METHOD FOR THE MICROBIAL PRODUCTION OF SPECIFIC NATURAL CAPSAICINOIDS
20220403427 · 2022-12-22
Assignee
Inventors
- Hui Chen (North Billerica, MA, US)
- Xiaodan Yu (Lexington, MA, US)
- LanLan ZHOU (Bedford, MA, US)
- Hongxue WANG (Jiangsu, CN)
- Min WANG (Bedford, MA, US)
Cpc classification
A61P29/00
HUMAN NECESSITIES
C07C233/20
CHEMISTRY; METALLURGY
C12P13/02
CHEMISTRY; METALLURGY
C11B9/0061
CHEMISTRY; METALLURGY
A61K9/0014
HUMAN NECESSITIES
A23V2002/00
HUMAN NECESSITIES
C07C233/18
CHEMISTRY; METALLURGY
International classification
C12P13/02
CHEMISTRY; METALLURGY
A23L27/10
HUMAN NECESSITIES
A61K9/00
HUMAN NECESSITIES
C07C233/18
CHEMISTRY; METALLURGY
C07C233/20
CHEMISTRY; METALLURGY
Abstract
The present invention relates to the production of capsaicinoid compounds including Capsaicin and Nonivamide via microbial fermentation.
Claims
1. A biosynthetic method of making a capsaicinoid of interest comprising: a) expressing an ACS and CS in a transformed cellular system; b) growing the cellular system in a medium; and, c) producing the capsaicinoid of interest.
2. The biosynthetic method of claim 1, wherein the ACS is cloned from a plant of the Capsicum genus.
3. The biosynthetic method of claim 2, wherein the Capsicum genus plant is the ghost chili.
4. The biosynthetic method of claim 1, wherein the ACS expressed is derived from a gene cloned from Arabidopsis based on LCAS4 or LCAS5.
5. The biosynthetic method of claim 1, wherein the CS is cloned from a plant of the Capsicum genus.
6. The biosynthetic method of claim 5, wherein the Capsicum genus plant is the ghost chili.
7. The biosynthetic method of claim 1, further comprising feeding a source material to said cellular system in addition to culture media.
8. The biosynthetic method of claim 7, wherein said source material is selected from the group consisting of: nonanoic acid; oil of pelargonium; octanoic acid; decanoic acid; vanillin; and, vanillyamine.
9. The biosynthetic method of claim 7, wherein the source material is a mixture of two or more of the following: nonanoic; oil of pelargonium; octanoic acid; decanoic acid; vanillin; and, vanillyamine.
10. The biosynthetic method of claim 1, wherein said transformed cellular system is selected from the group including yeast, non-capsaicinoid producing plants, algae and bacteria.
11. The biosynthetic method of claim 10, wherein said cellular system is E. coli.
12. The biosynthetic method of claim 1, wherein the source material is nonanoic acid.
13. The biosynthetic method of claim 1, wherein the capsaicinoid of interest is capsaicin.
14. The biosynthetic method of claim 1, wherein the capsaicinoid of interest is NV.
15. The biosynthetic method of claim 1, wherein the capsaicinoid of interest is DHCP.
16. The biosynthetic method of claim 1, wherein the capsaicinoids produced are a mixture comprising CP, NV and DHCP.
17. A capsaicinoid of interest produced by a transformed cellular system growing within a medium.
18. The capsaicinoid of interest of claim 17, wherein said transformed cellular system is selected from the group consisting of: yeast, non-capsaicinoid producing plants, algae and bacteria.
19. The capsaicinoid of interest of claim 18, wherein said transformed cellular system is transformed by the presence of an ACS and a CS derived from a plant of the Capsicum genus.
20. The capsaicinoid of interest of claim 17, wherein the method of producing further comprises feeding the transformed cellular system a specific source material.
21. The capsaicinoid of interest of claim 20, wherein said source material is selected from a group consisting of: nonanoic; oil of pelargonium; octanoic acid; decanoic acid; vanillin; and, vanillyamine.
22. The capsaicinoid of interest of claim 20, wherein said source material is selected from a mixture containing two or more of the following: nonanoic; oil of pelargonium; octanoic acid; decanoic acid; vanillin; and, vanillyamine.
23. The capsaicinoid of interest of claim 18, wherein said transformed cellular system is transformed by the presence of an ACS and a CS derived from a plant of the Capsicum genus.
24. The capsaicinoid of interest of claim 18, wherein said ACS transformed into the cellular system is an ACS derived from Arabidopsis based on LCAS4 or LCAS5.
25. The capsaicinoid of interest of claim 17, wherein said capsaicinoid is CP.
26. The capsaicinoid of interest of claim 17, wherein said capsaicinoid is NV.
27. The capsaicinoid of interest of claim 17, wherein said capsaicinoid is DHCP.
28. The capsaicinoid of interest of claim 17, wherein the capsaicinoids produced are a mixture of CP, NV and DHCP.
29. The capsaicinoid of interest of claim 19, wherein said transformed cellular system is transformed by the presence of an ACS and a CS derived from a plant of the Capsicum genus.
30. The capsaicinoid of interest of claim 29, wherein said transformed cellular system is transformed by the presence of an ACS and a CS derived the ghost chili.
31. The biosynthetic method of claim 1, wherein the ACS utilized is an ACS that shares a DNA sequence similarity of at least 75% with SEQ ID NO: 3.
32. The biosynthetic method of claim 1, wherein the ACS utilized is an ACS that shares a protein sequence similarity of at least 90% with SEQ ID NO: 1.
33. The biosynthetic method of claim 1, wherein the CS utilized is an CS that shares a DNA sequence similarity of at least 75% with SEQ ID NO: 4.
34. The biosynthetic method of claim 1, wherein the CS utilized is an CS that shares a protein sequence similarity of at least 90% with SEQ ID NO: 2.
35. The biosynthetic method of any one of claims 1 to 34, wherein the cellular system is selected from the group consisting of bacteria, yeast, plant cells, animal cells, an in vitro translation system and a combination thereof.
36. The capsaicinoid of interest of claim 17, wherein said capsaicinoid is purified capsaicin.
37. The capsaicinoid of interest of claim 36, wherein said capsaicinoid is greater than 70% pure.
38. The capsaicinoid of interest of claim 17, wherein said capsaicinoid content is greater than about 85% by weight on a dry basis.
39. The biosynthetic method of claim 1, wherein step c) comprises: i) purifying crude product; and, ii) removing solvents under vacuum to provide a concentrated capsaicinoid product.
40. The biosynthetic method of claim 39, wherein said crude product is purified by column chromatography.
41. The biosynthetic method of claim 39, wherein said crude product is purified by acid-base extraction.
42. The biosynthetic method of claim 39, wherein said crude product is purified by vacuum distillation.
43. The biosynthetic method of claim 39, wherein said crude product is purified by semi-preparative HPLC.
44. A method of producing a capsaicinoid of interest comprising feeding a transformed microbe culture a specific fatty acid precursor.
45. The method of claim 44, wherein the capsaicinoid of interest is Capsaicin and the fatty acid precursor is 6E-8-methyl-6-nonenoic acid.
46. The method of claim 44, wherein the capsaicinoid of interest is Dihydrocapsaicin and the fatty acid precursor is 8-Methyl nonanoic acid.
47. The method of claim 44, wherein the capsaicinoid of interest is Nonivamide and the fatty acid precursor is nonanoic acid.
48. The method of claim 44, wherein the capsaicinoid of interest is N-Vanilly octamide and the fatty acid precursor is octanoic acid.
49. The method of claim 44, wherein the capsaicinoid of interest is N-vanilyl decanamide and the fatty acid precursor is decanoic acid.
50. The method of claim 44, wherein the transformed culture is a microbe culture of yeast or bacteria.
51. The biosynthetic method of claim 10, wherein the cellular system further comprises an aminotransferase which is capable of catalyzing the conversion of vanillin to vanillylamine.
52. The biosynthetic method of claim 7, wherein said source material is selected from the group consisting of: C6 to C12 hydrocarbons that are medium to long chain fatty acids.
53. The biosynthetic method of claim 7, wherein the source material is a mixture of two or more C6 to C12 hydrocarbons that are medium to long chain fatty acids.
54. The biosynthetic method of claim 1, wherein the capsaicinoid of interest is nordihydrocapsaicin.
55. The biosynthetic method of claim 1, wherein said transformed cellular system includes a CaUGT2 from C. roseus.
56. The biosynthetic method of any one of claims 1 to 16, 31 to 35, and 51-55 wherein said transformed cellular system includes a CaUGT2 that shares a DNA sequence similarity of at least 75% with SEQ ID NO: 5.
57. The method of any one of claims 1 to 16, 31 to 35, and 51-55 wherein said transformed cellular system includes a CaUGT2 that shares a protein sequence similarity of at least 90% with SEQ ID NO: 6.
58. The method of claim 44, wherein the microbe culture expresses an ACS that shares a DNA sequence similarity of at least 75% with SEQ ID NO: 3.
59. The method of claim 44, wherein the microbe culture expresses an ACS that shares a protein sequence similarity of at least 90% with SEQ ID NO: 1.
60. The method of claim 44, wherein the microbe culture expresses a CS that shares a DNA sequence similarity of at least 75% with SEQ ID NO: 4.
61. The method of claim 44, wherein the microbe culture expresses a CS that shares a protein sequence similarity of at least 90% with SEQ ID NO: 2.
62. The method of any one of claims 44 and 58-61, wherein the microbe culture expresses a CaUGT2 that shares a DNA sequence similarity of at least 75% with SEQ ID NO: 5.
63. The biosynthetic method of claim 44, wherein said microbe culture expresses a CaUGT2 that shares a protein sequence similarity of at least 90% with SEQ ID NO: 6.
64. An analgesic composition for the topical treatment of pain in which said composition contains an effective amount of a capsaicinoid(s), wherein said analgesic composition is produced by the method of any one of claims 1-16, 31-35, and 39-63 wherein the improvement comprises producing said capsaicinoid in a microbial cellular system.
65. The analgesic composition of claim 64, where said effective amount is at least 0.0125 percent of a capsaicinoid of interest.
66. A flavor and fragrance composition, wherein the flavor and fragrance composition has at least one capsaicinoid produced according to the method of any one of claims 1-16, 31-35, and 39-63.
67. The flavor and fragrance composition according to claim 66, wherein the capsaicinoid is selected from the group comprising: nonivamide, N-vanillylnonanamides, N-vanillylsulfonamides, N-vanillylureas, N-vanillylcarbamates, N[(substituted phenyl)methyl]alkylamides, methylene substituted N[(substituted phenyl)methyl]alkanamides, N[(substituted phenyl)methyl]-cis-monosaturated alkenamides, N[(substituted phenyl)methyl]diunsaturated amides, 3-hydroxyacetanilide, hydroxyphenylacetamides, pseudocapsaicin, dihydrocapsaicin, nordihydrocapsaicin, homocapsaicin, homodihydrocapsaicin I, anandamide, piperine, zingerone, warburganal, polygodial, aframodial, cinnamodial, cinnamosmolide, cinnamolide, civamde, nonivamide, olvanil, N-oleyl-homovanillamidia, isovelleral, scalaradial, ancistrodial, and any combinations or mixtures thereof.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
DESCRIPTION OF THE PREFERRED EMBODIMENT
[0055] The following abbreviations have designated meanings in the specification:
Explanation of Terms Used Herein:
[0056] Capsaicin or CE is a colorless irritant phenolic amide C.sub.18H.sub.27NO.sub.3 and is one of a series of phenolic amides found in various Capsicum species and hybrids thereof that gives hot peppers their hotness or pungency and that is used for food, medicine, and security applications. Pure CP is a volatile, hydrophobic, colorless, odorless, crystalline to waxy compound. [0057] Capsaicinoid as used herein this refers to a class of irritant compounds, related to Capsaicin, that are responsible for the heat of chili peppers. They are irritants for mammals, including humans, and can produce a sensation of burning in any tissue with which they come into contact. The capsaicinoids are produced as secondary metabolites by chili peppers, probably as deterrents against certain mammals and fungi. Exemplary capsaicinoids include, but are not limited to: nonivamide, N-vanillylnonanamides, N-vanillylsulfonamides, N-vanillylureas, N-vanillylcarbamates, N[(substituted phenyl)methyl]alkylamides, methylene substituted N[(substituted phenyl)methyl]alkanamides, N[(substituted phenyl)methyl]-cis-monosaturated alkenamides, N[(substituted phenyl)methyl]diunsaturated amides, 3-hydroxyacetanilide, hydroxyphenylacetamides, pseudocapsaicin, dihydrocapsaicin, nordihydrocapsaicin, homocapsaicin, homodihydrocapsaicin I, anandamide, piperine, zingerone, warburganal, polygodial, aframodial, cinnamodial, cinnamosmolide, cinnamolide, civamde, nonivamide, olvanil, N-oleyl-homovanillamidia, isovelleral, scalaradial, ancistrodial, and any combinations or mixtures thereof. Certain capsaicinoids are further described in Table 2. [0058] Cellular system is any cells that provide for the expression of ectopic proteins. It includes bacteria, yeast, plant cells and animal cells. It includes both prokaryotic and eukaryotic cells. It also includes the in vitro expression of proteins based on cellular components, such as ribosomes. [0059] Fatty Acids, C6-C12. According to the current invention a variety of fatty acids can be used as starting source materials. The source materials include vanillin, vanillylamine or their derivatives with modifications at the aromatic ring such as methylation, ethylation, or glycosylation; and more particularly 6-12 carbon straight chain or branched chain fatty acids or their derivatives such as hydroxy fatty acids (Ex: Hexanoic acid; Heptanoic acid; Octanoic acid; Nonanoic acid; Decanoic acid; Undecanoic acid; and, Dodecanoic acid) can be straight chain fatty acids or branched chain fatty acids and be used to make the capsaicinoids of the current invention. [0060] Growing the Cellular System. Growing includes providing an appropriate medium that would allow cells to multiply and divide. It also includes providing resources so that cells or cellular components can translate and make recombinant proteins. [0061] Protein Expression. Protein production can occur after gene expression. It consists of the stages after DNA has been transcribed to messenger RNA (mRNA). The mRNA is then translated into polypeptide chains, which are ultimately folded into proteins. DNA may be present in the cells through transfection—a process of deliberately introducing nucleic acids into cells. The term is often used for non-viral methods in eukaryotic cells. It may also refer to other methods and cell types, although other terms are preferred: “transformation” is more often used to describe non-viral DNA transfer in bacteria, non-animal eukaryotic cells, including plant cells. In animal cells, transfection is the preferred term as transformation is also used to refer to progression to a cancerous state (carcinogenesis) in these cells. Transduction is often used to describe virus-mediated DNA transfer. Transformation, transduction, and viral infection are included under the definition of transfection for this application. [0062] Yeast. According to the current invention yeast as claimed herein are eukaryotic, single-celled microorganisms classified as members of the fungus kingdom. Yeast are unicellular organisms which evolved from multicellular ancestors but with some species useful for the current invention being those that have the ability to develop multicellular characteristics by forming strings of connected budding cells known as pseudohyphae or false hyphae.
[0063] Acronyms: [0064] Pal, phenylalanine ammonia lyase; [0065] Ca4H, cinnamic acid 4-hydroxylase; [0066] 4CL, 4-coumarate CoA ligase; [0067] HCT, hydroxycinnamoyl transferase; [0068] C3H, coumaroyl shikimate/quinate 3-hydroxylase; [0069] COMT, caffeic acid O-methyltransferase; pAMT, aminotransferase; [0070] BCAT, branched-chain amino acid transferase; [0071] Kas, 3-keto-acyl ACP synthase; [0072] ACL, acyl carrier protein; [0073] FatA,acyl-ACP thioesterase; [0074] ACS, acyl-CoA synthetase; and, [0075] CS, capsaicin synthase.
DETAILED DESCRIPTION
[0076] The present invention relates, in some embodiments, to a system for an improved production method of CP, DHCP and NV as developed from specific feeding precursors.
[0077] Nonivamide, also called pelargonic acid vanillylamide or PAVA (here “NV”), is one of trace capsaicinoids identified in hot peppers (FIG. 2; Constant et al., 1996). It is used as a food additive for pungent flavors. It is also used the pharmaceutical industry as an alternative to capsaicin. However, due to the extremely low content of nonivamide in hot peppers, using current plant extraction methods is not commercially viable so it has been exclusively made by chemical synthesis. Although chemically-synthesized nonivamide is readily available and cheap, non-natural compounds are not well perceived by consumers whose demand is in favor of natural products. To be natural, the chemicals have to be derived from the extraction of natural materials or to be transformed by enzymes or microbes from natural precursors, as provided in the methods of the current invention.
[0078] One aspect of the present invention are the DNA and corresponding protein sequences of the ACS and CS of the current invention. The DNA sequences for the ACS and CS enzymes were identified and removed from a ghost chili hybrid and inserted into plasmids for use in the current invention. Such sequences are provided herein as SEQ ID NO: 3 and SEQ ID NO: 4, respectively.
[0079] The present invention includes nucleic acid molecules and uses thereof in methods described herein, the nucleic acid molecules having nucleic acid sequences that hybridize to SEQ ID NO: 1 and SEQ ID NO: 2, respectively, or any complements thereof, or any cis elements thereof. The present invention also provides nucleic acid molecules and uses thereof in methods described herein, the nucleic acid molecules comprising a nucleic acid sequence selected from the group consisting of SEQ ID NO: 3 through SEQ ID NO: 4 for the ACS and CS sequences of the invention, any complements thereof, or any cis elements thereof, or any fragments thereof. (See Table 1, SEQ ID NOs: 3 and 4).
[0080] Additional embodiments include the use of ACS1 to modify the levels of capsaicinoids in pepper plants by overexpressing ACS1 utilizing standard known techniques for overexpression of genes in transformed plants. Another embodiment includes the use of ACS 1 to modulate the levels of capsaicinoids in pepper plants by knocking out or knocking down ACS1 utilizing standard known techniques for knocking out or knocking down expression of genes. Again, the overexpression or the knock out/knock down is by standard molecular cellular strategies and techniques known by a person of ordinary skill in the art. Another embodiment includes the use of ACS1 to generate acyl-CoAs and their downstream metabolites including fatty acids involving the expression or overexpression of ACS1. Another variation is the use of ACS1 to modulate the levels of acyl-CoAs and their downstream metabolites including fatty acids comprising knocking out or knocking down ACS1. Different specific capsaicinoids produced are determined by different fatty acids fed into the culture. (See Table 3).
[0081] The acyl CoAs that are made by the methods hereof could be utilized to make capsaicinoids of interest, and they would generally be of the medium chain variety. Again, although ACS1 can mediate the conversion of both medium chain- and long chain-carboxylic acids to acyl-CoAs, the medium chain activity is far more important than long chain activity as medium chain activity is the essential component in today's biofuel industry. The other importance as mentioned above for ACS1 is that it can be used to modify the capsaicinoid levels in plants through transgenic technology. However, ACS1 is not precluded from usage in regards to long chain acyl-CoAs. In an embodiment, a cellular system, such as a bacterial based system or a yeast based system can be modified to express ACS. The ACS could be ACS1 cloned from ghost pepper. Other ACSs suitable are one based on LCAS4 and LCAS5 from Arabidopsis. Other known ACS1 and ACS2 could also be expressed in the cellular systems. Appropriate substrate, such as 8-methyl-trans-6-nonenoic acid and 8-methylnonanoic acid, can then be fed to the cellular system. The substrates could also be expressed as part of a biosynthetic pathway within the cellular system. The cellular system is then incubated allowing for the biosynthetic production of 8-methyl-trans-6-nonenoyl-CoA or 8-methyl nonanoyl-CoA.
[0082] According to another embodiment of the current invention the efficiency of heterologous protein production in a microbial system can be enhanced by codon changes that alter the DNA sequences to one that may be preferred by the cellular system being used for expression but that varies from the original gene source organism without changing the eventual polypeptide produced. Approaches normally used to overcome this problem include targeted mutagenesis to remove rare codons or the addition of rare codon tRNAs in specific cell lines to move towards a codon sequence preferred by a host organism that will produce the polypeptide of interest. Recently, improvements in such “codon optimization” technology have enabled cost-effective production of synthetic genes, making this a feasible alternative and potentially useful for the current invention.
[0083] Identity and Similarity
[0084] Identity is the fraction of amino acids that are the same between a pair of sequences after an alignment of the sequences (which can be done using only sequence information or structural information or some other information, but usually it is based on sequence information alone), and similarity is the score assigned based on an alignment using some similarity matrix. The similarity index can be any one of the following BLOSUM62, PAM250, or GONNET, or any matrix used by one skilled in the art for the sequence alignment of proteins.
[0085] Identity is the degree of correspondence between two sub-sequences (no gaps between the sequences). An identity of 25% or higher implies similarity of function, while 18-25% implies similarity of structure or function. Keep in mind that two completely unrelated or random sequences (that are greater than 100 residues) can have higher than 20% identity. Similarity is the degree of resemblance between two sequences when they are compared. This is dependent on their identity.
Determination of Sequence Similarity Using Hybridization Techniques
[0086] Nucleic acid hybridization is a technique well known to those of skill in the art of DNA manipulation. The hybridization properties of a given pair of nucleic acids are an indication of their similarity or identity.
[0087] The term “hybridization” refers generally to the ability of nucleic acid molecules to join via complementary base strand pairing. Such hybridization may occur when nucleic acid molecules are contacted under appropriate conditions. “Specifically hybridizes” refers to the ability of two nucleic acid molecules to form an anti-parallel, double-stranded nucleic acid structure. A nucleic acid molecule is said to be the “complement” of another nucleic acid molecule if they exhibit “complete complementarity,” i.e., each nucleotide in one sequence is complementary to its base pairing partner nucleotide in another sequence. Two molecules are said to be “minimally complementary” if they can hybridize to one another with sufficient stability to permit them to remain annealed to one another under at least conventional “low-stringency” conditions. Similarly, the molecules are said to be “complementary” if they can hybridize to one another with sufficient stability to permit them to remain annealed to one another under conventional “high-stringency” conditions. Nucleic acid molecules that hybridize to other nucleic acid molecules, e.g., at least under low stringency conditions are said to be “hybridizable cognates” of the other nucleic acid molecules. Conventional low stringency and high stringency conditions are described herein and by Sambrook et al., MOLECULAR CLONING, A LABORATORY MANUAL, 2nd Ed., Cold Spring Harbor Press, Cold Spring Harbor, N.Y. (1989) and by Haymes et al., NUCLEIC ACID HYBRIDIZATION, A PRACTICAL APPROACH, IRL Press, Washington, DC (1985). Departures from complete complementarity are permissible, as long as such departures do not completely preclude the capacity of the molecules to form a double-stranded structure.
[0088] Low stringency conditions may be used to select nucleic acid sequences with lower sequence identities to a target nucleic acid sequence. One may wish to employ conditions such as about 0.15 M to about 0.9 M sodium chloride, at temperatures ranging from about 20° C. to about 55° C. High stringency conditions may be used to select for nucleic acid sequences with higher degrees of identity to the disclosed nucleic acid sequences (Sambrook et al., 1989). High stringency conditions typically involve nucleic acid hybridization in about 2× to about 10×SSC (diluted from a 20×SSC stock solution containing 3 M sodium chloride and 0.3 M sodium citrate, pH 7.0 in distilled water), about 2.5× to about 5×Denhardt's solution (diluted from a 50× stock solution containing 1% (w/v) bovine serum albumin, 1% (w/v) ficoll, and 1% (w/v) polyvinylpyrrolidone in distilled water), about 10 mg/mL to about 100 mg/mL fish sperm DNA, and about 0.02% (w/v) to about 0.1% (w/v) SDS, with an incubation at about 50° C. to about 70° C. for several hours to overnight. High stringency conditions are preferably provided by 6×SSC, 5×Denhardt's solution, 100 mg/mL fish sperm DNA, and 0.1% (w/v) SDS, with an incubation at 55° C. for several hours. Hybridization is generally followed by several wash steps. The wash compositions generally comprise 0.5× to about 10×SSC, and 0.01% (w/v) to about 0.5% (w/v) SDS with a 15 minute incubation at about 20° C. to about 70° C. Preferably, the nucleic acid segments remain hybridized after washing at least one time in 0.1×SSC at 65° C.
[0089] A nucleic acid molecule preferably comprises a nucleic acid sequence that hybridizes, under low or high stringency conditions, with SEQ ID NO: 3 and SEQ ID NO: 4, any complements thereof, or any fragments thereof, or any cis elements thereof. A nucleic acid molecule most preferably comprises a nucleic acid sequence that hybridizes under high stringency conditions with SEQ ID NO: 3 and SEQ ID NO: 4, any complements thereof, or any fragments thereof, or any cis elements thereof.
Analysis of Sequence Similarity Using Identity Scoring
[0090] As used herein “sequence identity” refers to the extent to which two optimally aligned polynucleotide or peptide sequences are invariant throughout a window of alignment of components, e.g., nucleotides or amino acids. An “identity fraction” for aligned segments of a test sequence and a reference sequence is the number of identical components which are shared by the two aligned sequences divided by the total number of components in reference sequence segment, i.e., the entire reference sequence or a smaller defined part of the reference sequence.
[0091] As used herein, the term “percent sequence identity” or “percent identity” refers to the percentage of identical nucleotides in a linear polynucleotide sequence of a reference (“query”) polynucleotide molecule (or its complementary strand) as compared to a test (“subject”) polynucleotide molecule (or its complementary strand) when the two sequences are optimally aligned (with appropriate nucleotide insertions, deletions, or gaps totaling less than 20 percent of the reference sequence over the window of comparison). Optimal alignment of sequences for aligning a comparison window are well known to those skilled in the art and may be conducted by tools such as the local homology algorithm of Smith and Waterman, the homology alignment algorithm of Needleman and Wunsch, the search for similarity method of Pearson and Lipman, and preferably by computerized implementations of these algorithms such as GAP, BESTFIT, FASTA, and TFASTA available as part of the GCG® Wisconsin Package® (Accelrys Inc., Burlington, Mass.). An “identity fraction” for aligned segments of a test sequence and a reference sequence is the number of identical components which are shared by the two aligned sequences divided by the total number of components in the reference sequence segment, i.e., the entire reference sequence or a smaller defined part of the reference sequence. Percent sequence identity is represented as the identity fraction multiplied by 100. The comparison of one or more polynucleotide sequences may be to a full-length polynucleotide sequence or a portion thereof, or to a longer polynucleotide sequence. For purposes of this invention “percent identity” may also be determined using BLASTX version 2.0 for translated nucleotide sequences and BLASTN version 2.0 for polynucleotide sequences.
[0092] The percent of sequence identity is preferably determined using the “Best Fit” or “Gap” program of the Sequence Analysis Software Package™ (Version 10; Genetics Computer Group, Inc., Madison, Wis.). “Gap” utilizes the algorithm of Needleman and Wunsch (Needleman and Wunsch, J
[0093] Useful methods for determining sequence identity are also disclosed in the Basic Local Alignment Search Tool (BLAST) programs which are publicly available from National Center Biotechnology Information (NCBI) at the National Library of Medicine, National Institute of Health, Bethesda, Md. 20894; see BLAST Manual, Altschul et al., NCBI, NLM, NIH; Altschul et al., J. MOL. BIOL. 215:403-410 (1990); version 2.0 or higher of BLAST programs allows the introduction of gaps (deletions and insertions) into alignments; for peptide sequence BLASTX can be used to determine sequence identity; and, for polynucleotide sequence BLASTN can be used to determine sequence identity.
[0094] As used herein, the term “substantial percent sequence identity” refers to a percent sequence identity of at least about 70% sequence identity, at least about 80% sequence identity, at least about 85% identity, at least about 90% sequence identity, or even greater sequence identity, such as about 98% or about 99% sequence identity. Thus, one embodiment of the invention is a polynucleotide molecule that has at least about 70% sequence identity, at least about 80% sequence identity, at least about 85% identity, at least about 90% sequence identity, or even greater sequence identity, such as about 98% or about 99% sequence identity with a polynucleotide sequence described herein. Polynucleotide molecules that have the activity of the ACS and CS genes of the current invention are capable of directing the production of a variety of capsaicinoids and have a substantial percent sequence identity to the polynucleotide sequences provided herein and are encompassed within the scope of this invention.
[0095] “Homology” refers to the level of similarity between two or more nucleic acid or amino acid sequences in terms of percent of positional identity (i.e., sequence similarity or identity). Homology also refers to the concept of similar functional properties among different nucleic acids or proteins.
[0096] In an alternative embodiment, the nucleic acid molecule comprises a nucleic acid sequence that exhibits 70% or greater identity, and more preferably at least 80 or greater, 85 or greater, 87 or greater, 88 or greater, 89 or greater, 90 or greater, 91 or greater, 92 or greater, 93 or greater, 94 or greater, 95 or greater, 96 or greater, 97 or greater, 98 or greater, or 99% or greater identity to a nucleic acid molecule selected from the group consisting of SEQ ID NO: 3 and SEQ ID NO: 4, any complements thereof, any fragments thereof, or any cis elements thereof. The nucleic acid molecule preferably comprises a nucleic acid sequence that exhibits a 75% or greater sequence identity with a polynucleotide selected from the group consisting of SEQ ID NO: 3 and SEQ ID NO: 4, any complements thereof, any fragments thereof, or any cis elements thereof. The nucleic acid molecule more preferably comprises a nucleic acid sequence that exhibits an 80% or greater sequence identity with a polynucleotide selected from the group consisting of SEQ ID NO: 3 and SEQ ID NO: 4, any complements thereof, any fragments thereof, or any cis elements thereof. The nucleic acid molecule most preferably comprises a nucleic acid sequence that exhibits an 85% or greater sequence identity with a polynucleotide selected from the group consisting of SEQ ID NO: 3 and SEQ ID NO: 4, any complements thereof, any fragments thereof, or any cis elements thereof.
[0097] For purposes of this invention “percent identity” may also be determined using BLASTX version 2.0 for translated nucleotide sequences and BLASTN version 2.0 for polynucleotide sequences. In a preferred embodiment of the present invention, the presently disclosed corn genomic promoter sequences comprise nucleic acid molecules or fragments having a BLAST score of more than 200, preferably a BLAST score of more than 300, and even more preferably a BLAST score of more than 400 with their respective homologues.
[0098] As is evident from the foregoing description, certain aspects of the present disclosure are not limited by the particular details of the examples illustrated herein, and it is therefore contemplated that other modifications and applications, or equivalents thereof, will occur to those skilled in the art. It is accordingly intended that the claims shall cover all such modifications and applications that do not depart from the spirit and scope of the present disclosure.
[0099] Moreover, unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the disclosure belongs. Although any methods and materials similar to or equivalent to or those described herein can be used in the practice or testing of the present disclosure, the preferred methods and materials are described above.
[0100] Although the foregoing invention has been described in some detail by way of illustration and example for purposes of understanding, it will be apparent to those skilled in the art that certain changes and modifications may be practiced. Therefore, the description and examples should not be construed as limiting the scope of the invention, which is delineated by the appended claims.
[0101] Accordingly, it is to be understood that the embodiments of the invention herein providing for the production of specific capsaicinoids are merely illustrative of the application of the principles of the invention. It will be evident from the foregoing description that changes in the form, methods of use, and applications of the elements of the disclosed production methods and selected microbial strains may be resorted to without departing from the spirit of the invention, or the scope of the appended claims.
Example 1
[0102] mg/L of vanillylamine and 500 mg/L of individual fatty acid were fed into E. coli. culture overexpressing ghost chili ACS1 and CS genes. Production samples were taken one (1) day and two (2) days after the substrate feeding and analyzed by high-performance liquid chromatography (HPLC) (see
[0103] As seen in
[0104] The CP, DHCP and NV capsaicinoids produced herein were synthesized in modified E. coli cultures that were modified to carry the ACS and CS genes from ghost chili peppers. These genes allowed the properly fed selected strains to synthesize the capsaicinoids via the inserted acyltransferase CS that transfers the 8-methylnonenoyl moiety from 8-methylnonenoyl-CoA to vanillylamine to form an amide conjugate. Vanillylamine is formed from the phenylpropanoid pathway whereas the branched-chain fatty acid is derived from a branched-chain amino acid, e.g., valine (Curry, et al., 1999; Mazourek, et al., et al., 2009). The aminotransferase (pAMT) catalyzes the formation of vanillyamine from vanillin (
[0105] In our previous application, we described a process for the production of CP and DHCP in E. coli cultures overexpressing ACS1 and CS genes from ghost chili pepper upon the feeding corresponding substrates (Table 1; Chen et al., 2015). According to the current invention we report the production of NV. According to the current invention the transformed cultures are fed specific fatty acids so that the product produced by such cultures is a single species of capsaicinoid (see Table 3). Of course this is an improvement in efficiency relative to plant based production where a mixture of various capsaicinoids with CP and DHCP are produced and extracted.
[0106] Although nonivamide has been identified as a naturally occurring capsaicinoid in Capsicum species (Constant et al. 1996), the content is so low that no natural nonivamide has been commercially used.
[0107] Inorganic or non-biological processes for the synthesis of capsaicin and analogues thereof have been reported, for example, by Crombie et al., (J. CHEM SOC., 1025-27 (1955)) describes an unambiguous synthesis of capsaicin, N-(4-hydroxy-3-methoxybenzyl)-8-methylnon-trans-6-enamide, the active principle in red pepper. Other organic pathways have been shown in U.S. Pat. No. 4,493,848 issued to LaHann et al., and U.S. Pat. No. 5,094,782 issued to Chen et al.
[0108] Capsaicinoids, have long been used as an experimental tool because of their selective action on the small diameter afferent nerve fibers C-fibers and A-delta fibers that are believed to signal pain. From studies in animals, capsaicinoids appears to trigger C-fiber membrane depolarization by opening cation channels permeable to calcium and sodium. Recently one of the receptors for capsaicinoid effects has been cloned.
[0109] In most chili peppers, vanillylamine is formed from phenylalanine via ferulic acid, vanillin and related compounds, and capsaicinoid is produced from vanillyamine and branched chain fatty acid by capsaicin synthase (
Synthetic Biology
[0110] Genetically engineered microbes have become an increasingly important platform for the production of drugs, chemicals, and biofuels from renewable resources (Du et al., 2011). These biotechnological products, when used in food, can be labeled ‘natural’ in food sector according to current regulations (Häusler and Münch, 1997).
[0111] Exemplary capsaicinoids include, but are not limited to: nonivamide, N-vanillylnonanamides, N-vanillylsulfonamides, N-vanillylureas, N-vanillylcarbamates, N[(substituted phenyl)methyl]alkylamides, methylene substituted N[(substituted phenyl)methyl]alkanamides, N[(substituted phenyl)methyl]-cis-monosaturated alkenamides, N[(substituted phenyl)methyl]diunsaturated amides, 3-hydroxyacetanilide, hydroxyphenylacetamides, pseudocapsaicin, dihydrocapsaicin, nordihydrocapsaicin, homocapsaicin, homodihydrocapsaicin I, anandamide, piperine, zingerone, warburganal, polygodial, aframodial, cinnamodial, cinnamosmolide, cinnamolide, civamde, nonivamide, olvanil, N-oleyl-homovanillamidia, isovelleral, scalaradial, ancistrodial, and any combinations or mixtures thereof.
[0112] Previously, an E. coli fermentation platform was developed where various capsaicinoids could be produced upon the feeding of fatty acids and vanillylamine/vanillin (Chen et al. 2015). As described herein, the production of nonivamide by this system is also possible (
Producing Acyl-CoAs: Cloning
[0113] Applicants amplified ACS1 gene from the cDNA of the green fruits of the ghost chili pepper using the primers of ACS1-sumo-F: CGC GAA CAG ATT GGA GGT GCAACAGATAAATITATTATTG and ACS1-sumo-R: GTG GCG GCC GCT CTA TTA TCACTTGGTACCCTTGTACAT. The resulting PCR product was purified on 1% agarose gel and mixed with linear pETite N-His SUMO Kan expression vector (Lucigen, Middleton, Wis.). The DNA mixture was used to transform Hl-control 10G chemically competent cells by heat shock (Lucigen). The gene insertion was fully sequenced and the encoded amino acid sequence was aligned with that of ACS1. As shown previously (Chen et al., 2015), these two sequences are new due to a replacement mutation in which Ile476 in the known Capsicum sequence is replaced by a valine residue in ghost pepper ACS1 (SEQ ID NO: 1 provided herein). The sequence of ghost pepper ACS1 was used to blast the Arabidopsis database (http://www.arabidopsis.org) and identified LCAS4 and LCAS5 as homologues. As previously shown, these three sequences share a sequence identity of 66% and a sequence similarity of 92%. Both LCAS4 and LCAS5 have been biochemically characterized as long chain acyl-CoA synthetases that participate in fatty acid and glycerolipid metabolism (Shockey et al., 2003). Recently, LCAS4 is demonstrated to be required for the formation of pollen coat lipids in Arabidopsis (Belza and Jessen, 2005).
[0114] Expression
[0115] Applicants used pETite N-His SUMO-ghost pepper ACS1 to transform HI-Control BL21(DE3) cells (Lucigen) and the expression of His-SUMO-ACS1 was induced by 0.5 mM IPTG at 16° C. for 20 hrs. The fusion protein was purified by Ni-NTA column. ACS 1 has a molecular weight of ca. 73.5 Kd and the size of His-SUMO tag is ca. 12 Kd. The His-SUMO-ghost pepper ACS1 fusion protein on SDS-PAGE migrated close to the predicted size.
[0116] Products
[0117] Applicants used an HPLC-based method to measure the activity of ghost pepper ACS1 (Chen et al., 2011). Briefly, reaction mixtures (400 μE) contained 0.1 M Tris-HCl, pH 7.5, 2 mM DTI, 5 mM ATP, 10 mM MgCl2, 0.5 mM CoA, 0.1% Triton and 200 μM carboxylic acids. The reaction was initiated by adding 20 μ{umlaut over (.Math.)} of purified enzyme and stopped after 30 minutes by addition of 20 micromolar acetic acid. HPLC was performed with Dionex-UltiMate© 3000 LC Systems (Thermo Scientific) using an Acclaim® 120 CI 8 reversed-phase column (Thermo Scientific; 3μ, 120 A, 150χ3 mm). The mobile phase consisted of solvent A (0.1% trifluoroacetic acid) and solvent B (acetonitrile). The gradient elution procedure was as follows: 0 to 5 min, 5% of B; 5 to 9 min, a linear gradient from 5 to 80% of B; 9 to 11 min, 80% of B; 11 to 12 min, 5% of B. The flow rate was 0.6 ml/min. The diode array detector collected data in the 200- to 400-nm range. For detection and quantification of substrate and products, peak areas were measured at 257 nm.
[0118] As shown in
[0119] Applicants then used 8-methyl-trans-6-nonenoic acid (6E), the endogenous intermediate in the capsaicinoid biosynthetic pathway or its reduced product, 8-methylnonanoic acid (8M), as a substrate to assay ACS1 activity. As shown in
[0120] Confirmation of Product
[0121] Methanol:Water:Acetonitrile buffer. 10 μE was used for direct infusion using the TriVersa Nanomate® (Advion, Ithaca, N.Y.). The mass spectrometer, LTQ-Orbitrap Velos (Thermo Fisher Scientific, Waltham, Mass.), was operated in negative ionization mode. The MS survey scan was performed in the FT cell from a mass range of 300 to 2,000 m/z. The resolution was set to 60,000@400 m/z. CID fragmentation was used for MS/MS, and detection was done in the ion trap with an isolation window of 1.5 m/z Fragmentation was performed with normalized collision energies of 35%. As shown previously the MS data matched the molecular weight of 8-methyl-trans-6-nonenoyl-CoA and 8-methyl nonanoyl-CoA, respectively.
[0122] The pH optimal of ACS1 against 8-methylnonanoic acid was also studied. Acetate, phosphate, Tris and glycine/NaOH buffers were used to provide a pH range from 4.0 to 10.5. The optical pH of ACS1 is ca. 9.5. Accordingly, applicants have identified a novel medium/long chain acyl-CoA synthetase in ghost hot pepper which provides the substrate for capsaicin synthase. In addition, the novel enzyme may also have applications in biofuel industry for making medium-chain fatty acid derivatives.
[0123] Production of Nordihydrocapsaicin with Addition of CaUGT2 from C. roseus
[0124] According to the current invention a variety of selected capsaicinoids can be produced through the use of selected starting materials. The current invention also provides for the production of specific capsaicinoid compounds through the use of specific enzymes. This process allows applicants to produce specific and desirable capsaicinoids in quantities not previously possible so that the medicinal, food and fragrances uses can be fully determined and modifications can be made to assist in solubilization and dosing.
[0125] According to the current invention, glycosylation of capsaicin and 8-nordihydrocapsaicin by cultured cells of Catharanthus roseus has been reported (Shimoda et al. 2007). However, the gene that is responsible for this specific activity has not been previously identified. Other workers (Kaminaga et al. (2004)) identified two genes encoding UDP-glucosyltransferases, CaUGT1 and CaUGT2 from C. roseus and demonstrated that they catalyzed the formation of curcumin monoglucoside from curcumin and also conversion of curcumin monoglucoside to curcumin diglucoside without mention of capsaicinoid activity. In fact, these authors also tested the activity of CaUGT2 against capsaicin but found it could not glycosylate capsaicin (Kaminage et al., 2004). However, according to the current invention we demonstrated that CaUGT2 can catalyze the formation of capsaicins glucoside both in vitro and in vivo.
[0126] According to the current invention the Catharanthus roseus CaUGT2 gene (GenBank: AB159213.1) was synthesized and codon-optimized for E. coli and cloned into a pDEST17 vector (see Table 5). The resulting pDEST17-CaUGT2 plasmid was used to transform BL21 Star (DE3) competent cells. The transformed culture was first grown at 37° C. in LB(AMP+) medium until OD600=0.4 and then cool down to 16° C. and 1 mM IPTG was added to induce the expression of CaUGT2 protein. Cells were harvested 16 h after induction by centrifugation and soluble protein was extracted by B-PER™ Bacterial Protein Extraction Reagent (Thermo Fisher Scientific) according to the manufacture's instruction and further purified by Ni-NTA affinity chromatography (
[0127] In addition, in vivo biotransformation of capsaicin and nonivamide was performed for the production of capsaicin-glu and nonivamide-glu, respectively using BL21 Star (DE3) culture overexpressing CaUGT2 with a titer of ca. 5 mg/L. Further, the fatty acid chain of 7M-CP is derived from the fatty acid, 7-methyloctanoic acid (7M) or isopelargonic acid. When 7M was fed into this culture system, 7M-CP was produced (
[0128] Production of Capsaicinoids
[0129] As shown in
[0130] HPLC was performed with Dionex-UltiMate® 3000 LC Systems (Thermo Scientific) using an Acclaim® 120 C18 reversed-phase column (Thermo Scientific; 3μ, 120 Å, 150×3 mm). The mobile phase consisted of solvent A (0.1% trifluoroacetic acid) and solvent B (acetonitrile). The gradient elution procedure was as follows: 0 to 5 min, 5% of B; 5 to 9 min, a linear gradient from 5 to 80% of B; 9 to 11 min, 80% of B; 11 to 12 min, 5% of B. The flow rate was 0.6 ml/min. The diode array detector collected data in the 200- to 400-nm range. For detection and quantification of substrate and products, peak areas were measured at 280 nm (
Statement of Industrial Applicability/Technical Field
[0131] This disclosure has applicability in the food, medicinal, and pharmacological industries. This disclosure relates generally to a method for the biosynthetic production of capsaicinoids via a modified microbial strain.
Tables Referenced in the Specification
[0132]
TABLE-US-00001 TABLE 1 Amino acid sequences of ACS1 and CS cloned from ghost chili pepper. ACS1 MATDKFIIEVESAKPAKDGRPSMGPVYRSIFAKHGFPPPIPGLD SCWDIFRMSVEKYPNNRMLGRREIVDGKPGKYVWMSYKEVYDIV IKVGNSIRSIGVDVGDKCGIYGANCPEWIISMEACNAHGLYCVP LYDTLGAGAVEFIISHAEVTIAFVEEKKLPELLKTFPNASKYLK TIVSFGKVTPEQKKELEEFGVVLYSWDEFLQLGSGKQFDLPVKK KEDICTIMYTSGTTGDPKGVLISNTSIVTLIAGVRRFLGSVDES LNVDDVYLSYLPLAHIFDRVIEECFIHHGASIGFWRGDVKLLTE DIGELKPTVFCAVPRVLDRIYSGLQQKIAAGGFLKSTLFNLAYA YKHHNLKKGRKHFEASPLSDKVVFSKVKEGLGGRVRLILSGAAP LAAHVEAFLRVVACCHVLQGYGLTETCAGTFVSLPNRYDMLGTV GPPVPNVDVCLESVPEMSYDALSSTPRGEVCVRGDVLFSGYYKR EDLTKEVMIDGWFHTGDVGEWQPNGSLKIIDRKKNIFKLSQGEY VAVENLENIYGNNPIIDSIWIYGNSFESFLVAVINPNQRAVEQW AEVNGLSGDFASLCEKPEVKEYILRELTKTGKEKKLKGFEFLKA VHLDPVPFDMERDLLTPTFKKKRPQLLKYYKDVIDSMYKGTK CS MAFALPSSLVSVCDKSFIKPSSLTPSKLRFHKLSFIDQSLSNMY IPCAFFYPKVQQRLEDSKNSDELSHIAHLLQTSLSQTLVSYYPY AGKLKDNATVDCNDMGAEFLSVRIKCSMSEILDHPHASLAESIV LPKDLPWANNCEGGNLLVVQVSKFDCGGIAISVCFSHKIGDGCS LLNFLNDWSSVTRDHTTTALVPSPRFVGDSVFSTKKYGSLITPQ ILSDLNECVQKRLIFPTDKLDALRAKVAEESGVKNPTRAEVVSA LLFKCATKASSSMLPSKLVHFLNIRTMIKPRLPRNAIGNLSSIF SIEATNMQDMELPTLVRNLRKEVEVAYKKDQVEQNELILEVVES MREGKLPFENMDGYENVYTCSNLCKYPYYTVDFGWGRPERVCLG NGPSKNAFFLKDYKAGQGVEARVMLHKQQMSEFERNEELLEFIA
In the above protein sequences ACS shall be considered SEQ ID NO 1 and CS shall be considered SEQ ID NO 2.
TABLE-US-00002 TABLE 1 Nucleic Acid sequences of ACS1 and CS cloned from ghost chili pepper. ACS1 ATGGCTACGGACAAATTTATTATTGAAGTTGAATCAGCAAAACCG GCAAAAGATGGTCGCCCGAGCATGGGCCCGGTCTATCGTTCGATC TTTGCGAAACATGGCTTTCCGCCGCCGATCCCGGGTCTGGATTCA TGCTGGGACATTTTTCGTATGTCGGTGGAAAAATATCCGAACAAT CGCATGCTGGGCCGTCGCGAAATTGTTGATGGCAAACCGGGTAAA TACGTTTGGATGAGCTACAAAGAAGTCTACGACATCGTTATCAAA GTCGGTAACAGTATTCGTTCCATCGGCGTGGATGTTGGTGACAAA TGCGGCATTTATGGTGCAAACTGTCCGGAATGGATTATCAGCATG GAAGCATGCAATGCTCATGGCCTGTATTGTGTCCCGCTGTACGAT ACCCTGGGCGCAGGTGCTGTGGAATTTATTATCTCTCACGCGGAA GTGACCATCGCCTTCGTTGAAGAGAAAAAACTGCCGGAACTGCTG AAAACCTTTCCGAATGCGAGCAAATATCTGAAAACCATTGTCTCT TTCGGCAAAGTGACGCCGGAACAGAAGAAAGAACTGGAAGAATTT GGTGTGGTTCTGTACAGTTGGGATGAATTTCTGCAGCTGGGCTCC GGTAAACAATTCGATCTGCCGGTGAAAAAGAAAGAAGATATTTGC ACCATCATGTATACGAGCGGCACCACGGGTGATCCGAAAGGTGTG CTGATTTCAAACACCTCGATTGTGACGCTGATCGCCGGTGTTCGT CGCTTTCTGGGCTCAGTTGATGAATCGCTGAATGTGGATGACGTT TATCTGTCATACCTGCCGCTGGCACATATTTTTGACCGTGTGATC GAAGAATGCTTCATTCATCACGGCGCTTCGATCGGTTTTTGGCGC GGCGATGTGAAACTGCTGACCGAAGACATTGGCGAACTGAAACCG ACGGTTTTCTGTGCGGTCCCGCGTGTGCTGGATCGCATCTATTCA GGTCTGCAGCAAAAAATTGCGGCCGGCGGTTTTCTGAAATCGACC CTGTTCAACCTGGCGTATGCCTACAAACATCACAATCTGAAGAAA GGCCGCAAACACTTTGAAGCCAGCCCGCTGTCTGATAAAGTCGTG TTCAGTAAAGTGAAAGAAGGCCTGGGCGGTCGTGTTCGCCTGATT CTGTCCGGTGCGGCTCCGCTGGCCGCACATGTGGAAGCGTTTCTG CGTGTTGTCGCCTGCTGTCACGTTCTGCAGGGCTATGGTCTGACC GAAACGTGCGCAGGCACCTTCGTGAGTCTGCCGAACCGCTACGAT ATGCTGGGCACGGTTGGTCCGCCGGTCCCGAATGTCGATGTGTGC CTGGAAAGCGTGCCGGAAATGTCTTATGACGCTCTGAGCTCTACC CCGCGTGGTGAAGTTTGTGTCCGCGGCGATGTTCTGTTTTCCGGT TATTACAAACGTGAAGACCTGACCAAAGAAGTTATGATTGATGGC TGGTTCCATACGGGCGACGTCGGTGAATGGCAGCCGAACGGTAGC CTGAAAATCATCGATCGTAAGAAAAACATCTTCAAACTGTCTCAA GGCGAATATGTGGCCGTTGAAAACCTGGAAAATATTTACGGCAAC AATCCGATTATCGACAGCATTTGGATCTATGGTAACAGTTTTGAA TCCTTCCTGGTCGCGGTGATCAACCCGAATCAGCGTGCAGTCGAA CAATGGGCTGAAGTGAATGGCCTGAGTGGTGATTTCGCCTCCCTG TGTGAAAAACCGGAAGTGAAAGAATACATTCTGCGCGAACTGACC AAAACGGGCAAAGAGAAAAAACTGAAAGGTTTCGAATTTCTGAAA GCAGTTCATCTGGACCCGGTGCCGTTTGATATGGAACGTGACCTG CTGACCCCGACGTTCAAGAAAAAACGTCCGCAACTGCTGAAATAC TATAAAGATGTGATCGACTCAATGTATAAAGGCACGAAATAA CS ATGGCGTTCGCACTGCCGTCGAGTCTGGTCTCTGTGTGTGATAAA TCCTTCATCAAGCCGAGTTCGCTGACCCCGAGCAAACTGCGTTTT CATAAACTGAGCTTCATTGATCAGTCTCTGAGTAATATGTATATC CCGTGCGCCTTTTTCTACCCGAAAGTGCAGCAACGTCTGGAAGAT TCTAAGAACAGTGACGAACTGTCTCATATTGCACACCTGCTGCAG ACGTCCCTGTCACAAACGCTGGTTAGCTATTACCCGTATGCTGGC AAACTGAAGGATAACGCGACCGTGGATTGCAATGACATGGGTGCC GAATTTCTGAGCGTTCGCATTAAATGTTCGATGAGCGAAATCCTG GATCATCCGCACGCGTCGCTGGCCGAAAGCATTGTGCTGCCGAAA GACCTGCCGTGGGCTAACAATTGCGAAGGCGGTAACCTGCTGGTT GTGCAGGTCTCGAAGTTTGATTGCGGCGGTATTGCGATCTCTGTG TGTTTCAGTCATAAAATCGGCGACGGTTGTAGCCTGCTGAACTTT CTGAATGATTGGAGCTCTGTCACCCGTGACCACACCACGACCGCC CTGGTGCCGTCTCCGCGTTTTGTCGGTGATTCCGTGTTCTCAACC AAAAAGTATGGTTCCCTGATTACGCCGCAAATCCTGTCAGACCTG AATGAATGCGTGCAAAAACGTCTGATCTTCCCGACCGATAAACTG GACGCACTGCGCGCTAAGGTGGCGGAAGAATCGGGCGTTAAAAAC CCGACCCGTGCTGAAGTCGTGAGCGCGCTGCTGTTTAAATGTGCC ACGAAGGCAAGTTCCTCAATGCTGCCGTCCAAGCTGGTTCATTTC CTGAATATTCGCACCATGATCAAACCGCGTCTGCCGCGCAACGCC ATTGGTAATCTGTCGAGCATTTTTAGCATCGAAGCAACCAATATG CAGGATATGGAACTGCCGACGCTGGTTCGTAACCTGCGCAAAGAA GTGGAAGTTGCGTACAAAAAGGATCAGGTCGAACAAAACGAACTG ATCCTGGAAGTTGTCGAATCCATGCGTGAAGGCAAACTGCCGTTT GAAAACATGGATGGTTATGAAAATGTGTACACCTGCTCAAACCTG TGTAAATATCCGTATTACACGGTTGACTTCGGCTGGGGTCGTCCG GAACGCGTCTGTCTGGGCAACGGTCCGTCTAAGAACGCGTTTTTC CTGAAGGATTACAAGGCCGGCCAGGGTGTTGAAGCACGTGTCATG CTGCACAAACAGCAAATGAGTGAATTTGAACGCAACGAAGAACTG CTGGAATTTATTGCATAA
In the above nucleic acid sequences ACS shall be considered SEQ ID NO: 3 and CS shall be considered SEQ ID NO: 4.
TABLE-US-00003 TABLE 2 Typical relative Scoville Capsaicinoid Name Abbrev. amount heat units Chemical structure Capsaicin C 69% 16,000,000
TABLE-US-00004 TABLE 3 Feeding Schedule for the Production of Specific Capsaicinoids Fatty Acid Fed Into the Microbial Culture Specific Capsaicinoid Produced 6E-8-methyl-6-nonenoic acid Capsaicin (CP) 8-Methyl nonanoic acid Dihydrocapsaicin (DHCP) Pelargonic Acid (nonanoic acid) Nonivamide (NV) Capyrlic Acid (octanoic acid) N-Vanilly octamide Capric Acid (decanoic acid) N-vanilyl decanamide
TABLE-US-00005 TABLE 4 .sup.13C Isotope Analysis of Capsaicinoid Samples δ.sup.13C Sample ‰ CP −30.1 DHCP −28.0 NV −28.8 NV standard −30.2 Natural CP −31.5 In Planta capsacinoid* mixture −31.9 *taken from a Chinese fern used in experimentation
TABLE-US-00006 TABLE 5 Sequence of codon-optimized CaUGT2 CaUGT2 ATGGTTAATCAATTACACATCTTCAATTTCCCGTTTATGGCGC DNA AGGGTCACATGTTACCGGCGTTGGATATGGCGAATCTGTTCAC TTCAAGAGGCGTAAAAGTTACACTGATTACCACTCATCAACAC GTGCCAATGTTTACGAAGAGCATCGAACGCTCGCGTAATTCTG GTTTCGATATCTCAATCCAAAGCATTAAATTCCCGGCGAGCGA AGTAGGCTTACCTGAAGGTATCGAATCATTGGATCAGGTTAGC GGCGATGACGAAATGCTGCCGAAATTCATGCGCGGTGTTAACC TGTTACAACAGCCATTAGAACAATTGCTGCAAGAATCACGTCC GCATTGTTTATTGAGCGATATGTTTTTCCCTTGGACAACGGAA AGTGCTGCAAAATTCGGCATTCCGCGCCTGTTATTTCACGGTT CTTGCTCATTCGCTCTGTCGGCCGCGGAATCTGTGCGTAGAAA TAAGCCTTTTGAAAACGTCTCCACCGATACTGAAGAATTTGTT GTGCCAGACTTGCCGCATCAAATTAAACTGACAAGAACGCAGA TCAGTACCTATGAACGCGAAAACATCGAATCCGATTTCACTAA GATGCTGAAGAAAGTTCGTGACAGCGAAAGTACATCCTACGGT GTCGTAGTTAATTCTTTCTACGAATTAGAACCAGATTACGCAG ACTATTACATTAACGTTTTGGGCCGTAAAGCCTGGCATATCGG TCCGTTTTTGCTGTGTAACAAACTGCAAGCAGAAGATAAGGCC CAGAGAGGTAAAAAGTCAGCAATTGATGCCGACGAATGTCTGA ATTGGTTAGACAGTAAACAACCTAACTCCGTGATCTATTTGTG CTTTGGCTCGATGGCGAATCTGAACTCTGCTCAATTGCACGAA ATTGCTACTGCACTGGAATCTTCAGGCCAGAATTTCATCTGGG TGGTCAGAAAATGCGTCGATGAAGAAAACAGCAGTAAGTGGTT TCCTGAAGGTTTCGAAGAACGCACCAAAGAAAAGGGCCTGATT ATCAAAGGTTGGGCACCACAGACTTTAATTTTGGAACATGAAT CGGTGGGCGCCTTTGTCACACACTGTGGTTGGAACTCTACGTT GGAAGGCATCTGCGCGGGTGTACCTCTGGTTACATGGCCATTT TTCGCTGAACAATTTTTCAACGAAAAACTGATCACCGAAGTAT TAAAGACTGGTTACGGCGTTGGTGCCCGTCAGTGGAGTAGAGT GTCCACGGAAATTATCAAAGGCGAAGCCATTGCGAATGCTATC AACCGCGTGATGGTCGGCGATGAAGCAGTCGAAATGAGAAATC GCGCCAAAGACCTGAAAGAAAAGGCGCGTAAGGCTTTAGAAGA AGATGGCTCCTCGTATAGAGACTTGACCGCGCTGATTGAAGAA CTGGGTGCTTACCGCTCTCAGGTGGAACGTAAACAACAGGATT AA CaUGT2 MVNQLHIFNFPFMAQGHMLPALDMANLFTSRGVKVTLITTHQH Amino VPMFTKSIERSRNSGFDISIQSIKFPASEVGLPEGIESLDQVS acid GDDEMLPKFMRGVNLLQQPLEQLLQESRPHCLLSDMFFPWTTE SAAKFGIPRLLFHGSCSFALSAAESVRRNKPFENVSTDTEEFV VPDLPHQIKLTRTQISTYERENIESDFTKMLKKVRDSESTSYG VVVNSFYELEPDYADYYINVLGRKAWHIGPFLLCNKLQAEDKA QRGKKSAIDADECLNWLDSKQPNSVIYLCFGSMANLNSAQLHE IATALESSGQNFIWVVRKCVDEENSSKWFPEGFEERTKEKGLI IKGWAPQTLILEHESVGAFVTHCGWNSTLEGICAGVPLVTWPF FAEQFFNEKLITEVLKTGYGVGARQWSRVSTEIIKGEAIANAI NRVMVGDEAVEMRNRAKDLKEKARKALEEDGSSYRDLTALIEE LGAYRSQVERKQQD
LITERATURE CITED AND INCORPORATED BY REFERENCE
[0133] 1. Aza-Gonzalez C. et al., (2011), Molecular biology of capsaicinoid biosynthesis in chili pepper (Capsicum spp.). P
PATENTS CITED AND INCORPORATED BY REFERENCE
[0165] 1. Chen H. et al., (2015) Methods of using capsaicin synthase for the microbial production of capsaicinoids. PCT/US2015/011729. [0166] 2. Chen et al., U.S. Pat. No. 5,094,782. [0167] 3. LaHann et al., U.S. Pat. No. 4,493,848. [0168] 4. Zhou R., and Yu X., (2014) Methods of making vanillin via the microbial fermentation of ferulic acid from eugenol using a plant dehydrogenase. PCT/US2014/063952.