal, intraocular, inhalation, insufflation, topical, cutaneous, transdermal, or intra-arterial.

(233) Determination of the appropriate dose is made by the clinician, e.g., using parameters or factors known or suspected in the art to affect treatment. Generally, in determining the dose, the dose begins with an amount somewhat less than the optimum dose and it is increased by small increments thereafter until the desired or optimum effect is achieved relative to any negative side effects. Important diagnostic measures include those of symptoms of, e.g., the inflammation or level of inflammatory cytokines produced. In general, it is desirable that a biologic that will be used is derived from the same species as the animal targeted for treatment, thereby minimizing any immune response to the reagent. In the case of human subjects, for example, chimeric, humanized and fully human antibodies are may be desirable. Guidance in selecting appropriate doses is available (see, e.g., Wawrzynczak (1996) Antibody Therapy, Bios Scientific Pub. Ltd, Oxfordshire, UK; Kresina (ed.) (1991) Monoclonal Antibodies, Cytokines and Arthritis, Marcel Dekker, New York, N.Y.; Bach (ed.) (1993) Monoclonal Antibodies and Peptide Therapy in Autoimmune Diseases, Marcel Dekker, New York, N.Y.; Baert et al. (2003) New Engl. J. Med. 348:601-608; Milgrom et al. (1999) New Engl. J. Med. 341:1966-1973; Slamon et al. (2001) New Engl. J. Med. 344:783-792; Beniaminovitz et al. (2000) New Engl. J. Med. 342:613-619; Ghosh et al. (2003) New Engl. J. Med. 348:24-32; Lipsky et al. (2000) New Engl. J. Med. 343:1594-1602).

(234) Whether a disease symptom has been alleviated can be assessed by any clinical measurement typically used by physicians or other skilled healthcare providers to assess the severity or progression status of that symptom. While an embodiment of the present invention (e.g., a treatment method or article of manufacture) may not be effective in alleviating the target disease symptom(s) in every subject, it should alleviate the target disease symptom(s) in a statistically significant number of subjects as determined by any statistical test known in the art such as the Student's t-test, the chi.sup.2-test, the U-test according to Mann and Whitney, the Kruskal-Wallis test (H-test), Jonckheere-Terpstra-test and the Wilcoxon-test.

(235) Generally, the treatment regimen will be followed until the desired therapeutic effect is achieved and/or for as long as the desired therapeutic effect is to be maintained. Again, this can be determined by the clinician.

(236) As the CTLA4 binders (e.g., ISVD such as a Nanobody) of the present invention are capable of binding to CTLA4, they can in particular be used for treatment or prevention of cancer, metastatic cancer, a solid tumor, a hematologic cancer, leukemia, lymphoma, osteosarcoma, rhabdomyosarcoma, neuroblastoma, kidney cancer, leukemia, renal transitional cell cancer, bladder cancer, Wilm's cancer, ovarian cancer, pancreatic cancer, breast cancer, prostate cancer, bone cancer, lung cancer, non-small cell lung cancer, gastric cancer, colorectal cancer, cervical cancer, synovial sarcoma, head and neck cancer, squamous cell carcinoma, multiple myeloma, renal cell cancer, retinoblastoma, hepatoblastoma, hepatocellular carcinoma, melanoma, rhabdoid tumor of the kidney, Ewing's sarcoma, chondrosarcoma, brain cancer, glioblastoma, meningioma, pituitary adenoma, vestibular schwannoma, a primitive neuroectodermal tumor, medulloblastoma, astrocytoma, anaplastic astrocytoma, oligodendroglioma, ependymoma, choroid plexus papilloma, polycythemia vera, thrombocythemia, idiopathic myelfibrosis, soft tissue sarcoma, thyroid cancer, endometrial cancer, carcinoid cancer or liver cancer, breast cancer and gastric cancer.

(237) CTLA4 binders (e.g., ISVD such as a Nanobody) of the present invention can be used for treatment or prevention of infectious diseases such as, for example, viral infection, bacterial infection, fungal infection or parasitic infection. In an embodiment of the invention, the viral infection is infection with a virus selected from the group consisting of human immunodeficiency virus (HIV), ebola virus, hepatitis virus (A, B, or C), herpes virus (e.g., VZV, HSV-I, HAV-6, HSV-II, and CMV, Epstein Barr virus), adenovirus, influenza virus, flaviviruses, echovirus, rhinovirus, coxsackie virus, coronavirus, respiratory syncytial virus, mumps virus, rotavirus, measles virus, rubella virus, parvovirus, vaccinia virus, HTLV virus, dengue virus, papillomavirus, molluscum virus, poliovirus, rabies virus, JC virus or arboviral encephalitis virus. In an embodiment of the invention, the bacterial infection is infection with a bacteria selected from the group consisting of Chlamydia, rickettsial bacteria, mycobacteria, staphylococci, streptococci, pneumonococci, meningococci and gonococci, klebsiella, proteus, serratia, pseudomonas, Legionella, Corynebacterium diphtheriae, Salmonella, bacilli, Vibrio cholerae, Clostridium tetan, Clostridium botulinum, Bacillus anthricis, Yersinia pestis, Mycobacterium leprae, Mycobacterium lepromatosis, and Borriella. In an embodiment of the invention, the fungal infection is infection with a fungus selected from the group consisting of Candida (albicans, krusei, glabrata, tropicalis, etc.), Cryptococcus neoformans, Aspergillus (fumigatus, niger, etc.), Genus Mucorales (mucor, absidia, rhizopus), Sporothrix schenkii, Blastomyces dermatitidis, Paracoccidioides brasiliensis, Coccidioides immitis and Histoplasma capsulatum. In an embodiment of the invention, the parasitic infection is infection with a parasite selected from the group consisting of Entamoeba histolytica, Balantidium coli, Naegleria fowleri, Acanthamoeba, Giardia lamnbia, Cryptosporidium, Pneumocystis carinii, Plasmodium vivax, Babesia microti, Trypanosoma brucei, Trypanosoma cruzi, Leishmania donovani, Toxoplasma gondii, Nippostrongylus brasiliensis.

(238) The present invention also includes methods for: preventing CTLA4 mediated inhibition of: T-cell costimulatory signaling; T-cell activation, T-cell proliferation; preventing CTLA4 binding to B7-1 (CD80) or B7-2 (CD86); and/or enhancing T-cell activation
in the body of a subject by administering the CTLA4 binder (e.g., F023700912 or F023700914) to the subject; or in vitro by contacting CTLA4 with the CTLA4 binder. Such activities can be mediated via the CTLA4 binder. Thus, such methods may also be performed with any binder that includes a CTLA4 binder.

(239) The invention also relates to methods of treatment of the aforementioned diseases and disorders, which generally comprise administering to a subject in need thereof (i.e. suffering from one of the aforementioned diseases) a therapeutically effective amount of a CTLA4 binder (e.g., ISVD such as a Nanobody) of the invention. The invention also relates to a CTLA4 binder of the invention for use in the prevention or treatment of one of the aforementioned diseases or disorders.

(240) The present invention also provides an injection device comprising any of the CTLA4 binders (e.g., ISVD such as a Nanobody), polypeptides or polynucleotides set forth herein or a pharmaceutical composition thereof. An injection device is a device that introduces a substance into the body of a patient via a parenteral route, e.g., intramuscular, subcutaneous or intravenous. For example, an injection device may be a syringe (e.g., pre-filled with the pharmaceutical composition, such as an auto-injector) which, for example, includes a cylinder or barrel for holding fluid to be injected (e.g., comprising the CTLA4 binder or a pharmaceutical composition thereof), a needle for piecing skin and/or blood vessels for injection of the fluid; and a plunger for pushing the fluid out of the cylinder and through the needle bore. In an embodiment of the invention, an injection device that comprises an CTLA4 binder or a pharmaceutical composition thereof is an intravenous (IV) injection device. Such a device includes the CTLA4 binder or a pharmaceutical composition thereof in a cannula or trocar/needle which may be attached to a tube which may be attached to a bag or reservoir for holding fluid (e.g., saline; or lactated ringer solution comprising NaCl, sodium lactate, KCl, CaCl.sub.2) and optionally including glucose) introduced into the body of the subject through the cannula or trocar/needle. The CTLA4 binder or a pharmaceutical composition thereof may, in an embodiment of the invention, be introduced into the device once the trocar and cannula are inserted into the vein of a subject and the trocar is removed from the inserted cannula. The IV device may, for example, be inserted into a peripheral vein (e.g., in the hand or arm); the superior vena cava or inferior vena cava, or within the right atrium of the heart (e.g., a central IV); or into a subclavian, internal jugular, or a femoral vein and, for example, advanced toward the heart until it reaches the superior vena cava or right atrium (e.g., a central venous line). In an embodiment of the invention, an injection device is an autoinjector; a jet injector or an external infusion pump. A jet injector uses a high-pressure narrow jet of liquid which penetrate the epidermis to introduce the CTLA4 binder or a pharmaceutical composition thereof to a patient's body. External infusion pumps are medical devices that deliver the CTLA4 binder or a pharmaceutical composition thereof into a patient's body in controlled amounts. External infusion pumps may be powered electrically or mechanically. Different pumps operate in different ways, for example, a syringe pump holds fluid in the reservoir of a syringe, and a moveable piston controls fluid delivery, an elastomeric pump holds fluid in a stretchable balloon reservoir, and pressure from the elastic walls of the balloon drives fluid delivery. In a peristaltic pump, a set of rollers pinches down on a length of flexible tubing, pushing fluid forward. In a multi-channel pump, fluids can be delivered from multiple reservoirs at multiple rates.

(241) It should also be noted that the Figures, any Sequence Listing and the Experimental Part/Examples are only given to further illustrate the invention and should not be interpreted or construed as limiting the scope of the invention and/or of the appended claims in any way, unless explicitly indicated otherwise herein.

(242) Other aspects, embodiments, advantages and applications of the invention will become clear from the further description herein.

EXAMPLES

(243) These examples are intended to exemplify the present invention are not a limitation thereof. Compositions and methods set forth in the Examples form part of the present invention.

Example 1: F023700906 Nanobody Binding to CTLA-4-Fc

(244) Monovalent F023700906 Nanobody 11F01 (L11V,A14P,Q45R,A74S,K83R, V89L,M96P,Q108L)-FLAG3-HIS6), a building block of F023700912, demonstrates binding to CTLA-4-Fc fusion molecule from both human and cynomolgus monkey. On-rate, off-rate and affinity were determined on a ProteOn XPR36 (BioRad 670BR0166) using human CTLA-4-hFc and cynomolgus monkey CTLA4-hFc (Table D below). These results demonstrate high-affinity binding of the Nanobody to human and cynomolgus monkey CTLA-4 suggesting potential for the Nanobody to modulate the function of CTLA-4 and that cynomolgus monkey may be used as a toxicology species.

(245) TABLE-US-00021 TABLE D-1 Nanobody Binding to Human or Cynomolgous Monkey CTLA-4-Fc Human CTLA-4-Fc Cynomolgus CTLA-4-Fc Ka Kd KD Ka Kd KD (1/Ms) (1/s) (M) (1/Ms) (1/s) (M) F023700906 4.8E+06 5.9E−03 1.2E−09 4.7E+06 5.7E−03 1.2E−09

(246) TABLE-US-00022 TABLE D-2 Reagents Expression Conc. Formulation SEC RP Reagent system (mg/ml) Buffer purity purity hCTLA4-Fc HEK293F 16.13 10 mM Sodium 94.86% 61.50% Phosphate, (~150 KDa 75 mM (tetramer) NaCl, 3% Sucrose, pH = 7.4 cynoCTLA4 HEK293EB 0.32 PBS pH 7.4 81.58% 83.50% -Fc NA

Example 2: F023700912 Nanobody Binding to Cell Surface CTLA4

(247) F023700912 demonstrates binding to human CTLA-4 expressed on cell surface. Binding of batches of F023700912 (11F01 (E1D,L11V,A14P,Q45R,A74S,K83R,V89L,M96P,Q108L)-35GS-11F01 (L11V,A14P,Q45R,A74S,K83R,V89L,M96P,Q108L)-35GS-ALB 11002-A]) (filled circles), F023700925 (PD1 binder-35GS-PD1 binder-35GS-11F01(L11V,A14P,Q45R,A74S,K83R,V89L,M96P,Q108L)-35GS-11F01(L11V,A14P,Q45R,A74S,K83R,V89L,M96P,Q108L)-35GS-ALB 11002-A]) (filled squares) and an irrelavant Nb (filled triangles) to (A) bulksorted hCTLA4-overexpressing jurkat JE6.2.11 cells or (B) hCTLA4-overexpressing CHO-K1 cells was studied by flow cytometry. Nanobodies were detected via the ALB 11002-binding mAB ABH0074. The data generated in these experiments are set forth in FIG. 5 (A-B). These results demonstrate binding of the F023700912 and F023700925 to CTLA-4 expressed on cell surface suggesting that these Nanobodies modulate the function of CTLA-4.

(248) FIG. 5 (A-B) is a dilution series (start concentration 1 μM, 1/4 serial dilution, 12 pts) of batches of half-life extended (ALB0011 building block) Nbs F023700912 (filled circles), F023700925 (filled squares) and negative control Nb IRR00051 (filled triangles) in 200 μl FACS buffer (PBS (Life Technologies, 14190-094), 10% heat-inactivated foetal bovine serum (Sigma, F7524), 0.05% NaN.sub.3 (ThermoScientific, 19038)) were added to (A) 2E4 bulksorted human CTLA4-overexpressing jurkat JE6.2.11 cells/well or (B) 2E4 human CTLA4-overexpressing CHO-K1 cells/well and incubated for 30 minutes at 4° C.

(249) After three washing steps (1 washing step=removal of Nb dilutions, addition of 100 μl cold FACS buffer, centrifugation for 5 minutes at 250 g), the cells were incubated for 30 minutes at 4° C. with 3 μg/ml anti-ALB 11002 mouse mAb ABH00074 in cold FACS buffer for detection of the half-life-extended Nanobodies.

(250) After three washing steps, the cells were incubated for 30 minutes at 4° C. with a 1/100 dilution in cold FACS buffer of PE goat F(ab′)2 anti-mouse IgG (Jackson ImmunoResearch, 115-116-071).

(251) After three washing steps, the cells were resuspended in 50 μl cold FACS buffer supplemented with 5 nM TO-PRO-3 (Molecular Probes, T3605) and analyzed with a FACS Canto.

(252) First, a P1 population is selected based on FSC-SSC distribution. Stopping gate was set on 10000 cells in P1. From this population the TO-PRO-3+ cells (dead cells) are excluded. For this P1/TO-PRO-3-negative population the median PE value is calculated.

Example 3: F023700912 Nanobody Blocks Binding of CTLA-4 to CD80 and CD86

(253) F023700912 block binding of human CTLA-4 to its ligands CD80 and CD86. Flow cytometry analysis of a competition experiment of F023700912 (filled circles) and ipilimumab (filled squares) with fixed concentrations (10×EC30) of (A) hCD80-hFc or (B) hCD86-hFc on hCTLA4-overexpressing CHO-K1 cells. The ligands were detected via the human IgG Fc fusion protein. The data generated in these experiments are set forth in FIG. 6 (A-B). These results demonstrate the ability of F023700912 to block binding of CTLA-4 to its ligands CD80 and CD86, illustrating the ability of F023700912 to affect immune responses modulated by CTLA-4 and its interactions with CD80 and CD86.

(254) FIG. 6 (A-B) is a dilution series (start concentration 1 μM, 1/3 serial dilution, 12 pts) of Nb F023700912 (filled circles) and Ipilimumab (filled squares) in 100 μl FACS buffer (PBS (Life Technologies, 14190-094), 10% heat-inactivated foetal bovine serum (Sigma, F7524), 0.05% NaN.sub.3 (ThermoScientific, 19038)) were added to 1E5 human CTLA4-overexpressing CHO-K1 cells/well in the presence of a fixed concentration of (A) FITC-labelled human CD80-hFc-HIS6 or (B) FITC-labelled human CD86-hFc-HIS6 (FITC labelling was performed with a degree of labelling of 3.6 and 2 respectively; concentration=10×EC30, being 3.71E-08 M or 4.35E-08 M respectively) and incubated for 90 minutes at 4° C.

(255) After three washing steps (1 washing step=removal of Nb dilutions, addition of 100 μl cold FACS buffer, centrifugation for 5 minutes at 250 g), the cells were resuspended in 50 μl cold FACS buffer supplemented with 5 nM TO-PRO-3 (Molecular Probes, T3605) and analyzed with a FACS Canto.

(256) First, a P1 population is selected based on FSC-SSC distribution. Stopping gate was set on 10000 cells in P1. From this population the TO-PRO-3+ cells (dead cells) are excluded. For this P1/TO-PRO-3-negative population the median FITC value is calculated.

Example 4: F023700912 Specificity Assessment

(257) Specificity assessment F023700912 demonstrated selective binding to CTLA-4. Specificity assessment against BTLA, CD8, PD1, CTLA4, LAG3, CD28 was performed on overexpressing cells using flow cytometry, whereas ICOS binding was evaluated in ELISA as a recombinant protein (hICOS-hFc). Expression of BTLA, CD8, PD1, CTLA4, LAG3, CD28 was confirmed via directly-labelled target-specific Abs. Anti-hICOS and anti-hCTLA4/anti-hPD1 positive controls were all positive. No binding to hICOS was observed in the ELISA assays. FIG. 7(A-H) assesses binding to negative control L cells, negative control CHO-K1 cells, huCD28+ L cells, huCD8alpha+ L cells, huLag-3+ CHO-K1 cells, huBTLA+ CHO-K1 cells, huCTLA-4+ CHO-K cells, and huPD-1+ CHO-K1 cells, respectively. No binding to BTLA, CD8, PD1, LAG3, CD28 could be observed for F023700912, whereas potent binding of F023700912 was observed on CTLA-4+ CHO-K1 cells. The data generated in these experiments are set forth in FIG. 7 (A-H). These results illustrated selective binding of F023700912 to CTLA-4 predicting minimal off-target effects upon in vivo administration.

(258) FIG. 7 (A-H) is a dilution series (start concentration 1 M, 1/4 serial dilution, 12 pts) of batches of half-life extended (ALB0011 building block) Nbs F023700912 (filled circles), F023700925 (filled squares) and negative control Nb IRR00051 (filled triangles) in 200 μl FACS buffer (PBS (Life Technologies, 14190-094), 10% heat-inactivated foetal bovine serum (Sigma, F7524), 0.05% NaN.sub.3 (ThermoScientific, 19038)) were added to (A) 2E4 L-cells/well, (B) 2E4 CHO-K1 cells/well, (C) human CD28-overexpressing L-cells or (D) human CD8 alpha-overexpressing L-cells, (E) 2E4 human LAG3-overexpressing CHO-K1/well, (F) 2E4 human BTLA-overexpressing CHO-K1 cells/well, (G) human CTLA4-overexpressing CHO-K1 cells/well or (H) human PD1-overexpressing CHO-K1 cells/well and incubated for 30 minutes at 4° C.

(259) After three washing steps (1 washing step=removal of Nb dilutions, addition of 100 μl cold FACS buffer, centrifugation for 5 minutes at 250 g), the cells were incubated for 30 minutes at 4° C. with 3 μg/ml anti-ALB0011 mouse mAb ABH00074 in cold FACS buffer for detection of the half-life-extended Nbs.

(260) After three washing steps, the cells were incubated for 30 minutes at 4° C. with a 1/100 dilution in cold FACS buffer of PE goat F(ab′)2 anti-mouse IgG (Jackson ImmunoResearch, 115-116-071).

(261) After three washing steps, the cells were resuspended in 50 μl cold FACS buffer supplemented with 5 nM TO-PRO-3 (Molecular Probes, T3605) and analyzed with a FACS Canto.

(262) First, a P1 population is selected based on FSC-SSC distribution. Stopping gate was set on 10000 cells in P1. From this population the TO-PRO-3+ cells (dead cells) are excluded. For this P1/TO-PRO-3-negative population the median PE value is calculated.

Example 5: F023700912 Nanobody Binding to Human, Rhesus Monkey and Mouse Albumin

(263) F023700912 binds to human, rhesus monkey and mouse albumin, predicting prolonged half-life when compared to non-albumin-binding Nanobodies. Binding to human, rhesus monkey and mouse serum albumin was observed, when analyzed using surface plasmin resonance (SPR). The data are set forth below in Table E. Albumin binding of F023700912 is expected to reduce the clearance of the Nanobody upon in vivo administration improving its therapeutic potential.

(264) TABLE-US-00023 TABLE E Binding of Nanobody to Albumin. Human serum albumin Rhesus serum albumin Mouse serum albumin Ka Kd KD Ka Kd KD Ka Kd KD (1/Ms) (1/s) (M) (1/Ms) (1/s) (M) (1/Ms) (1/s) (M) F023700912 9.4E+04 8.8E−03 9.3E−08 9.5E+04 8.9E−03 9.3E−08 1.2E+05 1.8E−01 1.5E−06 F023700925 3.4E+04 7.6E−03 2.2E−07 3.3E+04 8.1E−03 2.4E−07 4.8E+04 1.5E−01 3.1E−06 Instrument: Biacore T100 (GE Healthcare); Sensor chip: CM5 (ID T160713-2, GE Healthcare, lot 10242599)

Example 6: Nanobody F023700906 N73 Variants

(265) Variants F023701051 (11F01(L11V,A14P,Q45R,N73Q,A74S,K83R,V89L, M96P,Q108L)-FLAG3-HIS6), F023701054 (11F01(L11V,A14P,Q45R,N73T,A74S,K83R, V89L,M96P,Q108L)-FLAG3-HIS6), and F023701061 (11F01(L11V,A14P,Q45R,N73Y, A74S,K83R,V89L,M96P,Q108L)-FLAG3-HIS6) were compared to F023700906 for their ability to block binding of (A) CD80 or (B) CD86 to CTLA-4 expressing CHO-K1 cells. All these variants were able to block binding of CD80 and CD84 to CTLA-4. Blocking of CTLA4 to CD80 and CD86 was determined for several of the variants. These blocking data are set forth in FIG. 8 (A-B). These results illustrate the feasibility of varying the amino acid in position N73 without major impact on the ability of the Nanobodies to block binding of CD80 or CD86 to CTLA-4. Such variants will allow for avoidance of deamidation at N73.

Example 7: F023700912 Eradicates Established Solid Tumors in Humanized Mice

(266) Humanized mice (Jackson Laboratories) were implanted with Panc 08.13 tumor cells (human pancreatic adenocarcinoma). Mice with established tumors (˜100 mm.sup.3, n=9-10/group) were treated as follows: 1-Isotype controls (hIgG1-2 mg/kg and hIgG4-3 mg/kg); 2-Ipilimumab-N297A (3 mg/kg); 3-Ipilimumab (3 mg/kg); 4-Pembrolizumab (2 mg/kg); 5-Ipilimumab (3 mg/kg)+Pembrolizumab (2 mg/kg); 6-F023700912 (5 mg/kg; indicated as CTLA4-Nab 5), 7-F023700912 (15 mg/kg; indicated as CTLA4-Nab-15), and 8-F023700912 (15 mg/kg)+Pembrolizumab (2 mg/kg). All the antibodies were injected subcutaneously every 7 days for 6 doses. F023700912 was administered subcutaneously every 3.5 days for 11 doses. Tumor volume and body weight were measured every 4-5 days. Shown in FIG. 9 (A-B) are average tumor volumes±SEM, individual tumor volumes on day-37, and tumor volumes in individual mice over the course of the experiment. The tumor volume for each treatment group is also shown in FIG. 9 (C-J). Average (mean±SEM) and individual body weight changes in each treatment group were also measured (FIG. 9 (K-S)). The number of mice that were found dead or humanely euthanized due to body weight loss was indicated as ‘#’. ‘↑’ indicated antibody and ‘*’ indicated Nanobody dosing schedule. These data illustrated the ability of F023700912 to induce anti-human tumor response in vivo in animals that harbor human immune cells. These data support the potential of F023700912 in the treatment of human cancer.

Example 8: Binding of F023700912 and F023700925 to Pre-Existing Antibodies from Healthy Subjects and Cancer Patients

(267) Trivalent reference Nanobody, 013700112 (not modified for reducing the binding of pre-existing antibodies) demonstrates binding to several serum samples derived from (FIG. 10A) healthy subjects or (FIG. 10B) cancer patients. Sequence optimized trivalent Nanobody of similar size, F023700912, demonstrates a lower frequency of binding to the same serum samples. F023700925 comprises the same building blocks as F023700912. Despite the larger size, the pentavalent F023700925 Nanobody exhibits no more binding to pre-existing Abs than the reference Nanobody 013700112. Binding of pre-existing antibodies to Nanobodies captured on human serum albumin (HSA) was evaluated using the ProteOn XPR36 (Bio-Rad Laboratories, Inc.). PBS/Tween (phosphate buffered saline, pH7.4, 0.005% Tween20) was used as running buffer and the experiments were performed at 25° C. The ligand lanes of a ProteOn GLC Sensor Chip were activated with EDC/NHS (flow rate 30 μl/min) and HSA was injected at 10 g/ml in ProteOn Acetate buffer pH4.5 (flow rate 100 μl/min) to render immobilization levels of approximately 3600 RU. After immobilization, surfaces were deactivated with ethanolamine HCl (flow rate 30 μl/min). Nanobodies were injected for 2 minutes at 45 μl/min over the HSA surface to render a Nanobody capture level of approximately 600 RU for trivalent F023700912 and approximately 1000 RU for pentavalent F023700925. The samples containing pre-existing antibodies were diluted 1:10 in PBS-Tween20 (0.005%) before being injected for 2 minutes at 45 μl/min followed by a subsequent 400 seconds dissociation step. After each cycle (i.e., before a new Nanobody capture and blood sample injection step) the HSA surfaces were regenerated with a 2 minute injection of HCl (100 mM) at 45 μl/min. Sensorgram processing and data analysis was performed with ProteOn Manager 3.1.0 (Bio-Rad Laboratories, Inc.). Sensorgrams showing pre-existing antibody binding were obtained after double referencing by subtracting 1) Nanobody-HSA dissociation and 2) non-specific binding to reference ligand lane containing HSA only. Binding levels of pre-existing antibodies were determined by setting report points at 125 seconds (5 seconds after end of association). As a reference, the samples containing pre-existing antibodies were also tested for binding to a trivalent Nanobody not modified for reducing the binding of these pre-existing antibodies (TO 013700112).

Example 9: Epitope Mapping of Anti-hCTLA4 Nanobody by Hydrogen Deuterium Exchange Mass Spectrometry

(268) Contact areas between anti-hCTLA4 nanobody, F023700912 were determined by use of hydrogen deuterium exchange mass spectrometry (HDX-MS) analysis. HDX-MS measures the incorporation of deuterium into the amide backbone of the protein and changes in this incorporation are influenced by the hydrogen's solvent exposure. A comparison of the deuterium exchange levels in antigen-alone samples and nanobody-bound samples was done to identify antigen regions that may be in contact with the nanobody.

(269) The human CTLA4 residues most strongly protected from deuteration by the nanobody, F023700912 were VRVTVL (SEQ ID NO: 118; amino acids 33-38 of SEQ ID NO: 110), ADSQVTEVC (SEQ ID NO: 119; amino acids 41-49 of SEQ ID NO: 110) and CKVELMYPPPYYLG (SEQ ID NO: 120; amino acids 93-106 of SEQ ID NO: 110). A heat map for demonstrating F023700912 binding to CTLA4 is set forth in FIG. 13.

(270) TABLE-US-00024 TABLE F Amino Acid Sequences (SEQ ID NO: 110) Human AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQ CTLA4 VTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDT GLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFHHHHHH HHHGGQ