Methods and compositions for treating celiac disease
11795213 · 2023-10-24
Assignee
Inventors
- Detlef Schuppan (Mainz, DE)
- Yvonne Junker (Kiel, DE)
- Towia Aron Libermann (Chestnut Hill, MA, US)
- Simon T. Dillon (Danvers, MA, US)
Cpc classification
C07K2317/76
CHEMISTRY; METALLURGY
C12N15/8218
CHEMISTRY; METALLURGY
International classification
Abstract
The invention features the treatment of gastrointestinal disorders associated with an innate immune response triggered by alpha amylase inhibitor CM3, alpha amylase inhibitor 0.19 (0.19), CM1, CM2, CMa, CMd, CM 16, CMb, CMX1/CMX3, CMX2, and/or alpha amylase inhibitor 0.53 (0.53). To this end, the invention features pharmaceutical compositions including neutralizing antibodies to CM3, 0.19, CM1, CM2, CMa, CMd, CM16, CMb, CMX1/CMX3, CMX2, and/or 0.53, food products containing reduced levels of CM3, 0.19, CM1, CM2, CMa, CMd, CM1 6, CMb, CMX1/CMX3, CMX2, and/or 0.53 protein, the use of oral TLR4 inhibitors to block the effect of said alpha-amylase inhibitors, assays for identifying CM3, 0.19, CM1, CM2, CMa, CMd, CM16, CMb, CMX1/CMX3, CMX2, and/or 0.53 content in food products, and assays for diagnosing subjects with a disorder related to CM3, 0.19, CM1, CM2, CMa, CMd, CM 16, CMb, CMX1/CMX3, CMX2, and/or 0.53 triggered innate immune responses.
Claims
1. A method of making a food product comprising: a) obtaining a cereal selected from the group consisting of wheat and barley, b) reducing a level of proteins CM3 and 0.19 in the cereal by greater than 80% relative to the level of CM3 and 0.19 in a naturally occurring form of the cereal, wherein the CM3 and 0.19 in the cereal have the amino acid sequence of SEQ ID NO: 1 and 2, respectively, or variants thereof with up to 90% sequence identity thereto, and c) determining the cereal of step b) as having a reduced inflammatory activity relative to the naturally occurring form of the cereal by detecting reduced IL-8 secretion in a Toll-like Receptor 4 (TLR4) activation assay, and d) producing the food product from the cereal of step b).
2. The method of claim 1, wherein the level of CM3 and 0.19 is reduced at least 90% relative to the level of CM3 and 0.19 in the naturally occurring form of the cereal.
3. The method of claim 2, wherein the level of CM3 and 0.19 is reduced at least 95% relative to the level of CM3 and 0.19 in the naturally occurring form of the cereal.
4. The method of claim 3, wherein the level of CM3 and 0.19 is reduced at least 99% relative to the level of CM3 and 0.19 in the naturally occurring form of the cereal.
5. The method of claim 1, wherein the CM3 and 0.19 have the amino acid sequence of SEQ ID NO: 1 and 2, respectively.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
DETAILED DESCRIPTION OF THE INVENTION
(32) In general, the invention features the treatment of gastrointestinal disorders associated with an innate immune response triggered by alpha amylase inhibitor CM3, alpha amylase inhibitor 0.19 (0.19), CM1, CM2, CMa, CMd, CM16, CMb, CMX1/CMX3, CMX2, alpha Amylase Inhibitor 0.53 (0.53) (collectively termed AAI), and other structurally and functionally related molecules. To this end, the invention provides pharmaceutical compositions including neutralizing antibodies to alpha amylase inhibitor CM3, alpha amylase inhibitor 0.19 (0.19), CM1, CM2, CMa, CMd, CM16, CMb, CMX1/CMX3, CMX2, alpha Amylase Inhibitor 0.53 (0.53), and other structurally and functionally related molecules, food products containing reduced levels of AAI proteins, assays for identifying AAI protein content in food products, and assays for diagnosing subjects with a disorder related to AAI-triggered innate immune responses. The invention also features methods of treating gastrointestinal disorders associated with an innate immune response to these molecules with preferably, but not exclusively orally active TLR4 inhibitors.
(33) CM3
(34) We discovered that CM3 and/or 0.19 (among other AAIs) contributes to the activation of innate immunity in patients with celiac disease. An exemplary wheat CM3 protein has the sequence of
(35) TABLE-US-00002 (SEQ ID NO: 1) MACKSSCSLLLLAAVLLSVLAAASASGSCVPGVAFRTNLLPHCRDYVL QQTCGTFTPGSLPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEA LRYFIALPVPSQPVDPRSGNVGESGLIDLPGCPREMQWDFVRLLVAPGQ CNLATIHNVRYCPAVEQPLWIDYKDDDDK.
An exemplary wheat 0.19 protein has the sequence of:
(36) TABLE-US-00003 (SEQ ID NO: 2) SGPWMCYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHISE WCRCGALYSMLDSMYKEHGAQEGQAGTGAFPRCRREVVKLTAASITAVCR LPIVVDASGDGAYVCKDVAAYPD
(37) The invention provides methods for the treatment of negative gastrointestinal reactions to other cereal-based (e.g., barley, rye, oats, corn, and rice) CM3 or 0.19 proteins, or related molecules, e.g., those set forth in Tables 1 and 2.
(38) TABLE-US-00004 TABLE 1 Accession Description P17314.1 Alpha-amylase/trypsin inhibitor CM3; P11643.2 Alpha-amylase/trypsin inhibitor CMd; [Hordeum vulgare] CAA49536.1 CMd subunit of tetrameric alpha-amylase inhibitor [Hordeum vulgare] AAB63440.1 CMd3 protein [Hordeum vulgare] CAA31585.1 CMd preprotein (AA -14 to 146) [Hordeum vulgare subsp. vulgare] 1208404B trypsin/amylase inhibitor pUP38 P16159.1 Alpha-amylase/trypsin inhibitor CM16; [Triticum aestivum] P32936.2 Alpha-amylase/trypsin inhibitor CMb; [Hordeum vulgare subsp. vulgare]
(39) TABLE-US-00005 TABLE 2 Accession Description HSSA Alpha-amylase/trypsin inhibitor 0.19 [Triticum aestivum] HSSB Alpha-amylase/trypsin inhibitor 0.19 [Triticum aestivum] HSSC Alpha-amylase/trypsin inhibitor 0.19 [Triticum aestivum] HSSD Alpha-amylase/trypsin inhibitor 0.19 [Triticum aestivum] PO1085.1 Alpha-amylase/trypsin inhibitor 0.19 [Aegilops tauschii] BAA20139.1 Alpha-amylase/trypsin inhibitor 0.19 [Aegilops tauschii]
(40) A sequence comparison with a wide spectrum of other ATIs from wheat and barley (those sequences that are published in common sequence databases) show again largely conserved cysteine residues and neighbouring amino acid residues (
(41) TLR4 Inhibitors
(42) TLR4 inhibitors for pharmaceutical use are known in the art. Such inhibitors include synthetic gluco-disaccharides such as RSCL-0409 (Kalluri et al. FEBS J. 2010 April; 277(7):1639-52); TLR4 (MD2-TLR4) blocking antibodies (Ungaro et al. Am J Physiol Gastrointest Liver Physiol. 2009 June; 296(6):G1167-79); phosphatidyl-ethanolamine (Lee et al. Mol Cells. 2009 Feb. 28; 27(2):251-5); peptide antagonists (Slivka et al. Chembiochem. 2009 Mar. 2; 10(4):645-9); eritoram tetrasodium, E5564 (Rossignol et al. Innate Immun. 2008 December; 14(6):383-94; Kim et al. Cell. 2007 Sep. 7; 130(5):906-17; and Shimamoto et al. Circulation. 2006 Jul. 4; 114(1 Suppl):I270-4); tetra- or penta-acetylated lipid A (Zhang et al. Org Biomol Chem. 2008 Sep. 21; 6(18):3371-81; Coats et al. J Immunol. 2005 Oct. 1; 175(7):4490-8); blocking LPS variants such as LPS from cyanobacteria, Rhodobacter capsulates, Porphyromonas gingivalis and Capnocytophagatochracea or Helicobacter pylori (Ianaro et al. Mini Rev Med Chem. 2009 March; 9(3):306-17; Jemmett et al. Infect Immun. 2008 July; 76(7):3156-63; and Macagno A, et al. J Exp Med. 2006 Jun. 12; 203(6):1481-92), Bartonella Quintana (Popa et al. Infect Immun. 2007 October; 75(10):4831-7), Treponema (Lee et al. Microbiology. 2006 February; 152(Pt 2):535-46), or lipid IVa (Saitoh et al. Int Immunol. 2004 July; 16(7):961-9); E5531 (Bryant et al. Vet Immunol Immunopathol. 2007 Apr. 15; 116(3-4):182-9); soluble MD-2/TLR4 complex (Mitsuzawa et al. J Immunol. 2006 Dec. 1; 177(11):8133-9); including indirect negative modulators of TLR4 (MD2-TLR4), such as vitamin D (Sadeghi et al. Eur J Immunol. 2006 February; 36(2):361-70), testosterone derivatives (Norata et al. J Clin Endocrinol Metab. 2006 February; 91(2):546-54), CRX526 (Ianaro et al.), or inhibitors of the nicotinic acetylcholine receptor (Hamano et al. Shock. 2006 October; 26(4):358-64). Each of the above references is incorporated by reference in its entirety.
(43) Any of the agents employed according to the present invention may be contained in any appropriate amount in any suitable carrier substance, and is generally present in an amount of 1-95% by weight of the total weight of the composition. The composition may be provided in a dosage form that is suitable for the oral, parenteral (e.g., intravenously, intramuscularly), rectal, cutaneous, nasal, vaginal, inhalant, skin (patch), or ocular administration route. Thus, the composition may be in the form of, e.g., tablets, capsules, pills, powders, granulates, suspensions, emulsions, solutions, gels including hydrogels, pastes, ointments, creams, plasters, drenches, osmotic delivery devices, suppositories, enemas, injectables, implants, sprays, or aerosols. The pharmaceutical compositions may be formulated according to conventional pharmaceutical practice (see, e.g., Remington: The Science and Practice of Pharmacy, 20th edition, 2000, ed. A. R. Gennaro, Lippincott Williams & Wilkins, Philadelphia, and Encyclopedia of Pharmaceutical Technology, eds. J. Swarbrick and J. C. Boylan, 1988-1999, Marcel Dekker, New York).
(44) Indications
(45) The invention provides methods for the treatment of AAI (e.g., CM3- and/or 0.19)-related gastrointestinal disorders by administering a subject (e.g., a human) in need thereof an effective amount of a composition that includes an antibody against an AAI protein (e.g., CM3), or a different antibodies against the major AAI variants in cereals. Such disorders are related to the induction of an innate immune response against AAI proteins (e.g., against CM3 and/or 0.19) after the consumption of an AAI containing food product. These disorders include celiac disease, ulcerative colitis, Crohn's disease, irritable bowel syndrome, gastrointestinal hypersensitivity to wheat, as well as other inflammatory disease of the GI tract and related immune and autoimmune disorders.
(46) Anti-AAI Antibodies
(47) The invention provides therapeutic antibodies (e.g., neutralizing antibodies) and diagnostic antibodies against AAI, e.g., against CM3 and/or 0.19.
(48) The antibodies (e.g., monoclonal, polyclonal, poly-specific, or mono-specific antibodies) against AAI (e.g., against CM3 and/or 0.19) can be used for diagnostic, research, or therapeutic purposes. Numerous methods for making antibodies are known in the art and can be used in the invention to make such antibodies. In one example, a coding sequence for an AAI (e.g., a CM3 and/or 0.19) peptide or polypeptide is expressed as a C-terminal fusion with glutathione S-transferase (GST) (Smith et al., Gene 67:31, 1988). The fusion protein is purified on glutathione-Sepharose beads, eluted with glutathione, cleaved with thrombin (at an engineered cleavage site), and purified for immunization of rabbits. Primary immunizations are carried out with Freund's complete adjuvant and subsequent immunizations with Freund's incomplete adjuvant. Antibody titers are monitored by Western blot and immunoprecipitation analyses using the thrombin-cleaved protein fragment of the GST fusion protein. Immune sera are affinity purified using CNBr-Sepharose-coupled protein. Antiserum specificity can be determined using a panel of unrelated GST proteins.
(49) As an alternate or adjunct immunogen to GST fusion proteins, peptides corresponding to relatively unique immunogenic regions of a polypeptide of the invention can be generated and coupled to keyhole limpet hemocyanin (KLH) through an introduced C-terminal lysine. Antiserum to each of these peptides is similarly affinity purified on peptides conjugated to BSA, and specificity is tested by ELISA or Western blot analysis using peptide conjugates, or by Western blot or immunoprecipitation using the polypeptide expressed as a GST fusion protein. Alternatively, monoclonal antibodies that specifically bind an AAI (e.g., CM3 or 0.19) can be prepared using standard hybridoma technology (see, e.g., Kohler et al., Nature 256:495, 1975; Kohler et al., Eur. J. Immunol. 6:511, 1976; Kohler et al., Eur. J. Immunol. 6:292, 1976; Hammerling et al., Monoclonal Antibodies and T Cell Hybridomas, Elsevier, N Y, 1981). Once produced, monoclonal antibodies can also be tested for specific recognition by Western blot or immunoprecipitation analysis. Antibodies that specifically recognize an AAI protein (e.g., CM3 or 0.19) can be used, for example, in immunoassays or as therapies. Alternatively monoclonal antibodies can be prepared using the polypeptide of the invention described above and a phage display library (Vaughan et al., Nature Biotech. 14:309, 1996).
(50) Antibodies of the invention can be produced using fragments of the AAI (e.g., a CM3 and/or 0.19) polypeptide that lie outside generally conserved regions and appear likely to be antigenic by criteria such as high frequency of charged residues. In one specific example, such fragments are generated by standard techniques of PCR and cloned into the pGEX expression vector. Fusion proteins are expressed in E. coli and purified using a glutathione agarose affinity matrix. To minimize potential problems of low affinity or specificity of antisera, two or three such fusions are generated for each protein, and each fusion is injected into at least two rabbits. Antisera are raised by injections in a series, and can include, for example, at least three booster injections.
(51) In addition to intact monoclonal and polyclonal anti-AAI (e.g., anti-CM3 and/or 0.19) antibodies, the invention also includes various genetically engineered antibodies, humanized antibodies, chimeric antibodies, and antibody fragments, including F(ab′)2, Fab′, Fab, Fv, and sFv fragments. Truncated versions of monoclonal antibodies, for example, can be produced by recombinant methods in which plasmids are generated that express the desired monoclonal antibody fragment(s) in a suitable host. Antibodies can be humanized by methods known in the art, e.g., monoclonal antibodies with a desired binding specificity can be commercially humanized (Scotgene, Scotland; Oxford Molecular, Palo Alto, CA). Fully human antibodies, such as those expressed in transgenic animals, are also included in the invention (Green et al., Nature Genetics 7:13-21, 1994).
(52) Examples of approaches that can be used to generate antibodies of the invention include the following. Ladner (U.S. Pat. Nos. 4,946,778 and 4,704,692) describes methods for preparing single polypeptide chain antibodies. Ward et al., Nature 341:544-546, 1989, describes the preparation of heavy chain variable domains, which they term “single domain antibodies,” and which have high antigen-binding affinities. McCafferty et al., Nature 348:552-554, 1990, shows that complete antibody V domains can be displayed on the surface of fd bacteriophage, that the phage bind specifically to antigen, and that rare phage (one in a million) can be isolated after affinity chromatography. Boss et al., U.S. Pat. No. 4,816,397, describes various methods for producing immunoglobulins, and immunologically functional fragments thereof, that include at least the variable domains of the heavy and light chains in a single host cell. Cabilly et al., U.S. Pat. No. 4,816,567, describes methods for preparing chimeric antibodies.
(53) Antibodies to AAI (e.g., to CM3 or 0.19) can be used, as noted above, to detect AAI, or to inhibit the biological activities of AAI. In addition, the antibodies can be coupled to compounds, such as radionuclides and liposomes, for diagnostic uses.
(54) In order to generate polyclonal antibodies on a large scale and at a low cost an appropriate animal species can be chosen. Polyclonal antibodies can be isolated from the milk or colostrum of, e.g., immunized cows. Bovine colostrum contains 28 g of IgG per liter, while bovine milk contains 1.5 g of IgG per liter (Ontsouka et al. J. Dairy Sci. 86:2005-2011, 2003). Polyclonal antibodies can also be isolated from the yolk of eggs from immunized chickens (Sarker et al. J. Ped. Gastro. Nutr. 32:19-25, 2001).
(55) Multiple adjuvants are approved for use in dairy cows. Adjuvants useful in this invention include, but are not limited to, Emulsigen®, an oil-in-water emulsified adjuvant, Emulsigen®-D, an oil-in-water emulsified adjuvant with DDA immunostimulant, Emulsigen®-P, an oil-in-water emulsified adjuvant with co-polymer immunostimulant, Emulsigen®-BCL, an oil-in-water emulsified adjuvant with block co-polymer immunostimulant, Carbigen™, a carbomer base, and Polygen™, a co-polymer base. All of the listed adjuvants are commercially available from MVP Laboratories in Omaha, NE.
(56) Antibodies useful in this invention can be identified in several different screening assays. First, antibodies are assayed by ELISA to determine whether they are specific for the immunizing antigen (e.g., CM3 and/or 0.19). Using standard techniques, ELISA plates are coated with immunogen, the antibody is added to the plate, washed, and the presence of bound antibody detected by using a second antibody specific for the Ig of the species in which the antibody was generated.
(57) A functional in vitro assay can be used to screen antibodies e.g., an neutralizing assay based on monocyte derived dendritic cells, as described herein.
(58) Direct measurements of bovine immunoglobulin in illeal fluid in human subjects has shown that significant amounts of immunoglobulin survive transit through the stomach and small intestine (Wamy et al. Gut, 44:212-217, 1999). Methods have also been described to formulate avian immunoglobulin (IgY) for GI delivery (Kovacs-Nolan and Mine Immunol. Methods. 296: 199-209, 2005).
(59) The invention provides a therapeutic composition comprising anti-AAI (e.g., anti-CM3 and/or anti-0.19) antibodies suitable for delivery, preferably oral delivery, to a patient in need thereof, preferably a human patient. The pharmaceutical composition may further comprise suitable carriers, adjuvants and other physiologically acceptable excipients.
(60) The invention also features a therapeutic composition containing antibodies with specificity for both the CM3 of SEQ ID NO:1 (or proteins substantially identical to the protein of SEQ ID NO:1) and/or the 0.19 of SEQ ID NO:2 (or proteins substantially identical to the protein of SEQ ID NO:2) as well as additional CM3- or 0.19-related proteins (e.g., CM3 or 0.19 analogs expressed in other species of cereals or other AAI proteins as disclosed herein). Such antibodies can be identified by testing specificity to all of the desired CM3- or 0.19-related proteins.
(61) Furthermore, the invention also features pharmaceutical compositions containing a plurality of antibodies, where different antibodies in the composition are specific for different analogs of AAI (e.g., CM3 and/or 0.19). Additionally or alternatively, such compositions can contain antibodies against both AAI CM3 and/or 0.19), as well as gluten (e.g., gliadin and glutenin fractions, see, e.g., WO 2007/056301, which is herein incorporated by reference in its entirety). Such pharmaceutical compositions can be achieved by mixing more than one source of antibodies, or, e.g., inoculating an antibody producing animal with more than one AAI (e.g., a cow can be inoculated with variants of CM3 and/or 0.19 with adjuvants as described above thereby creating a mixture of polyclonal antibodies with differing specificities).
(62) The oral formulations can comprise enteric coatings, so that the active agent is delivered to the intestinal tract. Enteric formulations are often used to protect an active ingredient from the strongly acid contents of the stomach. Such formulations are created by coating a solid dosage form with a film of a polymer that is insoluble in acid environments and soluble in basic environments. Exemplary films are cellulose acetate phthalate, polyvinyl acetate phthalate, hydroxypropyl methylcellulose phthalate, and hydroxypropyl methylcellulose acetate succinate, methacrylate copolymers and cellulose acetate phthalate.
(63) The pharmaceutical compositions can be administered in any orally acceptable dosage form including, but not limited to, capsules, tablets, aqueous suspensions or solutions.
(64) Neutralizing antibodies can be administered to a patient prior to, or concurrently, or after the ingestion of a substance that may contain an AAI (e.g., CM3 and/or 0.19). The neutralizing antibodies of the invention can also be administered to the patient on a regular dosing schedule (e.g., one, two, three times a day, or more). The neutralizing antibodies can also be administered at a specific time of day, e.g., prior to sleep or upon wakening.
(65) Detection and measurement of indicators of efficacy may be measured by a number of available diagnostic tools, including but not limited to, for example, by physical examination including blood tests, biopsies of the small intestine, pulmonary function tests, and chest X-rays; CT scan; bronchoscopy; bronchoalveolar lavage; lung biopsy and CT scan. Suppression of the innate immunity can be measured, e.g., by quantifying the release of cytokines at the sites of lesions. Also, both the physician and patient can identify a reduction in symptoms of a disease.
(66) The pharmaceutical compositions of this invention comprise any of the compounds of the present invention, or pharmaceutically acceptable derivatives thereof, together with any pharmaceutically acceptable carrier.
(67) The dosage and dose rate of the compounds of this invention effective to produce the desired effects will depend on a variety of factors, such as the nature of the antibody, the size of the subject, the goal of the treatment, the nature of the pathology to be treated, the specific pharmaceutical composition used, and the judgment of the treating physician. Dosage levels of between about 0.1 and about 1000 mg/kg body weight per dose, preferably between about 1 and about 500 mg/kg body weight per dose of the active ingredient antibody are useful. The antibodies of the invention can also be administered at a dose ranging between about 1 mg/kg body weight/dose and about 200 mg/kg body weight/dose, and between about 5 mg/kg body weight/dose and about 50 mg/kg body weight/dose.
(68) Detection Assays
(69) The invention features assays for detecting AAI (e.g., CM3 and/or 0.19) in food products. The assays can contain, e.g., antibodies as described above. Such antibodies can be antibodies specific for AAI proteins (e.g., CM3 and/or 0.19), and can have neutralizing or non-neutralizing activities. Such antibodies can be detectably labeled to facilitate detection. Assays for detecting proteins in a sample (e.g., a food product) are known in the art (e.g., ELISA or RIA assays). Such assays can be readily adapted to detection of AAI (e.g., CM3 and/or 0.19).
(70) The invention also features assays for detecting antibodies against AAI (e.g., CM3 or 0.19) in a patient sample (e.g., using an ELISA assay as described above). Such assays can be used, e.g., to diagnose a patient as being sensitive to AAI (e.g., sensitive to CM3 and/or 0.19, and as having celiac disease, ulcerative colitis, Crohn's disease, or irritable bowel syndrome). The patient sample can be any sample likely to contain antibodies against AAI (e.g., a blood sample or stool sample). The presence or heightened levels of endogenously generated antibodies against AAI can be indicative of a subject as being sensitive to AAI containing food products.
(71) AAI Depleted Food Products
(72) The invention also features food products with decreased levels of AAI (e.g., CM3 and/or 0.19). Such food products can be prepared, e.g., by degrading or removing AAI prior to consumption. Such food products can also be prepared from transgenic cereals (e.g., wheat) containing nucleic acid constructs encoding RNAi molecules against AAI.
(73) Decreased levels of AAI (e.g., CM3 and/or 0.19) protein can be achieved, e.g., through disulfide reduction of AAI. This can be achieved by agents such dithioerithrol, or preferably by a NADP-thioredoxin system as described by Farid et al. (J Agricult Food Chem 56:7146-7150, 2008) for the improvement of digestability of soy flour. The latter and related methodologies have the advantage that disulfide reduction is non-toxic. The reduced AAIs are then easily degraded by gastric and duodenal proteases, leading to their “detoxification,” i.e., inability to elicit an innate immune response. To secure complete degradation before ingestion, the reduced AAIs can be predigested with common proteases such as pepsin, trypsin, or chymotrypsin, or with specialized enzyme preparations.
(74) Decreased levels of AAI (e.g., CM3 and/or 0.19) can also be achieved by separating AAI from the food product by, e.g., exposing the food product to antibodies specific for AAI. Such antibodies can be used, e.g., in a purification column to remove AAI from a solution containing AAI.
(75) Methods for silencing gene expression in plants is well understood in the art. The current invention features RNAi molecules specific for an AAI (e.g., against a nucleic acid sequence corresponding to the amino acid sequence of SEQ ID NO:1 and/or SEQ ID NO:2). Such RNAi molecules can be expressed from a nucleic acid construct introduced into a plant cell. Desirably, expression of the RNAi construct would result in a decrease of CM3 and/or 0.19 expression in the food product of 50%, 60%, 70%, 80%, 90%, 95%, 99%, or greater.
(76) In a specific embodiment, virus induced gene silencing (VIGS) can be used to decrease CM3 (or other AAIs) expression in, e.g., wheat or other cereals. In this embodiment, a plant virus (e.g., barley stripe mosaic virus) is engineered to contain a sequence with substantial identity to a the genomic nucleic acid sequence corresponding to CM3 (or other AAIs). This technology is reviewed, e.g., in Cakir et al. (Crop Sci. 50:S-1-S-8, 2010), which is hereby incorporated by reference in its entirety.
(77) Experimental Results
(78) To examine how far gliadin elicits innate immune responses, we stimulated the human monocytic cell lines THP-1 and U937 with different concentrations of gliadin digested with pepsin and trypsin (PT gliadin) and measured secretion of proinflammatory cytokines in the supernatant. A digest of zein, partly homolgous storage proteins from corn that lack toxicity for patients with celiac disease, served as negative control. In accordance with other studies, only PT gliadin but not PT zcin caused a dose dependent stimulation of IL-8, TNF-α, and MCP-1 secretion in both cell lines (
(79) It was shown previously that the α-gliadin peptide p31-43 increases IL-15 secretion in celiac biopsies. However, this peptide did not elicit secretion of IL-8, TNF-α, or MCP-1 in our monocytic or intestinal epithelial cell lines (HT29, Caco-2 and T84), even at 40 μg/ml (
(80) We then analyzed human DC derived from peripheral blood monocytes of celiac patients on gluten free diet (gfd, n=8), on regular diet (n=3) and healthy controls (n=10). Although there were considerable inter-individual variations, all cells strongly reacted to gliadin stimulation by IL-8 secretion. Of note, there were no significant differences in sensitivity towards PT gliadin between celiac patients on or off gluten free diet and healthy controls, confirming recent data that demonstrated comparable activation of PT gliadin-stimulated DC from controls and CD patients. Again, PT zein had no effect on cytokine production (
(81) When exposed to PT gliadin and LPS, DC also up-regulated the cell surface maturation markers CD25, CD80, CD83, and CD86 while zein showed no effect (
(82) A recent study suggested that gliadin may signal via MyD88, a key adapter molecule in the toll-like receptor (TLR)/IL-10 pathway. Since MyD88 transmits signals from several TLRs, we studied peritoneal macrophages of C3H/HeJ mice that lack TLR4 responses due to a spontaneous point mutation in the TLR4 gene. In these mice KC (IL-8) and TNF-α secretion was reduced to baseline levels after gliadin or LPS stimulation compared to syngenic C3H/HeOuJ TLR4 competent mice. In macrophages from both mouse strains the specific TLR2 agonist Pam3CSK4 induced equally high amounts of KC and TNF-α, verifying otherwise intact MyD88 and TLR signaling and viability of the cells (
(83) To confirm a key role of TLR4 in the innate immune response to gliadin extract, we used HEK-293 cells (that do not express TLR4 or TLR2) that were transfected with the human TLR4-CD14-MD2-complex. While non-transfected HEK-293 cells responded neither to gliadin nor to LPS stimulation, both stimulants induced an increase of IL-8 secretion in the transfected cells. Specificity of the transfection was demonstrated by the absence of IL-8 induction by the TLR2 agonist Pam3CSK4 (
(84) In order to examine whether gliadin also engages TLR4 in human dendritic cells, we preincubated monocyte derived DC with anti-TLR4 and CD14 blocking antibodies before adding the stimulants. This significantly reduced IL-8 production in DC stimulated with gliadin and LPS but not with the TLR2 and TLR3 agonists Pam3CSK4 and Poly-I:C, respectively, both in DC from healthy controls (
(85) TLR4 is unique in its ability to mediate cellular activation via two pathways: the adapter molecule MyD88 or via interferon regulatory factor 3 (IRF3) pathway. Compared to C57BL/6J wildtype mice, peritoneal macrophages from MyD88 knockout mice displayed markedly reduced KC and TNF-α secretion after gliadin and LPS stimulation, indicating a major involvement of the MyD88 pathway. Since TLR3 does not use MyD88 as adapter protein for signaling, we used the TLR3 agonist Poly PC as positive control (
(86) To analyze potential activation of the alternate pathway, we measured the secretion of RANTES in supernatants of macrophages from C57BL/6J wildtype mice. RANTES secretion was increased, suggesting that both the MyD88 dependant and independent pathway are activated by the gliadin extract (
(87) We then proceeded to further define the gliadin fractions that harbored the stimulatory activity. Gliadins from the pure wheat strain “Rektor” were separated into their α-, γ- and ω-fractions via HPLC. The α-, γ-, ω1-2-, and ω5-gliadins, as well as whole gliadin were digested with pepsin and trypsin and first tested on THP-1 monocytic cells. Neither the α- nor the γ-gliadins which represent more than 90% of total gliadin harbored stimulatory activity, whereas IL-8 release was induced strongly by PT-digested ω1-2- and ω5-gliadins (
(88) Next, we used synthetic overlapping 20mers of the ω5 gliadin chain to identify the TLR4-stimulating peptide sequence using TLR4-CD14-MD2-transfected FMK cells and IL-8 secretion for a readout. Surprisingly, none of the synthetic peptides triggered IL-8 secretion (
(89) Subsequently, we used AAI purified from wheat seed to stimulate human monocyte derived dendritic cells. HPLC analysis of this preparation showed one major peak confirming its purity. Both untreated and PT-digested AAI induced increased IL-8 secretion (
(90) To examine whether the in vitro responses translated into physiologically relevant in vivo responses, we used water-soluble gliadin (which was available in larger quantities) in most experiments and AAI for select studies. When injected intraperitoneally, water-soluble gliadin lead to an increase in peripheral KC and TNF-α levels comparable to LPS, whereas water-soluble zein did not induce a response. No responses were found in MyD88−/− mice, neither with LPS nor with water-soluble gliadin (
(91) Next we analyzed local intestinal effects of orally ingested ATI. To this end C57BL/6J mice were gavaged with LPS, water-soluble gliadin, or PBS, followed by measurement of transcript levels of inflammatory cytokines in the proximal duodenum. Only with water-soluble gliadin did we detect a significant upregulation of duodenal KG, MCP-1, and IL-1β (but not TNF-α) transcripts (
(92) Experiments were also performed with purified alpha amylase inhibitor, in order to confirm this protein antigen as trigger of wheat-induced innate immune response. When we gavaged C57BL/6 mice with LPS, AAI, and water-soluble zein, AAI was indeed able to increase transcript levels of KC, IL-1β, and IL-6 but not TNF-α in the duodenal mucosa (
(93) AAI CM3 and 0.19 were recombinantly expressed in eukaryotic HEK 293 cells, in order to exclude bacterial contaminants, to ensure correct folding, and to identify which of both molecules was the active compound. The affinity purified proteins were used to stimulate monocyte derived DCs. Here, CM3, and to a lesser degree 0.19, upregulated IL-8 secretion, suggesting that CM3 as well as 0.19 AAI were the active compound (
(94) CM3 and 0.19, the main ATI family members, were detected by mass spectrometry and were recombinantly expressed in eukaryotic HEK-293 cells to prevent bacterial contaminants (LPS) and to ensure correct protein folding (
(95) Materials
(96) Purified cell culture tested LPS (E coli 055:B5) and in wheat alpha-amylase inhibitor (AAI) type I were purchased from Sigma-Aldrich (St Louis, MO), the TLR2 agonist N-Palmitoyl-S-[2,3-bis(palmitoyloxy)-(2RS)-propyl]-[R]-cysteinyl-[S]-seryl-[S]-lysyl-[S]-lysyl-[S]-lysyl-[S]-lysine x3 HCl (Pam3CSK4) and the TLR3 agonist Polyinosine-polycytidylic acid (poly-I:C)) were obtained from Invivogen (San Diego, CA). Other reagents were of the highest purity available and, if not mentioned otherwise, obtained from Sigma-Aldrich.
(97) Isolation of Gliadin Fractions and PT-Gliadin
(98) Unless otherwise stated gliadin purchased from Sigma-Aldrich (G3375) was used for experiments. Gliadin from the pure wheat strain ‘Rektor’ was subfractionated as described in the art. Briefly, α, γ, ω1.2 and ω5 gliadins were obtained by HPLC purification on a Nucleosil C8 column (4.6×240 mm) at 50° C., using 0.1% trifluoroacetic acid as phase A, and 99.9% acetonitrile plus 0.1% trifluoroacetic acid as phase B, and a gradient from 24% B to 56% B in 30 min. Detection was at 210 nm. Purity of the fractions was confirmed by SDS PAGE, aminoterminal sequence analysis and their characteristic amino acid composition.
(99) Pepsin-trypsin-digested (PT-) gliadin was generated as originally described with minor modifications. Briefly, gliadin was digested with pepsin in 0.1M HCL (pH 1.8) at 37° C. for 4 hrs, followed by pH adjustment to 7.8 and digestion with trypsin at 37° C. for 4 hrs (substrate:enzyme ratio of 1:200 for both reactions). Adjustment of the pH to 4.5 resulted in a precipitate which was removed by centrifugation at 2,500 rpm, and N-tosyl-chloromethyl-ketone was added to inhibit residual trypsin activity. The supernatant containing the PT-gliadin was dialyzed against 10 mM ammonium carbonate, pH 7.8 (molecular weight exclusion 1000D, Spectra/Por®, Serva, Heidelberg, Germany), sterile-filtered and lyophilized. A parallel digest of zein from corn (Sigma-Aldrich) was used as negative control.
(100) The water soluble fraction of gliadin was obtained by incubating 10 g of gliadin in 50 ml sterile water at 37° C. for 8 hrs under continuous stirring. Insolubles were removed by centrifugation and the supernatant was sterile filtered and lyophilized.
(101) Synthetic Peptides
(102) Peptide p31-43 of α-gliadin (sequence LGQQQPFPPQQPY (SEQ ID NO:3 and a scrambled control peptide (sequence GLQPFQQPQPPQY (SEQ ID NO:4)) were synthesized by AnaSpec Inc. (San Jose, CA). Purity of the peptides was >80% according to HPLC and mass spectrometry analysis. Forty-three 20mer peptides with an overlap of ten amino acids covering the 440 residue omega 5 gliadin were synthesized at 60-80% purity by Primm Biotechnology (Cambridge, MA).
(103) Cell Culture and In Vitro Stimulation Experiments
(104) THP-1, U937, HEK-293 (all from ATCC, Manassas, VA), and HEK-293 cells stably transfected with the TLR4-CD14-MD2 complex (Invivogen) were cultured in complete RPM or DMEM (Cellgro, Manassas, VA) supplemented with penicillin/streptomycin and 10% fetal calf serum at 37° C. in a 5% CO.sub.2 atmosphere.
(105) For isolation of peripheral monocytes 40 ml blood was obtained from 11 patients with celiac disease during their diagnostic workup (median 37 years, range 18-59 years), after prior informed consent Eight patients were on gluten free diet and in clinical remission, three patients were newly diagnosed and therefore on a regular gluten containing diet Control monocytes were from the buffy coat of leukopheresis concentrates of anonymous blood donors. Whole EDTA blood or leukapheresis concentrates were subjected to density gradient centrifugation over Ficoll-Hypaque (GE Healthcare, Pittsburgh, PA) and CD14-positive monocytes purified by MACS separation according to the manufacturer's protocol (Miltenyi, Bergisch Gladbach, Germany). For generation of dendritic cells, monocytes were cultured in RPMI supplemented with 10% fetal calf serum, 200 U/ml rhIL-4 and 300 U/ml rhGM-CSF (both from PeproTech, Rocky Hill, NJ) for 6-8 days.
(106) Murine resident peritoneal macrophages were isolated by peritoneal lavage using a 3 ml syringe and 18 G needles. Three 3 ml of sterile PBS was injected into the peritoneal cavity and reaspirated after gentle massage of the abdomen. For further purification MACS separation for CD11b positive cells was done according to the manufacturer's protocol (Miltenyi).
(107) For stimulation cells were seeded on polystyrene wells at a density of 1×10.sup.6/ml. Unless otherwise stated supernatants were harvested after a 16 hr incubation with various stimulants.
(108) Exclusion of LPS Contamination
(109) To prove that stimulatory effects were due to protein, PT-gliadin, the wheat ATI, LPS, or TNFα were incubated with or without 20 μg/ml proteinase K (Promega, Madison, WI) for 4 hrs at 56° C. After proteinase K inactivation by boiling for 5 minute the digests were used for cell stimulation.
(110) Animals
(111) C3H/HeJ, C3H/HeOuJ and Rag1−/− mice were obtained from The Jackson Laboratory (Bar Harbour, ME). The MyD88−/− mice were a kind gift from S. Akira, (Osaka University, Osaka, Japan). Congenic C57BL/6J mice served as experimental controls and were bred under the same conditions in the same facility. All experiments were done with mice at age 5-7 weeks.
(112) In Vivo Experiments
(113) Mice were injected intraperitoneally with water-soluble gliadin, zein (500 μg/g body weight) or LPS (1 μg/g) in 200 μl PBS, or PBS alone (negative control). 2 hrs after injection, mice were euthanized by ketamine/xylazine administration and blood was drawn by intraorbital bleeding.
(114) For gavage experiments mice were either raised on gluten free diet (C57BL/6J and MyD88−/− mice) or put on gluten free diet for at least two weeks (C3H/HeJ, C3H/HeOuJ mice), and starved the night before the experiment. Gluten free feed was obtained from Research Diets (New Brunswick, NJ). All stimulants were diluted in PBS. Mice were administered gliadin, zein (2 mg/g mouse weight), LPS (20 μg/g mouse weight), ATI (0.075 mg/g mouse weight) in 200 μl PBS. Mice were euthanized 4 hrs after gavage and the duodenum snap frozen in liquid nitrogen.
(115) Cytokine/Chemokine Assays
(116) The concentration of IL-8, TNF-α, MCP-1, RANTES, and mouse IL-8 (KC) in cell culture supernatants and serum samples was determined using validated ELISAs (IL-8, hTNFα: BD Pharmingen, San Jose, CA; MCP-1, hRANTES, mRANTES, KC: R&D Systems, (Minneapolis, MN; mTNFα: eBioscience, San Diego, CA), according to the manufacturer's protocols.
(117) RNA Isolation and qRTPCR
(118) Samples from the small intestine (0.5 cm segment, 2 cm distal to the pylorus) were collected at sacrifice and snap-frozen for further analysis. Total RNA isolation was performed using Trizol reagent (Invitrogen) according to the manufacturer's instructions. Exon-exon boundary spanning primer sequences were obtained from PrimerBank (http://pga.mgh.harvard.edu/primerbank/) and sequences are listed in Table [x]. Real-time PCR was performed using LightCycler 480 SYBR Green mastermix (Roche, Indianapolis, IN) and a Roche LightCycler 480 system. Mouse GAPDH served as endogenous control. PCR was set up in triplicates and threshold cycle (Ct) values of the target genes were normalized to the endogenous control. Differential expression was calculated according to the 2-ΔΔCT method.
(119) Blocking Experiments
(120) Monocyte derived dendritic cells were seeded at a concentration of 1×10.sup.6/ml in 96 well plates. Cells were pre-incubated with blocking antibodies (polyclonal rat anti-TLR4, Invivogen, 10 μg/ml), polyclonal goat anti-CD14, R&D, 20 μg/ml) for 3 hrs at 37° C. before stimulation.
(121) Flow Cytometry
(122) Human monocyte derived DC were stimulated with LPS, PT gliadin, and PT zein overnight. For flow cytometry analysis, cells were pre-incubated with FcR blocking reagent (Miltenyi) for 15 min at 4° C. before staining with monoclonal antibodies (final concentration 10 μg/ml, all from eBioscience) for 30 min at 4° C. Cells were then washed with staining buffer (PBS, 1% BSA), cell viability was assessed by DAPI exclusion (0.1 μg/ml, Roche) and only viable cells were analyzed by flow cytometry using a 4 laser LSRII (BD Biosciences) and Flowjo software (Tree Star, Inc.).
(123) Recombinant Expression of AAI CM3 and 0.19 Proteins
(124) Recombinant flag-tagged CM3 or 0.19 were generated in a eukaryotic system using the expression vector pCDNA (Invitrogen) and HEK 293 cells. cDNA was optimized and synthesized by genescript (sequence number AY436554.1) and correct orientation was checked by sequencing analysis. The expressed protein was purified from supernatant with anti-flag agarose beads in batch technique according to the manufacturer's protocol (Sigma).
(125) Statistical Analysis
(126) Differences were tested for statistical significance by the unpaired t-test. p<0.05 was considered significant. In all graphs, error bars depict standard errors of the mean.
(127) Recombinant Expression of ATI CM3 and 0.19 Proteins
(128) In order to exclude bacterial contaminants, recombinant flag-tagged ATI CM3 and 0.19 were generated in eukaryotic HEK-293 cells, using cDNAs optimized to fit eukaryotic codon usage (Genscript, Piscataway, NJ; CM3 and 0.19 with NCBI GenBank sequence numbers AY436554.1 and AY729672.1, respectively). cDNAs were cloned into pUC57 and correct reading frames and orientations confirmed by sequence analysis and KpnI-ApaI restriction. CM3 and 0.19 open reading frames were then cloned into pcDNA3.1 (+) (Invitrogen). In order to increase expression level of ATI 0.19, the HindIII-KpnI fragment of the PCR product was fused with the Flag-tag at the N- instead of the C-terminus using the forward primer 5′-CCCAAGCTTAGCGGACCCTGGATGTGCTAC (SEQ ID NO: 15) and the reverse primer 5′-CGGGGTACCCCTCAGGCGTCAGGGTAAGCGGCCAC (SEQ ID NO: 16). The CM3 and 0.19 constructs were then subcloned into the pFLAG-CMV4 vector (Sigma-Aldrich) and the correct orientation was confirmed by sequencing with the N-terminal sequencing primer 5′-AATGTCGTAATAACCCCGCCCC-GTTGACGC (SEQ ID NO: 17).
(129) Subconfluent HEK-293 cells cultured on 10 cm tissue culture dishes were transfected with 10 μg of plasmid DNA encoding CM3 and 0.19 using lipofectamine 2000 (Invitrogen), followed by incubation in DMEM (Mediatech) containing 1% fetal bovine serum and 100 IU penicillin/100 μg/ml streptomycin for 48 h. The media were obtained by centrifugation at 4,500 rpm for 10 min at 4° C. Cells were then washed with ice cold-PBS [pH 7.4], resuspended in buffer C (20 mM Tris-HCl [pH 7.4], 150 mM NaCl, 50 mM NaF, 1 mM Na.sub.3VO.sub.4, 1 mM EDTA, 0.5% TritonX-100, 0.5% sodium deoxycholate) supplemented with EDTA-free Complete protease inhibitors (Roche) for 15 min on ice, and then centrifuged at 14,000 rpm for 20 min at 4° C. Aliquots of the detergent-soluble and insoluble fractions were boiled at 100° C. (the pellet in SDS sample buffer), separated on a SDS-15% polyacrylamide gel, and subjected to Western blot analysis. Protein lysates were probed with rabbit anti-flag antibody (Sigma-Aldrich), followed by horseradish peroxidase-labeled anti-rabbit IgG (Vector Laboratories, Burlingame, CA). Protein bands were visualized using enhanced chemiluminescence (Thermo Scientific, Rockford, IL) and X-Oat 2000A processor (Kodak).
(130) Purification of α-Amylase Inhibitors, CM3 and 0.19
(131) While sufficient CM3 protein was secreted into the media, 0.19 ATI had to be isolated from the detergent-soluble fraction. Briefly, HEK-cells expressing 0.19 were washed with ice cold-PBS, resuspended in 50 ml of buffer C for 15 min on ice, and centrifuged at 14,000 rpm for 20 min at 4° C. Thus, the solubilized 0.19 and soluble CM3 were bound to Flag-M2 agarose (Sigma-Aldrich) pre-equilibrated with buffer C by gentle shaking for 3 h at 4° C., washed three times with buffer C, and further washed three times with buffer D (Buffer C without detergents). Bound ATIs were eluted with TBS [pH 7.4] containing Flag peptide (Sigma-Aldrich). In order to rigorously exclude endotoxin, eluted CM3 and 0.19 were also applied to an entotoxin removal column (Norgen Biotek corp., Thorold, ON, Canada). ATIs were the used at 5 μg/ml to stimulate HEK-293 cells stably transfected with the TLR4-CD14-MD2 complex, and IL-8 secretion was quantified after 24 h using the IL-8 ELISA as described above.
(132) Downstream Signaling Pathways Induced by CM3 and 0.19 Overexpression
(133) HEK-293 cells stably expressing TLR4-CD14-MD2 were induced to express CM3 or 0.19, respectively, followed by cell lysis in buffer C. Lysates were cleared by centrifugation at 14,000 rpm for 20 min at 4° C., and 50 μg of protein run on a 15% SDS-gel and subjected to Western blotting to analyze activation of the canonical and the alternative (p-IRF3) pathways using antibodies to phosphorylated and unphosphorylated (p-NF-κB/p65) and IRF3 (all from Cell Signaling Technology, Danvers, MA).
Other Embodiments
(134) Various modifications and variations of the described methods and compositions of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific desired embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention that are obvious to those skilled in the fields of medicine, immunology, pharmacology, endocrinology, or related fields are intended to be within the scope of the invention.
(135) All publications mentioned in this specification are herein incorporated by reference to the same extent as if each independent publication was specifically and individually incorporated by reference.