Synthetic biology tools
11810646 · 2023-11-07
Assignee
Inventors
- Chunbo Lou (San Francisco, CA, US)
- Tae Seok Moon (San Francisco, CA, US)
- Virgil Rhodius (El Sobrante, CA, US)
- Brynne Stanton (San Francisco, CA, US)
- Alvin Tasmir (San Francisco, CA, US)
- Karsten Temme (San Francisco, CA, US)
- Chris Voigt (San Francisco, CA, US)
Cpc classification
C12N15/79
CHEMISTRY; METALLURGY
G16B35/00
PHYSICS
C12N15/70
CHEMISTRY; METALLURGY
C12N15/635
CHEMISTRY; METALLURGY
C12N15/63
CHEMISTRY; METALLURGY
G16B20/00
PHYSICS
International classification
C12N5/00
CHEMISTRY; METALLURGY
C12N15/63
CHEMISTRY; METALLURGY
C12N15/70
CHEMISTRY; METALLURGY
C12N15/79
CHEMISTRY; METALLURGY
G16B20/00
PHYSICS
G16B30/00
PHYSICS
G16B35/00
PHYSICS
Abstract
Methods for design of genetic circuits are provided.
Claims
1. A host cell comprising a heterologous genetic circuit comprising at least two orthogonal sequence-specific DNA binding polypeptides, wherein the genetic circuit is a combination of logic gates, wherein the logic gates are combined by having a connection promoter that is an output promoter of an upstream gate and an input promoter of a downstream gate, wherein a stem loop ribozyme spacer sequence is included after the connection promoter, and wherein the stem loop ribozyme spacer sequence comprises any one of SEQ ID NOS:209-218.
2. The host cell of claim 1, wherein the logic gates are selected from the group consisting of AND, NAND, NOR, OR, NOT, XOR, EQUALS, AND IMPLIES, and ANDN gates.
3. The host cell of claim 2, wherein the NOR gates comprise a transcriptional repressor and a transcriptional repressor target DNA sequence.
4. The host cell of claim 1, wherein the at least two orthogonal sequence-specific DNA binding polypeptides are selected from the group consisting of transcription factors, transcriptional activators, RNA polymerases, and transcriptional repressors.
5. The host cell of claim 4, wherein the transcriptional repressors are at least 70% identical to the Tetracycline repressor (TetR).
6. The host cell of claim 1, wherein the sequence-specific DNA binding polypeptides are sigma factors.
7. The host cell of claim 1, wherein the host cell is a prokaryotic cell.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
DETAILED DESCRIPTION
(33) I. Introduction
(34) Engineering synthetic gene circuits requires a library of “parts” that serve to regulate gene expression and can be reliably combined together to build complex programs. Transcriptional regulatory elements (e.g. promoters) are a “part” that control gene expression by regulating the rate of mRNA production. Large genetic circuits can require many promoters that can be individually controlled. This enables conditional control of gene expression across a circuit. A library of orthogonal promoter systems in which regulators target specific promoters with no cross-talk across the circuit is thus useful in design of genetic circuits.
(35) Methods of generating a “toolbox” of genetic components and for subsequent design of genetic circuits are provided. Orthogonal components for use in a genetic circuit can be identified by providing a set of sequence-specific DNA binding polypeptides, identifying their target DNA sequences (i.e., the DNA sequences that the polypeptides bind), and designing a set of orthogonal sequence-specific DNA binding polypeptide-target DNA sequence cognate pairs. Generation of the set of orthogonal sequence-specific DNA binding polypeptide-target DNA sequence cognate pairs provides a “toolbox” from which genetic circuits can then be made by using the cognate pairs to generate a system of Boolean logic gates as desired.
(36) In some embodiments, the methods comprise:
(37) Providing a set of sequence-specific DNA binding polypeptides;
(38) Optimizing expression of the polypeptides in a heterologous host cell (e.g., the host cell species in which the genetic circuit will eventually be employed);
(39) Identifying the full complement of target DNA sequences bound by at least a subset of the sequence-specific DNA binding polypeptides; and
(40) Designing a set of orthogonal sequence-specific DNA binding polypeptide-target DNA sequence cognate pairs (i.e. a set in which each pair regulates only itself and not other members of the set).
(41) Subsequently, the cognate pairs can be selected for use in a genetic circuit. Because the cognate pairs are part of the orthogonal set, the cognate pairs can be used in combinations (e.g., 2, 3, 4, 5, 6, 7, 8, 9, or more cognate pairs) from the orthogonal set without interference from each other. Once designed, the genetic circuit can be deployed in a host cell and further tested for unintended interactions within the circuit and/or with the host cell transcriptional regulatory system.
(42) II. Sequence-Specific DNA Binding Polypeptides
(43) Several classes of sequence-specific DNA binding polypeptides have been described in detail here to exemplify sequence-specific DNA binding polypeptides. However, it should be appreciated that similar technical approaches can be used to design other classes of sequence-specific DNA binding polypeptides for use in the methods described herein.
(44) Sets of sequence-specific DNA binding polypeptides, i.e., a plurality of different sequence-specific DNA binding polypeptides, optionally having sequence similarity or otherwise being of the same class of regulatory factor, can be generated as desired. In some embodiments, one or more pre-selected (e.g., by a third party) set of sequence-specific DNA binding polypeptides is provided. Alternatively, or in combination, in some embodiments, sequence-specific DNA binding polypeptides can be identified from one or more sequence database (e.g., NCBI, etc.). A variety of algorithms are available for identification of sequence-specific DNA binding polypeptides. For example, sequence similarity algorithms (e.g., BLAST and the like) can be used to identify amino acid sequence similarity in a database to a known sequence-specific DNA binding polypeptide. In some embodiments, for example, the algorithm identifies sequence-specific DNA binding polypeptide based on a phylogenetic tree.
(45) Generation of the set of sequence-specific DNA binding polypeptides can include increasing, and in some cases, maximizing the diversity within the set. Said another way, given a finite and possibly limited number of members of a set, the members can be selected to be as different from each other as possible. For example, in some embodiments, a phylogenetic tree is used to maximize diversity between sequence-specific DNA binding polypeptides in a library. In some embodiments, the algorithm identifies sequence-specific DNA binding polypeptide based on their predicted ability to bind to different target DNA sequences.
(46) In some embodiments, the algorithm can predict the ability of a sequence-specific DNA binding polypeptide to bind to different target DNA sequences if expression of the gene encoding the sequence-specific DNA binding polypeptide is autoregulated. For example, most ECF sigmas are autoregulated; i.e. the gene encoding the sigma is regulated by a promoter recognized by the same ECF sigma. ECF sigma factors in the same ECF subgroup recognize the same promoter sequence, since their DNA binding sequences are highly conserved within each group. Consequently, promoters can be identified for each subgroup by searching the upstream regulatory regions for conserved motifs. In one example, the following steps can be performed wholly or partially by a computer system to determine target sequence motifs of autoregulated DNA-binding polypeptides that bind to 2-block motifs:
(47) 1) For each subgroup of a sequence-specific DNA binding polypeptide (i.e., a subgroup for which it is expected all members bind the same conserved target DNA sequence), one can generate a set of upstream regulatory sequences by extracting the DNA sequences upstream of each gene encoding the DNA binding polypeptides (for example, 100, 200, 300, 400, 500, 1000 nt or more upstream of the gene to the gene start) based on the bacterial genomic sequences archived in a database (e.g., NCBI). The generated sequence sets can be stored in memory for subsequent retrieval (e.g., in a database with labels identifying sequences of a respective sequence set).
(48) 2) Search each sequence set for conserved over-represented motifs. For example, a process of the computer system can use an algorithm to search the database of sequence sets. An exemplary algorithm is a 2-block motif finding algorithm (including but not limited to BioProspector (Liu et al 2001: Liu X, Brutlag D L, Liu J S. Pac Symp Biocomput. 2001; 127-38)). This search allows one to search for two conserved sequence blocks separated by a variable length non-conserved spacer region. An exemplary search parameter representing the structure of ECF promoters would be: <block 1><spacer><block 2>, where block 1 is 7 nt in length, block 2 is 5 nt in length, and the spacer length varies from 13-15 nt.
(49) 3) For each sequence set, the highest scoring 2-block motif is selected by the processor to represent the target sequence motifs for that sequence-specific DNA binding polypeptide subgroup. Because the motif sizes can vary slightly between different sequence-specific DNA binding polypeptide subgroups, in some embodiments, optimal motifs are identified by performing multiple searches with slightly different <block 1><spacer><block 2> parameters.
(50) 4) For each sequence-specific DNA binding polypeptide subgroup: A sequence model can be constructed by the processor based on the highest scoring 2-block model. An exemplary model for ECF sigma promoters would be where block 1 represents the promoter −35 region; block 2 represents the promoter −10 region; the variable spacer length is used to construct a histogram of spacer lengths.
(51) 5) The sequence model can then be used by the processor to generate a Position Weight Matrix (PWM)-based scoring model to identify and score new sequences. An exemplary scoring model for ECF sigma promoters would be separate PWMs constructed based on the aligned −35 and −10 motifs and a spacer penalty termed for suboptimal spacer lengths based on the spacer histograms.
(52) The above steps can be varied or adapted as necessary for the particular type of sequence-specific DNA binding polypeptide examined.
(53) In addition to use of native or randomly mutated sequence-specific DNA binding polypeptides, it should also be appreciated that the sequence-specific DNA binding polypeptide can be modified to increase recruitment of RNA polymerase to DNA bound by the sequence-specific DNA-binding polypeptide. As an example, one can modify the sequence-specific DNA binding polypeptides by addition of a transcription factor domain known to recruit RNA polymerase. For example, the C-terminal amino acid sequence of the VP16 transcription factor can be linked to the sequence-specific DNA binding polypeptide.
(54) A. Transcriptional Activators
(55) i. General
(56) As noted above, it is believed that any class of transcriptional activators can be adapted for use in the methods described herein.
(57) ii. Sigma Factors
(58) In some embodiments, the sequence-specific DNA binding polypeptide is a sigma (σ) factor. Sigma factors recruit RNA polymerase (RNAP) to specific promoter sequences to initiate transcription. The σ 70 family consist of 4 groups: Group 1 are the housekeeping σs and are essential; groups 2-4 are alternative σs that direct cellular transcription for specialized needs (Gruber and Gross 2003). Group 4 σs (also known as ECF σs; extracytoplasmic function) constitute the largest and most diverse group of σs, and have been classified into 43 subgroups (Staron et al., Mol Microbiol 74(3): 557-81 (2009)). The subgroups can be stored in memory (e.g. a database) of a computer system.
(59) In some embodiments, the set of sequence-specific DNA-binding polypeptides comprise multiple sigma factors. In some embodiments, the set comprises sigma factors from Group 1, Group 2, Group 3, and/or Group 4 Sigma factors. The ECF subgroup of Group 4 is thought to recognize different promoter sequences, making these σs particularly useful for constructing orthogonal σ-promoter systems. However, it will be appreciated that any group of sigma factors can be used according to the methods of the embodiments of the invention to develop cognate pairs. In some embodiments, one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, etc.) or more sigma factor from Table 1 (or substantially identical to a sigma factor in Table 1) is selected for use in an orthogonal set of cognate pairs and/or in a genetic circuit.
(60) TABLE-US-00001 TABLE 1 Group Nr.sup.a ID.sup.b GI.sup.c SPECIES.sup.d CLASS.sup.d PHYLUM.sup.d ECF01 >3473 109899616 Pseudoalteromonas atlantica T6c Gammaproteobacteria Proteobacteria ECF01 >4085 114562024 Shewanella frigidimarina NCIMB 400 Gammaproteobacteria Proteobacteria ECF02 >2817 16130498 Escherichia coli K12 Gammaproteobacteria Proteobacteria ECF02 >915 119774011 Shewanella amazonensis SB2B Gammaproteobacteria Proteobacteria ECF03 >1198 29350055 Bacteroides thetaiotaomicron VPI-5482 Bacteroidetes ECF03 >1244 34541012 Porphyromonas gingivalis W83 Bacteroidetes ECF04 >1609 21673117 Chlorobium tepidum TLS Chlorobi ECF04 >1617 68549683 Pelodictyon phaeoclathratiforme BU-1 Chlorobi ECF05 >965 28868416 Pseudomonas syringae pv. tomato str. DC3000 Gammaproteobacteria Proteobacteria ECF05 >1054 67154316 Azotobacter vinelandii AvOP Gammaproteobacteria Proteobacteria ECF06 >3576 15595669 Pseudomonas aeruginosa PAO1 Gammaproteobacteria Proteobacteria ECF06 >853 26987094 Pseudomonas putida KT2440 Gammaproteobacteria Proteobacteria ECF07 >980 67154823 Azotobacter vinelandii AvOP Gammaproteobacteria Proteobacteria ECF07 >1134 15598606 Pseudomonas aeruginosa PAO1 Gammaproteobacteria Proteobacteria ECF08 >3580 15595872 Pseudomonas aeruginosa PAO1 Gammaproteobacteria Proteobacteria ECF08 >3627 70730114 Pseudomonas fluorescens Pf-5 Gammaproteobacteria Proteobacteria ECF09 >3581 15597622 Pseudomonas aeruginosa PAO1 Gammaproteobacteria Proteobacteria ECF09 >1009 70730971 Pseudomonas fluorescens Pf-5 Gammaproteobacteria Proteobacteria ECF10 >3486 77360766 Pseudoalteromonas haloplanktis TAC125 Gammaproteobacteria Proteobacteria ECF10 >2914 88706154 gamma proteobacterium KT 71 Gammaproteobacteria Proteobacteria ECF11 >3726 28868260 Pseudomonas syringae pv. tomato str. DC3000 Gammaproteobacteria Proteobacteria ECF11 >987 28899132 Vibrio parahaemolyticus RIMD 2210633 Gammaproteobacteria Proteobacteria ECF12 >807 86158800 Anaeromyxobacter dehalogenans 2CP-C Deltaproteobacteria Proteobacteria ECF12 >808 108762328 Myxococcus xanthus DK 1622 Deltaproteobacteria Proteobacteria ECF13 >1146 33152898 Haemophilus ducreyi 35000HP Gammaproteobacteria Proteobacteria ECF13 >1025 37524103 Photorhabdus luminescens subsp. laumondii TTO1 Gammaproteobacteria Proteobacteria ECF14 >3200 15608361 Mycobacterium tuberculosis H37Rv Actinobacteria ECF14 >1324 21223516 Streptomyces coelicolor A3(2) Actinobacteria ECF15 >436 77464848 Rhodobacter sphaeroides 2.4.1 Alphaproteobacteria Proteobacteria ECF15 >524 16127705 Caulobacter crescentus CB15 Alphaproteobacteria Proteobacteria ECF16 >3622 104782321 Pseudomonas entomophila L48 Gammaproteobacteria Proteobacteria ECF16 >973 161378140 Pseudomonas putida KT2440 Gammaproteobacteria Proteobacteria ECF17 >1691 15607875 Mycobacterium tuberculosis H37Rv Actinobacteria ECF17 >1458 21221399 Streptomyces coelicolor A3(2) Actinobacteria ECF18 >4451 21230791 Xanthomonas campestris pv. campestris str. ATCC Gammaproteobacteria Proteobacteria 33913 ECF18 >4438 21242133 Xanthomonas axonopodis pv. citri str. 306 Gammaproteobacteria Proteobacteria ECF19 >3197 15607586 Mycobacterium tuberculosis H37Rv Actinobacteria ECF19 >1315 21219164 Streptomyces coelicolor A3(2) Actinobacteria ECF20 >992 70731405 Pseudomonas fluorescens Pf-5 Gammaproteobacteria Proteobacteria ECF20 >2913 88706222 gamma proteobacterium KT 71 Gammaproteobacteria Proteobacteria ECF21 >1280 29350128 Bacteroides thetaiotaomicron VPI-5482 Bacteroidetes ECF21 >2825 89889680 Flavobacteria bacterium BBFL7 Bacteroidetes ECF22 >4450 21232074 Xanthomonas campestris pv. campestris str. ATCC Gammaproteobacteria Proteobacteria 33913 ECF22 >1147 21243541 Xanthomonas axonopodis pv. citri str. 306 Gammaproteobacteria Proteobacteria ECF23 >231 15895043 Clostridium acetobutylicum ATCC 824 Firmicutes ECF23 >1851 30261806 Bacillus anthracis str. Ames Firmicutes ECF24 >69 16079737 Bacillus subtilis subsp. subtilis str. 168 Firmicutes ECF24 >1034 32470052 Escherichia coli Gammaproteobacteria Proteobacteria ECF25 >1645 170078575 Synechococcus sp. PCC 7002 Cyanobacteria ECF25 >1643 17230772 Nostoc sp. PCC 7120 Cyanobacteria ECF26 >4464 58581966 Xanthomonas oryzae pv. oryzae KACC10331 Gammaproteobacteria Proteobacteria ECF26 >837 77459110 Pseudomonas fluorescens PfO-1 Gammaproteobacteria Proteobacteria ECF27 >4265 21222299 Streptomyces coelicolor A3(2) Actinobacteria ECF27 >1331 31795084 Mycobacterium bovis AF2122/97 Actinobacteria ECF28 >1088 114563849 Shewanella frigidimarina NCIMB 400 Gammaproteobacteria Proteobacteria ECF28 >1040 15641058 Vibrio cholerae O1 biovar eltor str. N16961 Gammaproteobacteria Proteobacteria ECF29 >371 13476734 Mesorhizobium loti MAFF303099 Alphaproteobacteria Proteobacteria ECF29 >2688 71281387 Colwellia osvchrervthraea 34H Gammaproteobacteria Proteobacteria ECF30 >35 16079766 Bacillus subtilis subsp. subtilis str. 168 Firmicutes ECF30 >83 18309341 Clostridium perfringens str. 13 Firmicutes ECF31 >2963 85713274 Idiomarina baltica OS145 Gammaproteobacteria Proteobacteria ECF31 >34 16080921 Bacillus subtilis subsp. subtilis str. 168 Firmicutes ECF32 >1122 4581629 Erwinia amylovora Gammaproteobacteria Proteobacteria ECF32 >3724 28868612 Pseudomonas syringae pv. tomato str. DC3000 Gammaproteobacteria Proteobacteria ECF33 >375 27378153 Bradyrhizobium japonicum USDA 110 Alphaproteobacteria Proteobacteria ECF33 >423 39934888 Rhodopseudomonas palustris CGA009 Alphaproteobacteria Proteobacteria ECF34 >3302 77164965 Nitrosococcus oceani ATCC 19707 Gammaproteobacteria Proteobacteria ECF34 >1384 21218750 Streptomyces coelicolor A3(2) Actinobacteria ECF35 >3582 15598092 Pseudomonas aeruginosa PAO1 Gammaproteobacteria Proteobacteria ECF35 >1119 24375055 Shewanella oneidensis MR-1 Gammaproteobacteria Proteobacteria ECF36 >3196 15609206 Mycobacterium tuberculosis H37Rv Actinobacteria ECF36 >1595 21219385 Streptomyces coelicolor A3(2) Actinobacteria ECF37 >3390 89094252 Oceano spirillum sp. MED92 Gammaproteobacteria Proteobacteria ECF37 >2513 83718468 Burkholderia thailandensis E264 Betaproteobacteria Proteobacteria ECF38 >1322 21222029 Streptomyces coelicolor A3(2) Actinobacteria ECF38 >1442 152967344 Kineococcus radiotolerans SRS30216 Actinobacteria ECF39 >1438 21223369 Streptomyces coelicolor A3(2) Actinobacteria ECF39 >2973 84494624 Janibacter sp. HTCC2649 Actinobacteria ECF40 >3198 15610550 Mycobacterium tuberculosis H37Rv Actinobacteria ECF40 >1380 62389491 Corynebacterium glutamicum ATCC 13032 Actinobacteria ECF41 >491 16127496 Caulobacter crescentus CB15 Alphaproteobacteria Proteobacteria ECF41 >1141 77459658 Pseudomonas fluorescens PfO-1 Gammaproteobacteria Proteobacteria ECF42 >3583 15596548 Pseudomonas aeruginosa PAO1 Gammaproteobacteria Proteobacteria ECF42 >4454 77747962 Xanthomonas campestris pv. campestris str. ATCC Gammaproteobacteria Proteobacteria 33913 ECF43 >4437 21244845 Xanthomonas axonopodis pv. citri str. 306 Gammaproteobacteria Proteobacteria ECF43 >3477 109897287 Pseudoalteromonas atlantica T6c Gammaproteobacteria Proteobacteria
(61) In addition to native sigma factors, chimeric or other variant sigma factors can also be used in the method of the invention. For example, in some embodiments, one or more sigma factor are submitted to mutation to generate library of sigma factor variants and the resulting library can be screen for novel DNA binding activities.
(62) In some embodiments, chimeric sigma factors formed from portions of two or more sigma factors can be used. Accordingly, embodiments of the invention provide for generating a library of polynucleotides encoding chimeric sigma factors, wherein the chimeric sigma factors comprise a domain from at least two different sigma factors, wherein each of the domains bind to the −10 or −35 region of a regulatory element; and expressing chimeric sigma factors from the library of polynucleotides, thereby generating a library of chimeric sigma factors. For example, in some embodiments, chimeric sigma factors are generated comprising a “Region 2” from a first sigma factor and a “Region 4” from a second sigma factor, thereby generating chimeric sigma factors with novel DNA binding activities. “Region 2” of sigma factors is a conserved domain that recognizes −10 regions of promoters. “Region 4” is a conserved domain of sigma factors that recognizes −35 regions of promoters. It will be appreciated that chimeric sigma factors can be generated from any two native sigma factors that bind different target DNA sequences (e.g., different promoter sequences). As noted in the Examples, it has been found that chimeric sigma factors formed from the ECF2 and ECF11 subgroups have unique DNA binding activities useful for generating orthogonal sets as described herein. Exemplary chimeric sigma factors include, but are not limited to, ECF11_ECF02 (containing amino acids 1-106 from ECF02_2817 and 122-202 from ECF11_3726) and ECF02_ECF11 (containing amino acids 1-121 from ECF11_3726 and 107-191 from ECF02_2817).
(63) The ECF11_ECF02 amino acid sequence (SEQ ID NO:97) is as follows:
(64) TABLE-US-00002 1 MRITASLRTFCHLSTPHSDSTTSRLWIDEVTAVARQRDRDSFMRIYDHFAPRLLRYLTGL 61 NVPEGQAEELVQEVLLKLWHKAESFDPSKASLGTWLFRIARNLYIDSVRKDRGWVQVQNS 121 LEQLERLEAISNPENLMLSEELRQIVERTIESLPEDLRMAITLRELDGLSYEEIAAIMDC 181 PVGTVRSRIFRAREAIDNKVQPLIRR*
(65) The ECF02_ECF11 amino acid sequence (SEQ ID NO:98) is as follows:
(66) TABLE-US-00003 1 MSEQLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAFIKAYRA 61 LDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRPPSSDVDAIEAENFEQLERLEAPVDRTL 121 DYSQRQEQQLNSAIQNLPTDQAKVLRMSYFEALSHREISERLDMPLGTVKSCLRLAFQKL 181 RSRIEES*
(67) iii. RNA Polymerases
(68) In some embodiments, the set of sequence-specific DNA-binding polypeptides comprise polypeptides having DNA binding activity and that are a variant of the T7 RNA polymerase (RNAP). The T7 RNAP amino acid sequence (SEQ ID NO:99) is as follows:
(69) TABLE-US-00004 1 mntiniaknd fsdielaaip fntladhyge rlareqlale hesyemgear frkmferqlk 61 agevadnaaa kplittllpk miarindwfe evkakrgkrp tafgflgeik peavayitik 121 ttlacltsad nttvqavasa igraiedear fgrirdleak hfkknveeql nkrvghvykk 181 afmqvveadm lskgllggea wsswhkedsi hvgvrcieml iestgmvslh rqnagvvgqd 241 setielapey aeaiatraga lagispmfqp cvvppkpwtg itgggywang rrplalvrth 301 skkalmryed vympevykai niaqntawki nkkvlavanv itkwkhcpve dipaiereel 361 pmkpedidmn pealtawkra aaavyrkdka rksrrislef mleqankfan hkaiwfpynm 421 dwrgrvyays mfnpqgndmt kglltlakgk pigkegyywl kihgancagv dkvpfperik 481 fieenhenim acaksplent wwaeqdspfc flafcfeyag vqhhglsync slplafdgsc 541 sgiqhfsaml rdevggravn llpsetvgdi ygivakkvne ilqadaingt dnevvtvtde 601 ntgeisekvk lgtkalagqw laygvtrsvt krsvmtlayg skefgfrqqv ledtiqpaid 661 sgkglmftqp nqaagymakl iwesysvtvv aaveamnwlk saakllaaev kdkktgeilr 721 krcavhwvtp dgfpvwqeyk kpiqtrlnlm flggfrlqpt intnkdseid ahkqesgiap 781 nfvhsqdgsh lrktvvwahe kygiesfali hdsfgtipad aanlfkavre tmvdtyescd 841 vladfydqfa dqlhesqldk mpalpakgnl nlrdilesdf afa
(70) The T7 RNAP promoter has also been characterized (see, e.g., Rong et al., Proc. Natl. Acad. Sci. USA vol. 95 no. 2 515-519 (1998) and is well known.
(71) As described in the Examples, methods have been discovered for generating orthogonal pairs of RNAP variants and target promoter variants. In some embodiments, one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, etc.) or more different RNA polymerases substantially identical to T7 RNAP is selected for use in an orthogonal set of cognate pairs and/or in a genetic circuit.
(72) Due to toxicity of expression of native T7 RNAP, a series of mutations and modifications were designed such that a library of RNAP variants could be expressed and tested for activity in cells without excessive toxicity. Accordingly, embodiments of the invention provide for one or more of the following modifications (and thus, for example, an embodiment of the invention provides for host cells comprising expression cassettes, or nucleic acids comprising expression cassettes, wherein the expression cassette encodes a RNAP variant substantially identical to T7 RNAP, wherein the expression cassette comprises one or more of the following):
(73) Expression of the T7 RNAP variant can be expressed from a low copy plasmid. Expression of the RNAP can be controlled by a separately encoded protein from a separate vector, thereby blocking expression of the RNAP until a second vector is added to the cells promoting RNAP expression;
(74) Translational control: a GTG start codon; weak ribosomal binding sites (RBSs), and/or random DNA spacers to insulate RNAP expression can be used;
(75) A molecular tag to promote rapid degradation of the RNAP. For example, an Lon N-terminal tag will result in rapid degradation of the tagged RNAP by the Lon protease system.
(76) A mutated RNAP active site (e.g., within amino acids 625-655 of T7 RNAP). For example, it has been discovered that a mutation of the position corresponding to amino acid 632 (R632) of T7 RNAP can be mutated to reduce the RNAP's activity. In some embodiments, the RNAP contains a mutation corresponding to R632S.
(77) Moreover, a variety of mutant T7 promoters have been discovered that can be used in a genetic circuit. Thus, in some embodiments, an expression cassette comprising a promoter operably linked to a second polynucleotide, wherein the promoter comprises a mutant sequence as set forth in
(78) A number of different stem loop structures that function as terminators for T7 RNAP have been discovered. See,
(79) Also provided are RNAP variants comprising and altered specificity loop (corresponding to positions between 745 and 761. Thus in some embodiments, an RNAP is provided that is identical or substantially identical to T7 RNAP but has a Loop Sequence selected from those in
(80) Also provided are expression cassettes comprising a promoter, which promoter comprises a “Promoter Sequence” selected from
(81) iv. Activators Requiring Chaperones
(82) In some embodiments, the set of sequence-specific DNA-binding polypeptides comprise polypeptides having DNA binding activity and that require a separate chaperone protein to bind the sequence-specific DNA-binding polypeptide for the sequence-specific DNA-binding polypeptide to be active. Exemplary transcriptional activators requiring a chaperone for activity include, but are not limited to activator is substantially similar to InvF from Salmonella typhimurium, MxiE from Shigella flexneri, and ExsA from Pseudomonas aeruginosa. These listed activators require binding of SicA from Salmonella typhimurium, IpgC from Shigella flexneri, or ExsC from Pseudomonas aeruginosa, respectively, for activation.
(83) Sequence information for the above components are provides as follows:
(84) TABLE-US-00005 DNA sequence encoding the named polypeptide Name Type (SEQ ID NO:) Optional Mutation sicA Gene Atggattatcaaaataatgtcagcgaagaacgtgttgcggaaa tgatttgggatgccgttagtgaaggcgccacgctaaaagacgt tcatgggatccctcaagatatgatggacggtttatatgctcat gcttatgagttttataaccagggacgactggatgaagctgaga cgttctttcgtttcttatgcatttatgatttttacaatcccga ttacaccatgggactggcggcagtatgccaactgaaaaaacaa tttcagaaagcatgtgacctttatgcagtagcgtttacgttac ttaaaaatgattatcgccccgttttttttaccgggcagtgtca attattaatgcgtaaggcagcaaaagccagacagtgttttgaa cttgtcaatgaacgtactgaagatgagtctctgcgggcaaaag cgttggtctatctggaggcgctaaaaacggcggagacagagca gcacagtgaacaagaaaaggaataa (100) sicA* Mutant sicA Atggattatcaaaataatgtcagcgaagaacgtgttgcggaaa The large “t” of the sicA tgatttgggatgccgttagtgaaggcgccacgctaaaagacgt sequence above was mutated to tcatgggatccctcaagatatgatggacggtttatatgctcat “a” by error-prone PCR. This gcttatgagttttataaccagggacgactggatgaagctgaga mutation was made to reduce cgttctttcttacttatgcatttatgatttttacaatcccgat cross talk between SicA and tacaccatgggactggcggcagtatgccaactgaaaaaacaat MxiE. ttcagaaagcatgtgacctttatgcagtagcgtttacgttact taaaaatgattatcgccccgttttttttaccgggcagtgtcaa ttattaatgcgtaaggcagcaaaagccagacagtgttttgaac ttgtcaatgaacgtactgaagatgagtctctgcgggcaaaagc gttggtctatctggaggcgctaaaaacggcggagacagagcag cacagtgaacaagaaaaggaataa (101) invF Gene with Atgctaaatacgcaggaagtacttaaagaaggagagaagcgga The accepted start codon new start aaatccgcagcccggaagcatggtttatacagacgtgttccgc (the large “atg”) was codon gcaaaagctgcatatgtcattttctgaaagccgacacaatgaa determined to be incorrect and aattgcctgattcaggaaggcgcgctgcttttttgcgagcagg a correct upstream start ccgttgtcgcaccagtatcaggagacctggtttttcgaccgtt codon was found. aaaaattgaagtactcagcaaattactggcatttatcgatggc gcaggattagtggacacgacatatgctgaatccgataaatggg ttttgctgagtcctgagtttcgcgctatttggcaagatcgtaa acgctgcgagtactggtttttgcagcaaattattacgccttct ccggccttcaataaggtactggcgctgttacgaaaaagcgaga gttactggttggttggctatttactcgctcagtcaaccagcgg caacacgatgagaatgctgggagaagactatggcgtttcttat acccattttcgtcgtttgtgcagcagagcgttgggcggaaaag cgaagagtgaattacgaaactggcgtatggcgcaatcgctgct gaatagtgtagaaggccacgagaacatcacccaattagccgtt aatcatggttactcatcgccttcacatttttctagtgagatca aagagctgatcggcgtttcgccgcggaaattatcaaatattat tcaattggcagacaaatga (102) psicA Promoter Ccacaagaaacgaggtacggcattgagccgcgtaaggcagtag cgatgtattcattgggcgttttttgaatgttcactaaccaccg tcggggtttaataactgcatcagataaacgcagtcgttaagtt ctacaaagtcggtgacagataacaggagtaagta (103) ipgC Gene Atgtctttaaatatcaccgaaaatgaaagcatctctactgcag taattgatgcaattaactctggcgctacactgaaagatattaa tgcaattcctgatgatatgatggatgacatttattcatatgct tatgacttttacaacaaaggaagaatagaggaagctgaagttt tcttcaggtttttatgtatatacgacttttacaatgtagacta cattatgggactcgcagctatttatcagataaaagaacagttc caacaagcagcagacctttatgctgtcgcttttgcattaggaa aaaatgactatacaccagtattccatactggacaatgtcagct tcggttgaaagcccccttaaaagctaaagagtgcttcgaactc gtaattcaacacagcaatgatgaaaaattaaaaataaaagcac aatcatacttggacgcaattcaggatatcaaggagtaa (104) mxiE Gene with atgagtaaatataaaggcctgaacaccagcaacatgttctaca The wide type gene has codon tctacagctctggtcatgaaccggtgaacgttgaactggtgaa “ttttttttt” in this enlarged optimization agataaagaacgtaacatcatcgaactggcaccggcgtggaaa sequence region. One more “t” ggctttttctttgtgcgtaaccagaacatcaaattcagcgata was added to make “tttttttttt” acgttaactaccactaccgcttcaacatcaactcttgcgcaaa and then the entire gene was attcctggcgttttgggattattttagcggcgccctggttgaa codon optimized by GenScript. cattctcacgcagaaaaatgcatccatttctaccacgaaaacg The additional “t” was added atctgcgtgatagctgtaatacggaatctatgctggataaact to make this ORF in-frame. gatgctgcgcttcatttttagtagcgatcagaacgtgtctaat In addition, the wide-type gccctggcaatgatccgtatgaccgaaagttatcatctggttc gene starts with “g” and this tgtacctgctgcgtacgattgaaaaagaaaaagaagtgcgcat synthetic gene starts with caaaagcctgaccgaacactatggcgtttctgaagcgtacttt “a.” cgtagtctgtgtcgcaaagcgctgggtgccaaagtgaaagaac agctgaacacgtggcgcctggtgaatggcctgctggatgtttt cctgcataaccagaccattacgagcgcggccatgaacaatggt tatgcgtctaccagtcacttcagcaatgaaattaaaacgcgtc tgggctttagtgcccgcgaactgagcaacatcaccttcctggt gaagaaaattaatgaaaaaatctaa (105) pipaH9.8 Promoter gcgaaaatgacatcaaaaacgccattaacctgatgttctgggg aatataaatgtcaggctagggtcaaaaatcgtggcggttgaca aaatggctgcgttacgtcattgagcatatccaggactggccgg caaaccgggtacgcgatctgttgccttggaaagttgatctgac ctctcagtaaatatcaatacggttctgacgagccgcttaccgt tcaaatatgaagtacgatgtttaactaaccgaaaaacaagaac aatacggtgcaaacaggccattcacggttaactgaaacagtat cgtttttttacagccaattttgtttatccttatataataaaaa atgct (106) pipaH9.8* Promoter gcgaaaatgacatcaaaaacgccattaacctgatgttctgggg The enlarged “ta” above of with aatataaatgtcaggctagggtcaaaaatcgtggcgttgacaa pipaH9.8 was mutated to “ag” mutation aatggctgcgttacgtcattgagcatatccaggactggccggc by saturation mutagenesis. aaaccgggtacgcgatctgttgccttggaaagttgatctgacc This mutation was made to tctcagtaaatatcaatacggttctgacgagccgctaccgttc reduce leaky expression of aaatatgaagtacgatgtttaactaaccgaaaaacaagaacaa pipaH9.8. tacggtgcaaacaggccattcacggttaactgaaacagtatcg tttttttacagccaattttgtttatccttattaagataaaaaa gtgct (107) exsC Gene atggatttaacgagcaaggtcaaccgactgcttgccgagttcg caggccgtatcggtttgccttccctgtccctcgacgaggaggg catggcgagcctcctgttcgacgaacaggtgggcgtcaccctg ttgctgctcgccgagcgcgagcgtctgttgctggaggccgatg tggcgggcatcgatgtgctgggcgaggggatctttcgccagct cgccagcttcaaccgccattggcaccgtttcgatctgcatttc ggcttcgacgagctgaccggcaaggtccagttgtatgcgcaga ttctcgcagcgcaactgaccctcgaatgcttcgaggcgacctt ggccaatctgctcgatcacgccgagttctggcagcgcctgctg ccgtgcgacagtgatcgcgaggcggtcgctgcggtcggcatga gggtttga (108) exsD Gene atggagcaggaagacgataagcagtactcccgagaagcggtgt tcgctggcaggcgggtatccgtggtgggctcggacgcccgctc gcggggtcgggtgccgggttacgcatcgagcagtttgtatcgt gagtccggaatcatcagtgcgcggcaactggcgttgctgcagc ggatgctgccgcgcctgcggctggagcaactgttccgctgcga gtggttgcagcagcgcctggcgcgcggcctggcgctggggcgc gaagaggtgcggcagattctcctctgcgcggcgcaggacgacg acggctggtgctccgaactgggcgaccgggtcaacctcgccgt gccgcagtcgatgatcgactgggtcctgctgccggtctatggc tggtgggaaagcctgctcgaccaggcgatccccggctggcgcc tgtcgctggtggagctggagacccagtcccggcaactgcgagt caagtccgaattctggtcccgcgtggccgagctggagccggag caggcccgcgaggaactggccagggtcgccaagtgccaggcgc gcacccaggaacaggtggccgaactggccggcaagctggagac ggcttcggcactggcgaagagcgcctggccgaactggcagcgg ggcatggcgacgctgctcgccagcggcgggctggccggcttcg agccgatccccgaggtcctcgaatgcctctggcaacctctctg ccggctggacgacgacgtcggcgcggcggacgccgtccaggcc tggctgcacgaacgcaacctgtgccaggcacaggatcacttct actggcagagctga (109) exsA Gene atgcaaggagccaaatctcttggccgaaagcagataacgtctt gtcattggaacattccaactttcgaatacagggtaaacaagga agagggcgtatatgttctgctcgagggcgaactgaccgtccag gacatcgattccactttttgcctggcgcctggcgagttgcttt tcgtccgccgcggaagctatgtcgtaagtaccaagggaaagga cagccgaatactctggattccattatctgcccagtttctacaa ggcttcgtccagcgcttcggcgcgctgttgagtgaagtcgagc gttgcgacgagcccgtgccgggcatcatcgcgttcgctgccac gcctctgctggccggttgcgtcaaggggttgaaggaattgctt gtgcatgagcatccgccgatgctcgcctgcctgaagatcgagg agttgctgatgctcttcgcgttcagtccgcaggggccgctgct gatgtcggtcctgcggcaactgagcaaccggcatgtcgagcgt ctgcagctattcatggagaagcactacctcaacgagtggaagc tgtccgacttctcccgcgagttcggcatggggctgaccacctt caaggagctgttcggcagtgtctatggggtttcgccgcgcgcc tggatcagcgagcggagaatcctctatgcccatcagttgctgc tcaacagcgacatgagcatcgtcgacatcgccatggaggcggg cttttccagtcagtcctatttcacccagagctatcgccgccgt ttcggctgcacgccgagccgctcgcggcaggggaaggacgaat gccgggctaaaaataactga (110) pexsD Promoter gaaggacgaatgccgggctaaaaataactgacgttttttgaaa gcccggtagcggctgcatgagtagaatcggcccaaat (111) pexsC Promoter gatgtggcttttttcttaaaagaaaagtctctcagtgacaaaa gcgatgcatagcccggtgctagcatgcgctgagcttt (112) rfp Gene atggcttcctccgaagacgttatcaaagagttcatgcgtttca aagttcgtatggaaggttccgttaacggtcacgagttcgaaat cgaaggtgaaggtgaaggtcgtccgtacgaaggtacgcagacc gctaaactgaaagttaccaaaggtggtccgctgccgttcgctt gggacatcctgtccccgcagttccagtacggttccaaagctta cgttaaacacccggctgacatcccggactacctgaaactgtcc ttcccggaaggtttcaaatgggaacgtgttatgaacttcgaag acggtggtgttgttaccgttacccaggactcctccctgcaaga cggtgagttcatctacaaagttaaactgcgtggtactaacttc ccgtccgacggtccggttatgcagaaaaaaaccatgggttggg aagcttccaccgaacgtatgtacccggaagacggtgctctgaa aggtgaaatcaaaatgcgtctgaaactgaaagacggtggtcac tacgacgctgaagttaaaaccacctacatggctaaaaaaccgg ttcagctgccgggtgcttacaaaaccgacatcaaactggacat cacctcccacaacgaagactacaccatcgttgaacagtacgaa cgtgctgaaggtcgtcactccaccggtgctgcagcaaacgacg aaaactacgcttaa (113)
(85) In some embodiments, one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, etc.) or more transcriptional activators requiring chaperones (e.g., those substantially identical to a transcriptional activator listed above), as well as its corresponding chaperone is selected for use in an orthogonal set of cognate pairs and/or in a genetic circuit.
(86) B. Transcriptional Repressors
(87) i. General
(88) It is believed that any class of transcriptional repressors can be adapted for use in the methods described herein.
(89) ii. Tet Repressors
(90) In some embodiments, the set of sequence-specific DNA-binding polypeptides comprise polypeptides having DNA binding activity and that are a variant of the Tet Repressor (TetR). The Tet R protein and operator sequences are provided in, e.g., Postle et al., Nucl. Acid Res. 12:4849-4863 (1984); Hillen et al., Ann. Rev. Microbiol. 48:345-369 (1994); Wissmann et al., J Mol. Biol. 202:397-406 (1988)). A wide variety of organisms have repressor proteins with homology to Tet.sup.R that bind target DNA sequences other than the classical Tet operator. Thus, a diversity of Tet.sup.R homologs are available to generate a set of polypeptides that are substantially identical to Tet.sup.R. As demonstrated in the Examples, Tet.sup.R homologs can be identified in metagenomic gene searches and then tested to determine their target DNA sequence(s) (as further discussed below). Table 2 provides a selected (non-limiting) list of potential Tet.sup.R homologs. Table 3 provides a list target DNA sequences (labeled in the table as “operators”) to which the listed Tet.sup.R homologs bind.
(91) TABLE-US-00006 TABLE 2 Repressor SwissProt ID Organism AcrR P0ACT0 Escherichia coli AmeR Q9F8V9 Agrobacterium tumefaciens AmrR Q9RG61 Pseudomonas aeruginosa AmtR Q9S3L4 Corynebacterium glutamicum ArpA Q54189 Streptomyces griseus ArpR Q9KJC4 Pseudomonas putida BarA Q9LBV6 Streptomyces virginiae BarB O24739 Streptomyces virginiae BetI P17446 Escherichia coli BM1P1 O68276 Bacillus megaterium BM3R1 P43506 Bacillus megaterium BpeR Q6VV70 Burkholderia pseudomallel ButR Q9AJ68 Streptomyces cinnamonensis CalR1 Q8KNI9 Micromonospora echinospora CampR Q93TU7 Rhodococcus erythropolis CasR Q9F6W0 Rhizobium etli CprB O66129 Micrococus luteus CymR O33453 Psudomonas putida Cyp106 Q59213 Bacillus megaterium DhaR Q9RAJ1 Mycobacterium sp. GP1 Ef0113 Q8KU49 Enterococcus faecalis EnvR P0ACT2 Escherichia coli EthR P96222 Mycobacterium tubercolosis FarA O24741 Streptomyces lavendulae HapR O30343 Vibrio cholerae HemR P72185 Propionibacterium freudenreichii HlyIIR Q63B57 Bacillus cereus IcaR Q9RQQ0 Staphylococcus aureus IcaR Q8GLC6 Staphylococcus epidermidis IfeR O68442 Agrobacterium tumefaciens JadR2 Q56153 Streptomyces venezuelae KstR Q9RA03 Rhodococcus erythropolis LanK Q9ZGB7 Streptomyces cyanogenus LitR Q8KX64 Vibrio fischeri LmrA O34619 Bacillus subtilis LuxT Q9ANS7 Vibrio harveyi McbR Q8NLK1 Corynebacterium glutamicum MmfR Q9JN89 Streptomyces coelicolor MphB Q9ZN97 Escherichia coli MphR Q9EVJ6 Escherichia coli MtrR P39897 Neisseria gonorrhoeae NonG Q9XDF0 Streptomyces griseus OpaR O50285 Vibrio parahaemolyticus Orf2 Q9XDV7 Streptomyces griseus orfL6 Q8VV87 Terrabacter sp. DBF63 PaaR Q9FA56 Azoarcus evanssi PhaD Q9F9Z7 Pseudomonas resinovorans PhlF Q9RF02 Pseudomonas fluorescens PqrA Q9F147 Streptomyces coelicolor PsbI Q9XDW2 Rhodopseudomonas palustris PsrA Q9EX90 Pseudomonas putida Q9ZF45 Q9ZF45 Lactococcus lactis QacR P0A0N4 Staphylococcus aureus RmrR Q9KIH5 Rhizobium etli ScbR O86852 Streptomyces coelicolor SmcR Q9L8G8 Vibrio vulnificus SmeT Q8KLP4 Stenotropomonas maltophilia SrpR Q9R9T9 Pseudomonas putida TarA Q9RPK9 Streptomyces tendae TcmR P39885 Streptomyces glaucescens ThlR O85706 Clostridium acetobutylicum TtgR Q9AIU0 Pseudomonas putida TtgW Q93PU7 Pseudomonas putida TylP Q9XCC7 Streptomyces fradiae TylQ Q9ZHP8 Streptomyces fradiae UidR P0ACT6 Escherichia coli UrdK Q9RP98 Streptomyces fradiae Tu2717 VanT Q8VQC6 Vibrio anguillarum VarR Q9AJL5 Streptomyces virginiae YdeS P96676 Bacillus subtilis YDH1 P22645 Xanthobacter autotrophicus YixD P32398 Bacillus subtilis YjdC P0ACU7 Escherichia coli
(92) TABLE-US-00007 TABLE 3 Repressor Operator sequence (SEQ ID NO:) Length McbR TGAACAGCTTGGTCTA (114) 16 UidR CTATTGGTTAACCAATTT (115) 18 BM3R1 CGGAATGAACGTTCATTCCG (116) 20 AmtR ATTATCTATAGATCGATAGAAA (117) 22 BetI TTATATTGAACGTCCAATGAAT (118) 22 HapR TTATTGATTTTTAATCAAATAA (119) 22 HlyIIR TTTAAACAAGAATTTTAAATAT (120) 22 SmcR TTATTGATAAATCTGCGTAAAA (121) 22 AcrR TACATACATTTATGAATGTATGTA (122) 24 ArpA CGACATACGGGACGCCCCGTTTAT (123) 24 LmrA AGATAATAGACCAGTCACTATATT (124) 24 BarA AGATACATACCAACCGGTTCTTTTGA (125) 26 QacR CTTATAGACCGATCGCACGGTCTATA (126) 26 TylP ATACAAACCGCGTCAGCGGTTTGTAA (127) 26 MtrR TTTTTATCCGTGCAATCGTGTATGTAT (128) 27 FarA GATACGAACGGGACGGACGGTTTGCAGC (129) 28 IcaR Se ACAACCTAACTAACGAAAGGTAGGTGAA (130) 28 SchR GAAAAAAAACCGCTCTAGTCTGTATCTTA (131) 29 PhIF ATGATACGAAACGTACCGTATCGTTAAGGT (132) 30 SmeT GTTTACAAACAAACAAGCATGTATGTATAT (133) 30 MphR GAATATAACCGACGTGACTGTTACATTTAGG (134) 31 LuxT TTCGGTTTACTTTGTTTAGAATACCCACGTCT (135) 32 PsrA AGCAGGGCTGAAACGTATGTTTCAAACACCTGTTTCTG (136) 38 ItgR CAGCAGTATTTACAAACAACCATGAATGTAAGTATATTCC (137) 40 VarR CACTTGTACATCGTATAACTCTCATATACGTTGTAGAACAG (138) 41 EthR GTGTCGATAGTGTCGACATCTCGTTGACGGCCTCGACATTACG 55 TTGATAGCGTGG (139)
(93) In some embodiments, one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, etc.) or more repressors from Table 2 (or substantially identical to a repressor in Table 2) is selected for use in an orthogonal set of cognate pairs and/or in a genetic circuit.
(94) iii. Tal Effectors
(95) In some embodiments, the set of sequence-specific DNA-binding polypeptides comprise Tal effectors. The plant pathogenic bacteria of the genus Xanthomonas are known to cause many diseases in important crop plants. Pathogenicity of Xanthomonas depends on a conserved type III secretion (T3S) system which injects more than 25 different effector proteins into the plant cell. Among these injected proteins are transcription activator-like (TAL) effectors which mimic plant transcriptional activators and manipulate the plant transcript (see Kay et al (2007) Science 318:648-651). These proteins contain a DNA binding domain and a transcriptional activation domain. One of the most well characterized TAL-effectors is AvrBs3 from Xanthomonas campestgris pv. vesicatoria (see Bonas et al (1989) Mol Gen Genet 218: 127-136 and WO2010079430). TAL-effectors contain a centralized domain of tandem repeats, each repeat containing approximately 34 amino acids, which control the DNA binding specificity of these proteins. In addition, they contain a nuclear localization sequence and an acidic transcriptional activation domain (for a review see Schomack S, et al (2006) J Plant Physiol 163(3): 256-272).
(96) Specificity of TAL effectors depends on the sequences found in the tandem repeats. The repeated sequence comprises approximately 102 bp and the repeats are typically 91-100% homologous with each other. Polymorphism of the repeats is usually located at positions 12 and 13 and there appears to be a one-to-one correspondence between the identity of the hypervariable diresidues at positions 12 and 13 with the identity of the contiguous nucleotides in the TAL-effector's target sequence (see Moscou and Bogdanove, (2009) Science 326:1501 and Boch et al (2009) Science 326:1509-1512). Experimentally, the code for DNA recognition of these TAL-effectors has been determined such that an HD sequence at positions 12 and 13 leads to a binding to cytosine (C), NG binds to T, NI to A, C, G or T, NN binds to A or G, and IG binds to T. These DNA binding repeats have been assembled into proteins with new combinations and numbers of repeats, to make artificial transcription factors that are able to interact with new sequences and activate the expression of a reporter gene in plant cells (Boch et al (2009) Science 326:1509-1512d). Accordingly, the set of sequence-specific DNA-binding polypeptides can comprise native or non-natural Tal effectors.
(97) In some embodiments, one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, etc.) or more Tal effectors is selected for use in an orthogonal set of cognate pairs and/or in a genetic circuit.
(98) iv. Zinc Fingers
(99) In some embodiments, the set of sequence-specific DNA-binding polypeptides comprise zinc finger DNA binding domains. Zinc finger binding domains can be engineered to recognize and bind to any nucleic acid sequence of choice. See, for example, Beerli et al. (2002) Nat. Biotechnol. 20:135-141; Pabo et al. (2001) Ann. Rev. Biochem. 70:313-340; Isalan et al. (2001) Nat. Biotechnol. 19:656-660; Segal et al. (2001) Curr. Opin. Biotechnol. 12:632-637; Choo et al. (2000) Curr. Opin. Struct. Biol. 10:411-416; Zhang et al. (2000) J. Biol. Chem. 275(43):33850-33860; Doyon et al. (2008) Nat. Biotechnol. 26:702-708; and Santiago et al. (2008) Proc. Natl. Acad. Sci. USA 105:5809-5814. An engineered zinc finger binding domain can have a novel binding specificity compared to a naturally-occurring zinc finger protein. Engineering methods include, but are not limited to, rational design and various types of selection. Rational design includes, for example, using databases comprising doublet, triplet, and/or quadruplet nucleotide sequences and individual zinc finger amino acid sequences, in which each doublet, triplet or quadruplet nucleotide sequence is associated with one or more amino acid sequences of zinc fingers which bind the particular triplet or quadruplet sequence. See, for example, U.S. Pat. Nos. 6,453,242 and 6,534,261. Alternative methods, such as rational design using a nondegenerate recognition code table may also be used to design a zinc finger binding domain to target a specific sequence (Sera et al. (2002) Biochemistry 41:7074-7081). Publically available web-based tools for identifying potential target sites in DNA sequences and designing zinc finger binding domains may be found at http://www.zincfingertools.org and http://bindr.gdcb.iastate.edu/ZiFiT/, respectively (Mandell et al. (2006) Nuc. Acid Res. 34:W516-W523; Sander et al. (2007) Nuc. Acid Res. 35:W599-W605).
(100) A zinc finger DNA binding domain may be designed to recognize a DNA sequence ranging from about 3 nucleotides to about 21 nucleotides in length, or from about 8 to about 19 nucleotides in length. In some embodiments, the zinc finger binding domains comprise at least three zinc finger recognition regions (i.e., zinc fingers). In one embodiment, the zinc finger binding domain may comprise four zinc finger recognition regions. In another embodiment, the zinc finger binding domain may comprise five zinc finger recognition regions. In still another embodiment, the zinc finger binding domain may comprise six zinc finger recognition regions. A zinc finger binding domain may be designed to bind to any suitable target DNA sequence. See for example, U.S. Pat. Nos. 6,607,882; 6,534,261 and 6,453,242.
(101) Exemplary methods of selecting a zinc finger recognition region may include phage display and two-hybrid systems, and are disclosed in U.S. Pat. Nos. 5,789,538; 5,925,523; 6,007,988; 6,013,453; 6,410,248; 6,140,466; 6,200,759; and 6,242,568; as well as WO 98/37186; WO 98/53057; WO 00/27878; WO 01/88197 and GB 2,338,237. In addition, enhancement of binding specificity for zinc finger binding domains has been described, for example, in WO 02/077227.
(102) Zinc finger recognition regions and/or multi-fingered zinc finger proteins may be linked together using suitable linker sequences, including for example, linkers of five or more amino acids in length. See, U.S. Pat. Nos. 6,479,626; 6,903,185; and 7,153,949, for non-limiting examples of linker sequences of six or more amino acids in length. The zinc finger binding domains described herein may include a combination of suitable linkers between the individual zinc fingers of the protein.
(103) In some embodiments, one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, etc.) or more zinc fingers is selected for use in an orthogonal set of cognate pairs and/or in a genetic circuit.
(104) III. Optimizing Expression of Sequence-Specific DNA Binding Polypeptides
(105) Once a set of sequence-specific DNA binding polypeptides have been identified, in some embodiments, expression of the polypeptides is optimized for expression in a heterologous host cell. Optimization will generally include a determination of polynucleotides encoding the polypeptides in the set (and ideally no additional promoter or terminator sequences) and then alteration of the polynucleotide for expression in the host cell.
(106) Optimizing involves alteration of one or more codon in the coding sequence. The codon changes can result in codon optimization for the host cell, i.e., the cell in which the polynucleotide is to be expressed for testing and/or for expressing as part of a genetic circuit. Methods of codon optimization are known (e.g., Sivaraman et al., Nucleic Acids Res. 36:e16 (2008); Mirzahoseini, et al., Cell Journal (Yakhteh) 12(4):453 Winter 2011; U.S. Pat. No. 6,114,148) and can include reference to commonly used codons for a particular host cell. In some embodiments, one or more codon is randomized, i.e., a native codon is replaced with a random codon encoding the same amino acid. This latter approach can help to remove any cis-acting sequences involved in the native regulation of the polypeptide. In some embodiments, an algorithm is used to eliminate transcriptionally functional sequences in a gene encoding the polypeptide. For example, in some embodiments, ribosome binding sites, transcriptional regulatory elements, terminators, or other DNA sequences bound by proteins are removed from the native coding sequence. Notably, the functional sequences removed can be functional in the native species (from which the sequence was originally derived), from the heterologous host cell, or both. In some embodiments, optimizing comprises removal of sequences in the native coding sequence that are functional for other sequence-specific DNA binding polypeptides in the set of sequence-specific DNA binding polypeptides.
(107) In some embodiments, as noted above, optimization will depend on the host cell used. Host cells can be any prokaryotic cell (including but not limited to E. coli) or eukaryotic cell (including but not limited to yeast cells, mammalian cells, avian cells, amphibian cells, plant cells, fish cells, and insect cells).
(108) In some embodiments, expression of the sequence-specific DNA binding polypeptides is optimized for a particular host cell for production of the polypeptide for testing (e.g., identification of target DNA sequences of the polypeptides) and also optimized for expression in a second host cell in which the ultimate genetic circuit will be expressed.
(109) IV. Identification of Target DNA Sequences to which Sequence-Specific DNA Binding Polypeptides Bind
(110) Once a set of sequence-specific DNA binding polypeptides have been provided and expressed, the polypeptides can be tested to identify DNA sequences to which the polypeptides bind (“target DNA sequences”). Identification of target DNA sequences can be performed in vitro or in vivo.
(111) A. In Vitro
(112) In some embodiments, the target DNA sequence(s) for polypeptides are determined in vitro. For example, sequence-specific DNA binding polypeptides can be expressed (e.g., via optimized expression from a host cell), optionally purified as needed, labeled, and contacted to an array of polynucleotides under conditions to allow for sequence-specific binding of the polypeptide to any target polynucleotides present on the array. The location of the label on the array can subsequently to used to determine the identity of the target polynucleotide bound. A variety of different arrays (e.g., comprising 100s, to 1000s, millions, or more polynucleotides) can be used. In some embodiments, microarray technology is used.
(113) As desired, polynucleotides having random sequences, and/or sequences of random length, can be screened for their ability to bind to the sequence-specific DNA binding polypeptides. In some embodiments, the polynucleotides in the array are rationally designed. For example, in some embodiments, the polynucleotides are designed to include a hairpin structure. For example, the hairpin can contain, and thereby display, the target DNA sequence. Hairpins can be designed to have various lengths and sequences. In some embodiments, the hairpins comprise an inverted repeat. For example, the inverted repeats can have 20, 22, 24, 26, 28, 30, 32, 34, 36 or more nucleotides.
(114) In some embodiments, the inverted sequence has a T at position 14, A at position 13, A at position 7, T at position −7, T at position −13, and A at position −14. The positions are counted backwards starting from the axis of symmetry (center of the probe), which begins with the number 1 (or −1, for the adjacent complement).
(115) In some embodiments, the polynucleotides are designed to allow for a sufficient sequence diversity while making a limited number of polynucleotides (e.g., when the number of positions on an array are limited). In some embodiments, the hairpin sequences are designed to have no more than a particular GC content, thereby limiting the possible number of sequences without significantly altering the available diversity. In some embodiments, the GC content of the hairpin is equal or less than 25% 40%, 35%, 30%, 25%, 20% or less.
(116) In some embodiments, an in vitro or in vivo method can be used for identifying target DNA sequences (e.g., operators). For example, in some embodiments, a library of putative transcriptional activator (e.g., sigma factor) binding polynucleotide sequences, which are predicted to bind to a particular transcriptional activator or portions thereof, is constructed. The library can comprise randomized, putative transcriptional activator binding polynucleotide sequences inserted into plasmids without terminator sequences. When contacted with the transcriptional activator and RNA polymerase (e.g., E. coli RNA polymerase), the plasmid is transcribed, thereby creating RNA transcripts complementary to the DNA sequence of the plasmid. Since the plasmids of the library do not have transcriptional terminators, transcription of the plasmids will not end until the RNA polymerase is no longer in contact with the plasmid. In some instances, an increase in quantity of RNA will indicate that the transcriptional activators have successfully bound to transcriptional operators and generated RNA transcripts. In other instances, the absence of an increase in RNA quantity will suggest that the transcriptional activators and RNA polymerase may not have bound to operator sequences to activate transcription. In some embodiments, an in vitro transcription assay is used to determine the level of transcription from the plasmids of the library when in the presence of the sigma factor. In other embodiments, an in vivo transcription assay is used to identify the plasmids in the library constructed with sigma factor target binding polynucleotide sequences. For example, plasmids of the library can be transformed in the host cells expressing sigma factors, chimeric sigma factors, or portions thereof, and then RNA transcripts generated from the plasmid can be quantified. The RNA transcripts from transcription assays can be quantified by methods, including, but not limited to, high-throughput sequencing, RNA-seq, next-generation RNA sequencing, microarray, or quantitative RT-PCR.
(117) B. In Vivo
(118) In some embodiments, the target DNA sequence(s) for polypeptides are determined in vivo. For instance, in vivo methods for identifying target DNA sequences can include generation of synthetic transcriptional regulatory elements comprising potential DNA target sequences operably linked to a reporter gene (thereby forming a reporter expression cassette), and testing such reporter expression cassette in a host cell for transcriptional response to a sequence-specific DNA binding polypeptide expressed in the cell. The particular expression response will depend on whether the sequence-specific DNA binding polypeptide is an activator (in which case increased expression is a positive response) or a repressor (in which case reduced expression is a positive response).
(119) In some embodiments, a synthetic regulatory element library is constructed wherein library members comprise different target DNA sequence(s). The base regulatory element will comprise at least a minimal promoter functional in the host cell and can optionally comprise further cis-acting regulatory elements. The potential target DNA sequence(s) can be position anywhere within the regulatory element useful for testing promoter activity. The position of the potential target DNA sequence will depend, in part, on the particular type of sequence-specific DNA binding polypeptide being tested. In some embodiments, the regulatory element comprises −10 and −35 regions and the potential target DNA sequence binding region is located between the −10 and −35 regions of the regulatory element. In some embodiments, the potential target DNA sequence comprises one or both of the −10 or −35 regions of the regulatory element. In some embodiments, the position of the target DNA sequence in the regulatory element is selected from: at the −10 or −35 region of the regulatory element, in the UP-region of the regulatory element, upstream of the −35 site, between the −10 and −35 sites. between the −10 and transcriptional start site, overlapping the transcriptional start site, and overlapping an activator binding site.
(120) Potential target DNA sequences in the library of regulatory elements can be generated, for example, by design or random mutagenesis.
(121) The regulatory element (e.g., minimal promoter) can be function in a prokaryotic cell, a eukaryotic, or both. Sequences within the regulatory element can be derived from eukaryotic promoters, prokaryotic promoters, or can be synthetic variants of such sequences.
(122) Once the library of regulatory elements has been generated, the library can be screened in host cells to determine whether, and/or to what extent, expression of a sequence-specific DNA binding polypeptide results in activation or repression of transcription from the library expression cassettes. Once library members are identified with the desired activity, the target DNA sequences within the regulatory element can be determined (e.g., by reference to a database of library members, or nucleotide sequencing, etc.).
(123) V. Generation of Synthetic Transcriptional Regulatory Elements
(124) Once target DNA sequence(s) bound by a sequence-specific DNA binding polypeptide are identified, the activity of one or more of the target DNA sequences can be tested to confirm the cognate sequence-specific DNA binding polypeptide binds to the target DNA sequence in the context of the regulatory element and/or regulates expression controlled by the regulatory element. In some embodiments, this activity test will have been completed in the target DNA sequence identification process (see, e.g., the in vivo screening process discussed above). However, even in situations in which target DNA sequences have been found to function in regulatory elements, it may be desirable to modify the position of the DNA sequence in the regulatory element and/or test the DNA sequence in one or more additional regulatory elements.
(125) VI. Design of Cognate Pairs
(126) Embodiments of the invention also provides for generation of sets of cognate sequence-specific DNA binding polypeptide-target DNA sequence pairs for use in a genetic circuit. It will be appreciated that in essentially any initial set of sequence-specific DNA binding polypeptides and their target DNA sequences, there will be “overlap” in target DNA sequences between different polypeptides. Therefore, embodiments of the invention provides for methods of generating a set of cognate orthogonal sequence-specific DNA binding polypeptide-target DNA sequence pairs, i.e., pairs of polypeptides/DNA sequences that do not interact with each other. In view of knowledge (e.g., from empirical data) regarding the DNA binding sequence of each sequence-specific DNA binding polypeptide of interest, one can design a set of cognate pairs.
(127) In some embodiments, the method comprises identifying a set of sequence-specific DNA-binding polypeptides that do not bind to each other's target DNA sequences.
(128) Design of sets of cognate sequence-specific DNA binding polypeptide-target DNA sequence pairs can, in some embodiments, involve maximizing the size of the set of orthogonal sequence-specific DNA binding polypeptide-target DNA sequence pairs. This sort of design can involve, for example, bioinformatic algorithms to maximize the set based on the cognate pairs available. For example, bioinformatic models can be employed that maximize the diversity between target DNA sequences in the set of orthogonal sequence-specific DNA binding polypeptide-target sequence pairs. In some embodiments, sequence entropy, also sometimes known as a “Shannon information entropy,” is used in analysis of target DNA sequences, e.g., when polypeptides bind to more than one target DNA sequence. The more sequences to which a polypeptide binds, the higher the information entropy. This type of analysis provides a quantitative method to measure the percent overlap between the target DNA sequences to which two polypeptides bind. A higher joint information entropy means that there are more sequences to which two polypeptides can bind. In graph theory, the polypeptides are “nodes” and the “edges” are how close they are (e.g., a measured by their different binding sequences). In some embodiments, algorithms, including but not limited to, graph partitioning algorithms, can be used to identify the largest connected network of nodes. In some embodiments, a graph partitioning algorithm, k-means clustering, position weight matrices, hidden markov models, neural networks, or other algorithms are employed. These algorithms maybe performed by a processor executing instructions encoded on a computer-readable storage medium.
(129) Ultimately, a set of orthogonal cognate sequence-specific DNA binding polypeptide-target DNA sequence pairs are provided. The set of orthogonal pairs can then be used as “tools” to generate a genetic circuit as desired.
(130) In some embodiments, control elements adapted for a particular host cell can be used in host cells derived from other species. In other embodiments, some or all of the control elements may not be optimized for use in a second host cell. In such cases, standardized assays as described herein can be used to identify control elements for the second host cell.
(131) VII. Design of Genetic Circuits
(132) Genetic circuits are comprised of an array of logic gates that process one or more input signals, process the input, and generate an output according to a logic design. Generation of logic gates can be generated using expression cassettes that respond to biological inputs, wherein the expression cassettes are regulated using combinations of repressors and activators. A variety of logic gates using such expression cassettes have been described. See, Tamsir et al., Nature, 469(7329): 212-215 (2011). The genetic circuit can function as, for example, a switch, oscillator, pulse generator, latch, flip-flop, feedforward loop, or feedback loop.
(133) The term “gate” is used to refer to a device or molecular mechanism that produces a particular (predetermined) output in response to one or more inputs. Thus, for example, an AND gate produces a HIGH output only when all inputs are HIGH. An OR gate produces a HIGH output when any input is HIGH and a LOW output only when all inputs are LOW. A NOT function returns a HIGH when input is LOW and a LOW when input is HIGH. Logic Gates and their uses are well known to those of skill in the art (see, e.g. Horowitz and Hill (1990) The Art of Electronics, Cambridge University Press, Cambridge). In some embodiments, the genetic circuits generated from the identified set of orthogonal pairs comprise 1, 2, 3, 4, 5, 6, 7, 8, 9 or more logic gates. Exemplary logic gates include, e.g., AND, NAND, NOR, OR, NOT, XOR, EQUALS, AND, IMPLIES, and ANDN gates. For example, NOR gates can comprise a transcriptional repressors and a transcriptional repressor target DNA sequence. AND gates can comprise a transcriptional activator and a transcriptional activator target DNA sequence.
(134) In some embodiments, a genetic circuit is designed with the aid of an algorithm. For example, a logic minimization algorithm can be used to identify the minimum number of parts (e.g., repressors, activators, operators, etc.) for achievement a particular logic circuit. Algorithms may be performed by a processor by executing instructions encoded on a computer-executable storage medium. An exemplary algorithm can be in a VLSI design, for example the ESPRESSO program. See, e.g., Rudell, R L: Multiple-Valued Logic Minimization for PLA Synthesis. Berkeley, Calif.: UC-Berkeley; 1986. In some embodiments, The output of the logic minimization tool feeds into programs, such as Logic Friday (e.g., Wu Y, et al. Nature 461:104-108 (2009)), which act as a visualization tool and enable constraints to be applied to the construction of a circuit diagram. See, Clancy and Voigt, Current Opinion in Biotechnology 21:1-10 (2010). In some embodiments, the genetic circuit is determined using a hardware descriptive language. In some embodiments, the hardware descriptive language is VHDL or Verilog.
(135) Once a genetic circuit is designed and implemented, the genetic circuit can be tested by challenging the circuit with a variety of inputs to confirm that the expected outputs are generated. This can assist to confirm that no unintended interactions occur within the genetic circuit or between the genetic circuit and the host cell in which the genetic circuit is expressed.
(136) VIII. Computer Implemented Methods
(137) Embodiments of the invention as described above can be implemented in the form of control logic using hardware and/or using computer software, firmware, or combinations thereof, in a modular or integrated manner. For example, the logic minimization methods for determining the genetic circuit, sequence similarity algorithms, and motif finding algorithms, can be implemented via the various forms above. Based on the disclosure and teachings provided herein, a person of ordinary skill in the art will know and appreciate other ways and/or methods to implement the present invention using hardware and a combination of hardware and software.
(138) Computing system 700 can include one or more processors, such as a processor 704. Processor 704 can be implemented using a general or special purpose processing engine such as, for example, a microprocessor, controller or other control logic. In this example, processor 704 is connected to a bus 702 or other communication medium.
(139) Memory 706 (which may be organized as a database) can store the classification information (e.g., functional roles and activities) of the sequences and assay data used to design the genetic circuit. Any data mentioned herein (e.g., classification information) can be downloaded from remote memory (e.g., from a network drive or a server that can be considered to be part of the computer system) and stored in a local memory that is more quickly accessible to a processor on which certain steps of methods are being implemented. Conversely, data generated by such a processor can be uploaded to the remote memory.
(140) Further, it should be appreciated that a computing system 700 of
(141) Computing system 700 may include bus 702 or other communication mechanism for communicating information, and processor 704] coupled with bus 702 for processing information.
(142) Computing system 700 also includes a memory 706, which can be a random access memory (RAM) or other dynamic memory, coupled to bus 702 for storing instructions to be executed by processor 704. The instructions may include instructions for performing methods of embodiments described herein. Memory 706 also may be used for storing temporary variables or other intermediate information during execution of instructions to be executed by processor 704. Computing system 700 further includes a read only memory (ROM) [708] or other static storage device coupled to bus 702 for storing static information and instructions for processor 704.
(143) Any of the software components or functions described in this application, may be implemented as software code to be executed by a processor using any suitable computer language such as, for example, Java, C++ or Perl using, for example, conventional or object-oriented techniques. The software code may be stored as a series of instructions, or commands on a computer readable medium for storage and/or transmission, suitable media include random access memory (RAM), a read only memory (ROM), a magnetic medium such as a hard-drive or a floppy disk, or an optical medium such as a compact disk (CD) or DVD (digital versatile disk), flash memory, and the like. The computer readable medium may be any combination of such storage or transmission devices.
(144) Computing system 700 may also include a storage device 710, such as a magnetic disk, optical disk, or solid state drive (SSD) is provided and coupled to bus 702 for storing information and instructions. Storage device 710 may include a media drive and a removable storage interface. A media drive may include a drive or other mechanism to support fixed or removable storage media, such as a hard disk drive, a floppy disk drive, a magnetic tape drive, an optical disk drive, a CD or DVD drive (R or RW), flash drive, or other removable or fixed media drive. As these examples illustrate, the storage media may include a computer-readable storage medium having stored therein particular computer software, instructions, or data.
(145) In alternative embodiments, storage device 710 may include other similar instrumentalities for allowing computer programs or other instructions or data to be loaded into computing system 700. Such instrumentalities may include, for example, a removable storage unit and an interface, such as a program cartridge and cartridge interface, a removable memory (for example, a flash memory or other removable memory module) and memory slot, and other removable storage units and interfaces that allow software and data to be transferred from the storage device 710 to computing system 700.
(146) Computing system 700 can also include a communications interface 718. Communications interface 718 can be used to allow software and data to be transferred between computing system 700 and external devices. Examples of communications interface 718 can include a modem, a network interface (such as an Ethernet or other NIC card), a communications port (such as for example, a USB port, a RS-232C serial port), a PCMCIA slot and card, Bluetooth, etc. Software and data transferred via communications interface 718 are in the form of signals which can be electronic, electromagnetic, optical or other signals capable of being received by communications interface 718. These signals may be transmitted and received by communications interface 718 via a channel such as a wireless medium, wire or cable, fiber optics, or other communications medium. Some examples of a channel include a phone line, a cellular phone link, an RF link, a network interface, a local or wide area network, and other communications channels.
(147) Computing system 700 may be coupled via bus 702 to a display 712, such as a cathode ray tube (CRT) or liquid crystal display (LCD), for displaying information to a computer user. An input device 714, including alphanumeric and other keys, is coupled to bus 702 for communicating information and command selections to processor 704, for example. An input device may also be a display, such as an LCD display, configured with touchscreen input capabilities.
(148) Execution of the sequences of instructions contained in memory [706] causes processor [704] to perform the process states described herein. Alternatively hard-wired circuitry may be used in place of or in combination with software instructions to implement embodiments of the present teachings. Thus implementations of embodiments of the present teachings are not limited to any specific combination of hardware circuitry and software.
(149) The term “computer-readable medium” as used herein generally refers to any media that is involved in providing one or more sequences or one or more instructions to processor 704 for execution. Such instructions, generally referred to as “computer program code” (which may be grouped in the form of computer programs or other groupings), when executed, enable the computing system 700 to perform features or functions of embodiments of the present invention. These and other forms of computer-readable media may take many forms, including but not limited to, non-volatile media, volatile media, and transmission media. Non-volatile media includes, for example, solid state, optical or magnetic disks, such as storage device 710. Volatile media includes dynamic memory, such as memory 706. Transmission media includes coaxial cables, copper wire, and fiber optics, including the wires that comprise bus 702. A computer product can be or include the computer-readable medium. For example, a computer product can be a computer system that includes one or more processors and a computer readable medium that has instructions for controlling the one or more processors to perform any of the methods described herein.
(150) Common forms of computer-readable media include, for example, a floppy disk, a flexible disk, hard disk, magnetic tape, or any other magnetic medium, a CD-ROM, any other optical medium, punch cards, paper tape, any other physical medium with patterns of holes, a RAM, PROM, and EPROM, a FLASH-EPROM, any other memory chip or cartridge, a carrier wave as described hereinafter, or any other medium from which a computer can read.
(151) Various forms of computer readable media may be involved in carrying one or more sequences of one or more instructions to processor 704 for execution. For example, the instructions may initially be carried on magnetic disk of a remote computer. The remote computer can load the instructions into its dynamic memory and send the instructions over a network. The instructions received by memory 706 may optionally be stored on storage device 710 either before or after execution by processor 704.
(152) It will be appreciated that, for clarity purposes, the above description has described embodiments of the invention with reference to different functional units and processors. However, it will be apparent that any suitable distribution of functionality between different functional units, processors or domains may be used without detracting from the invention. For example, functionality illustrated to be performed by separate processors or controllers may be performed by the same processor or controller. Hence, references to specific functional units are only to be seen as references to suitable means for providing the described functionality, rather than indicative of a strict logical or physical structure or organization.
(153) IX. Computational Implementation of Genetic Circuit Design
(154) Genetic Element Data & Data Models
(155) Much of biological data is reported in a standardized way. Many of these data formats support an implicit data model, facilitating understanding of the data by humans and use of that data in computational analysis. In this embodiment, genetic element data may represent a standardized way for reporting and transferring data. The implicit data model will include a standardized representation of basic information. Genetic element data may contain a standardized representation of classification data which provides identification of functional regions of the sequence, as well as the functional description of that sequence. Finally, genetic element data may provide a standardized classification of the experimental characterization information associated with the part. In some embodiments, genetic element data can be added, removed, modified or updated over time. Genetic element data may be updated on a server and downloaded locally.
(156) Classification of Genetic Design Elements, Devices and Circuits
(157) Genetic element data can be characterized using standardized terms, such as the features seen in GenBank records. Such terms can be used automation systems based upon controlled vocabularies, or ontology based terms.
(158) Characterization Based Upon Experimental Measurements
(159) Performance of a genetic design element, device or genetic circuit can be based upon use of measurement data. Meta data associated with a given assay can be used to classify the types of experimental investigations performed upon the element. Raw data can be reported managed, and stored in a standardized format. This in turn permits the comparison of elements that have gone through similar experimental investigations and provides a means to use data from several such investigations as a way to sort, filter, compare and select elements with appropriate performance characteristics for genetic circuit design.
(160) Development and Use of Design Template
(161) A design template is a general solution to a design problem that recurs repeatedly in many projects. Software designers adapt the template solution to their specific project. Templates use a formal approach to describing a design problem, its proposed solution, and any other factors that might affect the problem or the solution. A successful template should have established itself as leading to a good solution in three previous projects or situations.
(162) In embodiments described herein, design templates can be developed from genetic element data in order to identify genetic circuit elements, devices and genetic circuits that have certain characteristics. Such characteristics can be annotated through use of ontology or controlled vocabulary terms. According to embodiments described herein, designs can be searched and identified and reused or modified to suit the purposes of new designs. The corresponding DNA sequences can be identified and experimental manipulations can be performed upon them to introduce new desired functionality.
(163) Computer Aided Design Algorithms
(164) According to various embodiments, genetic circuit elements may be classified and characterized and their data stored. This may permit the data to be used in a genetic compiler program. A genetic compiler program is a software program, computer executable instructions, that may allow a system to use genetic circuit element data to design, develop, verify and validate genetic circuits. The types of algorithms supporting a design methodology used in such a genetic compiler program may include the following steps: Receiving the specification of genetic circuits based upon desired inputs and resultant outcomes, the identification of design constraints or requirements affecting that specification. Design of the processing of the inputs to result in desired outcomes. Analysis and design for orthogonality checks between the circuit design elements, the proposed devices, the proposed genetic circuit and the proposed target genome. Identification and compositional arrangement of appropriate genetic circuit elements. Assembly and Experimental verification and validation of the design.
(165) According to various embodiments described herein, the design process is an interactive process, supporting simultaneous development of similar solutions for desired performance characteristics.
(166) Development of Standardized Assays
(167) According to various embodiments described herein characterization of genetic circuit elements, devices and genetic circuits may be through use of standardized assays, designed to measure the performance of an identified element as compared to a set of variant elements. Description of such experiments will be encoded in a standardized fashion for use in the software.
(168) Orthogonality & Interaction Checks for Computational Designs
(169) According to various embodiments described herein, data may be collected to identify possible design constraints during device and genetic circuit design and development. In some embodiments, this may include checks for genetic element design, development and usage. In some embodiments, this may include checks for device design, development and usage. In some embodiments, this may include checks for genetic circuit design, development and usage. In some embodiments, this may include checks for genetic circuit element, device and genetic circuit, development and usage within identified hosts. In some embodiments this will include checks for genetic circuit element, device and genetic circuit, development and usage within identified populations of hosts.
(170) Assembly, Validation & Verification of Computational Designs
(171) According to various embodiments described herein, data may be collected to identify possible design constraints during device and genetic circuit assembly, validation and verification. In some embodiments, this may include checks for assembly constraints. In some embodiments this may include checks for verification constraints. In some embodiments, this may include checks for validation constraints.
(172) Modeling & Simulation
(173) According to various embodiments described herein, data may be collected to identify possible functioning of the genetic circuit element, device or genetic circuit. This data may be used to demonstrate the functioning of the design during modeling. Models may be used to query the performance of the design under different condition during simulations.
(174) Incorporation of Performance Data into Models & Simulations
(175) According to various embodiments described herein, data may be collected to identify the actual performance of the genetic circuit element, device or genetic circuit in the host system. As described in the section for assay standardization, performance data may be collected and reported for use in a computer analysis in a standardized fashion. This data may be used to demonstrate the actual functioning of the design as compared to predicted functioning of the device during modeling. Models may be used to query the actual performance of the design as compared to the predicted performance of the device under different conditions during simulations.
EXAMPLES
(176) The following examples are offered to illustrate, but not to limit the claimed invention.
Example 1. Orthogonal Sigmas for Programmable Transcriptional Regulation
(177) Engineering synthetic gene circuits requires a library of “parts” that serve to regulate gene expression and can be reliably combined together to build complex programs (see, Voigt, C. A., Curr. Opin. Biotechnol., 17(5): 548-57, (2006)). Promoters are an essential “part” that control gene expression by regulating the rate of mRNA production. Large genetic circuits require many promoters that can be individually controlled. This enables conditional control of gene expression across a circuit and requires a library of orthogonal promoter systems in which regulators target specific promoters with no cross-talk across the circuit.
(178) To achieve orthogonal regulation, we are using sigma (σ) factors to construct orthogonal σ-promoter systems. Sigma factors recruit RNA polymerase (RNAP) to specific promoter sequences to initiate transcription. The σ 70 family consist of 4 groups: Group 1 are the housekeeping σs and are essential; Groups 2-4 are alternative σs that direct cellular transcription for specialized needs (see, Gruber, T. M. and C. A. Gross, Annu. Rev. Microbiol., 57: 441-66, (2003)). Group 4 σs (also known as ECF σs; extracytoplasmic function) constitute the largest and most diverse group of σs, and have been classified into 43 subgroups (
(179) A. Constructing the ECF Sigma Library
(180) The ECF σ library was constructed as follows: 2 σ candidates were selected from each ECF subgroup (
(181) B. Expressing the ECF Sigma Library and Measuring Toxicity in E. coli Host
(182) Expression of the ECF σ library was monitored using a 3 plasmid system encoding a T7 expression system, ECF σ library, and target promoter reporter transformed in DH10b cells (see,
(183) Only small numbers of a molecules (˜100s) are required in a cell to observe gene expression; however, expression of foreign proteins in E. coli can be toxic. Sigmas may be toxic due to erroneous gene expression or by binding strongly to RNA polymerase, preventing gene expression by host σs. Toxicity was determined by measuring the changes in growth rate from over-expressing each member of the ECF σ library in DH10b host E. coli cells assayed in 96-well format both in exponentially growing cultures and colony sizes on agar plates.
(184) C. Identifying Target Promoters
(185) Many ECF σs autoregulate their own gene expression (
(186) D. Predicting Promoter Orthogonality
(187) The 34 promoter models were used to predict whether σs from the different ECF subgroups were able to recognize promoters from another subgroup (cross-talk) or if they were specific to just their own subgroup (orthogonal). For promoters from each subgroup, scoring models were constructed as described in Rhodius, V. A. & V. K. Mutalik, Proc Natl. Acad. Sci. U.S.A., 107(7):2854-9, (2010) using Position Weight Matrices (PWMs) for the −35 and −10 motifs, and a penalty term for suboptimal distances between the −35/−10 motifs:
Score=PWM.sub.−35+PWM.sub.−10+spacer penalties
(188) This model can then be used to “score” promoter sequences: the resultant score has been shown to be proportional to promoter strength (rate of mRNA production) (Rhodius, V. A. & V. K. Mutalik, Proc Natl. Acad. Sci. U.S.A., 107(7):2854-9, (2010)), i.e.
Score ∞ log(promoter strength)
(189) The 34 promoter scoring models were used to score 706 promoter sequences from all 34 ECF σs to predict specificity of promoter recognition. We find that in general the σs are highly specific, mainly recognizing promoters from their own subgroup (
(190) E. Testing Sigma-Promoter Orthogonality
(191) Next, we tested the orthogonality of the ECF σ-promoter pairs. Using our promoter scoring models to predict orthogonal promoters, for each ECF σ subgroup we constructed candidate promoters fused to gfp. Each promoter was then screened in vivo against the entire ECF σ library in 96-well format using our σ expression system to measure promoter activity (see
(192) Using this approach we identified 24 orthogonal σ-promoter systems (
(193) Sequence of functional ECF promoters from −60 to +20. The core −35 and −10 motifs are underlined.
(194) TABLE-US-00008 Promoter Sequence (−60 to +20) (SEQ ID NOS: 221-244) Pecf02_2817 CATGACAAACAAAAACAGATGCGTTACGGAACTTTACAAAAACGAGACACTCTAACCCTTTGCTTGCTCAAATTGCAGCT Pecf03_UP1198 CAGTACAAAATTTTTTAGATGCGTTTTTAACTTCGTTCCTTTTCGGCGTTCTAATAACCAAAGCTCAGAAATAATAGATG Pecf11_3726 ATGCCTCCACACCGCTCGTCACATCCTGTGATCCACTCTTCATCCCGCTACGTAACACCTCTGCATCGCGAACCAAAACC Pecf12_UP807 CAGTACAAAATTTTTTAGATGCGTTGCGGGAATCTCCCCGGCCGATGGGCCGTTTCCCAGGTCGAGTGGCCTGAATCGGA Pecf15_UP436 CAGTACAAAATTTTTTAGATGCGTTCTTGGGAACCGAACGCCGGTGCCCGCGTTCGGTTCCGGGGATCTTATCAACTTTT Pecf16_3622 CTTGGATGAAAAGAAACCCACCGACGGTGTAACCCTGGCGGCCGATGCAACGAACTAACTCACAGGACGTGCTCAGCACC Pecf17_UP1691 CAGTACAAAATTTTTTAGATGCGTTTGGTGAACCAAACTCTTACTCGACTCGTGTCAGTAAGCGGGAGGTGATCGCGTGG Pecf18_UP1700 CAGTACAAAATTTTTTAGATGCGTTTGCATCCAGATTGTCTCGGCGGCGGTAATGCCATAAGCAATGTTCGATGGCGCAG Pecf19_UP1315 CAGTACAAAATTTTTTAGATGCGTTTCCTCCCGCTCCTGTGGAGCACGATCGAACGCGAACGCGGTCACTATACCCATGC Pecf20_992 GCGCGGATAAAAATTTCATTTGCCCGCGACGGATTCCCCGCCCATCTATCGTTGAACCCATCAGCTGCGTTCATCAGCGA Pecf21_UP4014 CAGTACAAAATTTTTTAGATGCGTTAGGCAACCCTTTTTCATCCGGCTTCGTCTATATCTATAGAAACCGACACCAAACC Pecf22_UP1147 CAGTACAAAATTTTTTAGATGCGTTGTTGTGAGGAATCGCGCTCCTGCGCGAATCATCCCGTGTCGTCCCTTCACCTGCC Pecf24_UP69 CAGTACAAAATTTTTTAGATGCGTTACGGAACGCAGTCTTTTCGTCTGTATCAACTCCAAAATTCATCGTGCCTAAACAT Pecf25_UP4311 CAGTACAAAATTTTTTAGATGCGTCGAGGAACTCAAACTGCGCCATTATCGTCTAGCTAACAGAGGTTCTGCTTGGGAGG Pecf26_UP601 CAGTACAAAATTTTTTAGATGCGTTTGGAATAACCGGTCGCCTCCATCCGTTTACATACCGAATCCCGGCAGCGCCGGCC Pecf29_UP371 CAGTACAAAATTTTTTAGATGCGTTCCGGGAACCTTTTGTCGGCACGAACATCCAATTGGCGGATGAAACACTTTGTCTG Pecf30_2079 ACCATCCGTATTTTTTTAGGGATTTATAAAACTTTTCCATGGCGTGCGTCGTCTAATAAATGGGAAGGAGGAAATGATGT Pecf31_34 CAATGGCTGAAAAGAATTGTAAAAAAGATGAACGCTTTTGAATCCGGTGTCGTCTCATAAGGCAGAAAAACAAAAAAGGG Pecf32_1122 GCGACTTTATTTAACAGCGGCATGGCCAGGGAACCGATGCGTCAATCGCACCACACAATGACAACTGCTCTCATCATTGA Pecf33_375 TAAGTTGAACAATTTTGCACCTTCCGTCGAACCGTCCGCTGCATCGACCCGACCAACCTTGCGAGACGGCCTTTGAGCGT Pecf38_UP1322 CAGTACAAAATTTTTTAGATGCGTTGTACAACCCTCACGGGGGTGGACGTGTCCAACTGGCGTGGCAGAGGTTCTCGATT Pecf39_UP1413 CAGTACAAAATTTTTTAGATGCGTTTGTCAACCGTCCACGACGCGCTGGCGTCTGGAAGGGTGACCCAGCCAGACCAGCG Pecf41_UP1141 CAGTACAAAATTTTTTAGATGCGTTCACGTCACAAACCCGAAAGCTGAATCGTCATCCCGTTGAATCCCTCAAACACGGA Pecf42_UP4062 CAGTACAAAATTTTTTAGATGCGTTCGCTGTCGATCCGGCCCGTCGTCGTTCGTCGTACCCCCGAGAGCCCGCGAAAGGC
(195) In summary, we have constructed a library of 86 ECF σ factors for controlled expression in an E. coli host. Over-expression of the majority of these σs has little effect on growth in E. coli demonstrating their suitability for use as regulators in this host. Using computational approaches we have identified and constructed promoter models for 34 ECF subgroups. In vivo assays show that the ECF σ-promoter systems are highly orthogonal, with 24 orthogonal systems identified to date. We suggest that these σs are ideal candidates for constructing orthogonal regulatory systems for genetic engineering.
Example 2. Screening a Repressor Library to Build Orthogonal Circuits
(196) This examples describes the construction of chimeric sigmas as a means to diversify available orthogonal regulatory systems. Our work with ECF sigmas demonstrates that they are ideal tools for constructing orthogonal regulatory systems.
(197) ECF sigmas contain 2 highly conserved DNA binding domains. Conserved Region 2 recognizes the promoter −10 sequence and conserved Region 4 recognizes the promoter −35 sequence (
(198) Cognate chimeric promoters were also constructed in which the upstream −35 region (sequences −60 to −21) and the downstream −10 region (−19 to +20) were swapped (
Example 3. Screening a Repressor Library to Build Orthogonal Circuits
(199) This examples demonstrates a method of characterizing a library of repressor proteins belonging to the TetR family. Genetic circuits are often constructed using prokaryotic repressor proteins. Currently, only a few well-characterized repressors are implemented within circuit designs, which severely limit the number and complexity of programs that result. To expand the toolbox of programmable orthogonal operator-repressor pairs, we are characterizing a library of repressor proteins belonging to the TetR family. The newly characterized repressors will allow for the generation of transcriptional circuits of increasing complexity.
(200) A. Generation of the Repressor Library
(201) The Tetracycline repressor (TetR) represents one of the most well characterized microbial regulators. Based on the robust transcriptional control exhibited by TetR, this family of repressors is well suited for use in the programming of genetic circuits. To date, TetR itself is the only repressor within this family that has been used for such purposes. To expand the toolbox of programmable transcriptional repressor proteins, we are characterizing a library of 73 GENEART-synthesized repressors belonging to the TetR family (Table 2).
(202) Using a metagenomic approach, the repressors included within our library originate from 47 distinct prokaryotic organisms, and were selected based on two criteria: 1) homology to TetR, and 2) predicted variation in target sequence recognition. Each gene was refactored and codon optimized for production in E. coli. Post-synthesis, repressor coding sequences were inserted downstream of the T7 promoter, into a pET expression vector that contains an amino-terminal 6×-His (SEQ ID NO:141) tag.
(203) B. Repressor Library Characterization Using In Vivo Reporter Assays
(204) The operator sequences recognized by 26 repressors included in our library have been previously identified (Table 3). These operators range 16-55 bp in length, and typically contain inverted repeat sequences. To determine whether these repressors promote repression when paired with their properly matched operator sequences, reporters containing each operator sequence were constructed. Using in vivo reporter assays, constructs were then screened against the library in 96 well format.
(205) Reporters containing 23 of the known operator sequences were constructed, whereby each operator sequence is inserted into a strong constitutive promoter (J23119) that is situated upstream of the yellow fluorescent protein (YFP) reporter gene (
(206) Those reporters that render an active/fluorescent construct are then screened against the library in 96-well format. Specifically, the repressor library is transformed into cells containing an individual reporter and the T7 polymerase gene. A blue light transilluminator is then used to visualize fluorescence and subsequent repression of the transformation plate (
(207) C. Identifying Sequences Bound by Uncharacterized Repressors
(208) While some of the operators for repressors included in our library have been characterized, the majority are unknown. To determine the sequences bound by the previously uncharacterized repressors, newly designed protein binding arrays are being utilized. Each array contains 2.1 million distinct 28-mer inverted repeat sequences. A purified, fluorescently labeled repressor is applied to each array; each sequence becomes associated with an intensity value upon repressor binding. Data extraction and motif analysis reveal consensus sequences that are bound with high affinity (
(209) Using these 2.1M arrays, each repressor within the library is purified and its binding profile extracted. Consensus sequences representing those bound with high affinity, referred to as synthetic operator sequences are then inserted into the J23119 promoter (
(210) In summary, we have constructed and are characterizing a library of 73 TetR homologs. Utilizing both in vivo reporter assays and protein binding arrays, we are determining the sequences bound by each repressor, building reporters, and screening the orthogonality of each newly determined binding sequence against our library in vivo (
Example 4. Generation of Orthogonal RNAP:Promoter Interactions and Promoters of Different Strengths
(211) This example describes a physical library of RNA Polymerases (RNAPs) that bind orthogonal promoter sequences and mutations in these promoters that elicit different strengths of expression. This example also illustrates a method of constructing a T7 RNAP “scaffold” with reduced host toxicity to serve as a platform for creating orthogonal variants. In addition, this example describes the generation of orthogonal RNAP-promoter interaction by analyzing phage genomes to guide mutations to the RNAP scaffold and a region of the T7 promoter. Furthermore, this example describes the generation of promoters of different strengths by mutating a different region of the T7 promoter. Methods herein can be applied to extend the existing library or to create new libraries based on protein-DNA interactions.
(212) The T7 RNAP and promoter have historical utility in gene expression applications and recent utility in synthetic biology genetic circuits. There is value in identifying orthogonal RNAP-promoter interactions as well as promoter variants of differing strengths.
(213) Previous efforts to generate orthogonal RNAP-promoter interactions have fallen into two categories: 1) sourcing RNAP from different phage and characterizing their orthogonality based on which promoters they bind, or 2) mutating the T7 RNAP in an attempt to generate RNAPs that bind different promoters. Previous efforts to generate promoters of different strengths were based on non-specific mutations throughout the entire promoter structure. We have created both orthogonal RNAP-promoter interactions and also numerous phage promoters with different transcriptional strengths.
(214) An embodiments of the invention consists of a physical library of RNAPs that bind orthogonal promoter sequences and mutations to these promoters that elicit different strengths of expression. It can be divided into three primary aspects. Firstly, we constructed a T7 RNAP “scaffold” with reduced host toxicity to serve as a platform for creating orthogonal variants. Secondly, we generated promoters of different strengths by mutating a different region of the T7 promoter. And thirdly, we generated orthogonal RNAP-promoter interactions by analyzing phage genomes to guide mutations to the RNAP scaffold and a region of the T7 promoter. In certain embodiments, the methodology described herein can be applied to extend the existing library or to create new libraries based on protein-DNA interactions.
(215) A. T7 RNAP Scaffold: RNAP Backbone Mutations
(216) We constructed a T7 RNAP “scaffold” with reduced host toxicity to serve as a platform for creating multiple orthogonal variants. We were able to achieve better control of T7 RNAP activity by adopting functional design elements based on four key molecular mechanisms, including physical isolation, translational control, degradative control and processivity modulation.
(217) The physical isolation mechanism allows for the activation of an engineered genetic circuit in host cells that do not carry the T7 RNAP plasmid. We cloned the T7 RNAP on a low copy plasmid, separate from any T7 promoters and/or genes we wished to express. Then, we co-transformed our genetic circuit plasmid and T7 RNAP plasmid into host cells, and were able to activate the circuit.
(218) The translational control mechanism is based on minimizing T7 RNAP concentration by using weak ribosome binding sites, the sequence GTG as an suboptimal start codon, and random DNA spacers which insulate T7 RNAP expression from changes in upstream promoter activity.
(219) The degradative control is achieved by using an N-terminal tag to promote rapid degradation of the T7 RNAP by the Lon protease system. Our tag is based on the N-terminal sequence of the UmuD protein from E. coli.
(220) It is known by those skilled in the art that naturally, T7 RNAP transcribes DNA approximately eight times faster than the native E. coli RNAP. It has been determined that the active site mutations affect both promoter escape and transcription rate. We have characterized mutations located in the O-helix of T7 RNAP that spans residues 625-655. Studies of RNAP mutants have been described from Rui Sousa's laboratory (see, Bonner et al., EMBO J, 11(10), 3767-75 (1992), Bonner et al., J Biol. Chem., 269(40), 25120-8 (1994), and Makarova et al., Proc. Natl. Acad. Sci. U.S.A, 92(26), 12250-4 (1995)). Based on this analysis and our design, we created a library of T7 RNAP mutants and tested their processivity. The best mutation we identified is R632S, which has not been mentioned in any reference to date. We identified the R632S mutation while creating an RBS library. This particular R to S mutation at position 632 has not been studied before.
(221) B. Promoter Strength Library
(222) We developed and utilized a method of modulating RNAP specificity and promoter strength simultaneously by introducing mutations in different domains of the T7 promoter. T7 RNAP recognizes and initiates transcription from 17 promoters in the T7 phage. These promoters vary in sequence, and the consensus sequence is known as the T7 promoter. A number of groups have mutated the T7 promoter to produce variation in promoter activity. The variance is the result of altered binding affinity of the RNAP for the promoter, altered efficiency of transcript initiation, or a combination of the two. Further characterization of the interaction between T7 RNAP and promoter has identified a recognition domain between bases −17 and −5, as well as an initiation domain between bases −4 and +6 (see, Ikeda et al., Nucleic Acids Research, 20(10), 2517-2524 (1992) and McGinness and Joyce, J Biol. Chem., 277(4), 2987-2991 (2002)). Protein structures have shown that the T7 RNAP initially binds to the recognition domain of the promoter and subsequently interacts with the initiation domain to melt the DNA and form a transcription bubble. Recently, a study from the Ellington lab showed in vitro that mutations of the initially transcribed region (+1 to +6) result in a library of promoters with varying activity (see, Davidson et al., Symposium on Biocomputing, 15, 433-443 (2010)).
(223) We hypothesized that mutations in the recognition domain of the T7 promoter would primarily influence RNAP:DNA binding and mutations in the initiation domain predominately influence rate of transcription initiation. Therefore, we adopted a strategy to modularize the T7 promoter for the purpose of changing RNAP specificity and promoter strength simultaneously. We developed a promoter library by randomly mutating the T7 promoter from bases −2 to +3 (see
(224) C. Terminator Library
(225) To avoid repeated use of the same transcriptional components in the synthetic genetic circuits, we created numerous T7 promoter and transcriptional terminator derivatives. Since duplication of a sequence can hamper in vitro cloning methods or lead to homologous recombination in vivo, each transcriptional unit in the circuit ideally requires a unique transcriptional terminator.
(226) We developed a library of synthetic terminators that facilitate T7 RNAP transcription. Using the naturally occurring T7 phage terminator as a seed sequence, we developed a degenerate terminator sequence that was predicted to form stem-loop structures. We cloned the terminator library between GFP and RFP. When co-transformed with a mutant T7 RNAP scaffold, we observed a reduction in RFP expression for many clones. We assessed termination efficiency across the library by screening colonies for reduction of RFP expression using flow cytometry (see
(227) D. Methodology for Generating Orthogonal RNAP:Promoter Interactions
(228) We created a methodology to generate orthogonal RNAP:promoter interactions and identified synthetic RNAP:promoter combinations that are mutually orthogonal.
(229) The T7 RNAP specificity loop is a beta-hairpin that extends from approximately residue 730 to approximately residue 770. This loop is the primary determinant of RNAP:DNA binding, and previous crystal structures have shown direct major-groove DNA interactions with residues 746, 748, 756 and 758. Previous research focused on changing these four residues to influence specificity of RNAP binding and to recognize novel promoters.
(230) We hypothesized that specificity loop conformation and DNA interaction are the influenced by the entire loop, not simply the four residues implicated by previous studies. In particular, we thought that random mutagenesis of a few residues within the loop could detrimentally alter the ability of the RNAP specificity loop adopt a conformation that can interact with the major groove of the promoter. However, we also believed that mutations elsewhere in the loop could compensate for mutations to the residues that interact with DNA. These compensating mutations would confer on the loop the ability recover proper conformation for interacting with the promoter and potentially confer specificity for alternative DNA sequences.
(231) An exhaustive search of all possible loop sequences is not feasible (i.e., no. of residues to the power of the no. of 20 amino acids; ˜40.sup.20=1×10.sup.32). We believed that we could best source alternative loop sequences from biology. By identifying phage related to T7 in sequence databases, we created library of alternative specificity loop candidates sourced from homologous RNAP. Each RNAP contains a functional specificity loop that is divergent in sequence and possibly in structure from T7 RNAP. Additionally, many of the consensus promoters for phage found in sequence databases diverge from the T7 consensus promoter.
(232) We grafted alternative specificity loops in place of the T7 RNAP specificity loop to produce a library of synthetic RNAP. We found that in many cases this library recognized the consensus promoter for the source phage, rather than the T7 consensus promoter. In four cases, this methodology produced RNAP:promoter combinations that are mutually orthogonal.
(233) The methodology for generating orthogonal binding pairs comprises computational and experimental steps, including identification of RNAP and promoters from phage genomes in sequence databases, alignment of the specificity loop region from all RNAP, creation of synthetic RNAPs and synthetic promoters, and experimental testing for orthogonality.
(234) In certain embodiments, we identified RNAP and promoters from phage genomes in sequence databases. For instance, we selected RNAP sequences based on annotation or sequence homology to T7 RNAP. We selected promoters based on annotations or using a promoter identification algorithm we developed. This algorithm can scan phage genomes and identify regions containing a particular “seed” sequence. For example, a seed sequence we used was the highly conserved core of the T7 consensus promoter, CACTA. We aligned the regions surrounding the seed and eliminated highly divergent sequences.
(235) In certain embodiments, we aligned the specificity loop region from all RNAP based on amino acid sequence. We derived a cladogram from the alignment and used it to identify families of specificity loops. We generated consensus promoters for each phage using sequence logos. Then, we grouped consensus promoters into families based on recognition domain sequence. We observed perfect correlation between the RNAP families and promoter families.
(236) We created synthetic RNAPs by replacing the specificity loop sequence between residues 745 and 761 with a consensus loop sequence from a given phage family.
(237) We created synthetic promoters by replacing bases −12 to −7 in the T7 consensus promoter with the corresponding bases from the phage family consensus promoter.
(238) We co-transformed synthetic RNAP with synthetic promoters controlling RFP expression. We observed orthogonal activity as expected. Substantially more RFP was produced when synthetic RNAP were co-transformed with the synthetic promoters from the same phage family (see
(239) E. Combinatorial Promoters
(240) The methodology described herein was applied to improve the previous iterations of the synthetic promoter library. Combining mutations that confer orthogonality with mutations conferring altered strength into a single promoter greatly extends the utility of our invention. It is possible to utilize multiple RNAP in a single cell, each controlling multiple transcriptional units with a range of specified transcription rates.
(241) Using the methodology described herein, we demonstrated that we could combine orthogonal promoters responsive to T7 RNAP or T3 RNAP with the promoter strength library to achieve predictable outcomes. The combinatorial promoters were assembled from the T7 or T3 synthetic recognition domain and the synthetic initiation domain of the promoter strength library. The experiments demonstrated that promoters showed activity only when co-transformed with the RNAP specified by their recognition domain (see
Example 5. 5′ UTR Sequences
(242) A complex transcriptional regulatory circuit can be decomposed into several basic modules. These basic modules can consist of a regulatory gene and its regulated promoter. In such basic module, both input and output are promoter activities, and their relation can be described by a transfer function. A task for synthetic biologists is to characterize the transfer function. Unfortunately, transfer function we investigated are context-dependent (“context-dependent” means the same basic module owns different transfer functions in different contexts). In our experiments, the testing module is a NOT logic gate that consists of cI repressor and its repressed pOR1 promoter (sequence: tttgacatacctctggcggtgatatataatggttgc; SEQ ID NO:142). After generating this module, the NOT gate module was connected to three different upstream inducible promoters. The three promoters were:
(243) TABLE-US-00009 Pbad (sequence: agaaaccaattgtccatattgcatcagacattgccgtcac tgcgtatttactggctcttctcgctaaccaaaccggtaaccccgcttatt aaaagcattctgtaacaaagcgggaccaaagccatgacaaaaacgcgtaa caaaagtgtctataatcacggcagaaaagtccacattgattatttgcacg gcgtcacactttgctatgccatagcatttttatccataagattagcggat cctacctgacgctttttatcgcaactctctactgtttctccatacccg; SEQ ID NO: 143), Ptac (sequence: ggcaaatattctgaaatgagctgttgacaattaatcatc ggctcgtataatgtgtggaattgtgagcggataacaatttcacac; SEQ ID NO: 144) and Modified-Ptac (sequence: ggcaaatattctgaaatgagctgataaatgtgagcggat aacattgacattgtgagcggataacaagatactgagcac; SEQ ID NO: 145).
(244) We found that, under the three different promoters, the same NOT gate generated three completely different transfer functions. Experimentally, the input and output promoter activities were measured by the same super-fold gfp(gfp) gene with a same ribosome binding sequence (SDA: actagaaggaggaaaaaaatg; SEQ ID NO:146). See
(245) We knew that usually a piece of upstream promoter regions are transcribed into message RNA of regulatory genes. It is possible they change the translation rate and/or stability of the mRNA and ultimately change the regulatory gene expression in comparison with reporter gene's, so a fused cI-gfp gene (stop codon of cI is deleted, a short linker sequence “GGCGGTGGCGGT” (SEQ ID NO:147) is added, and the start codon of gfp is removed too) was constructed to monitor the regulatory gene expression. Experimental data indicated the relation between GFP and CI-GFP under Pbad and Ptac promoter are linear but with different slopes (slope of Pbad is 2.31, while slope of Ptac is 0.25). This means that the ratio between the regulatory gene (cI-gfp) and reporter gene (gfp) expression is 2.31 under Ptac promoters, but is 0.25 under Pbad promoter. See
(246) We have shown that transcriptional modules could seriously interfere with each other when being connected, and some optimized sequences as spacers must be found to prevent such interference. We collected about sixty 5′UTR sequences from the scientific literature and tested their properties by the Modified-Ptac-{spacer}-(gfp/cI-gfp) system. See
(247) TABLE-US-00010 Statistics Num/names Sources Sequence (SEQ ID NO:) Slope (Adj. R.sup.2) References 1 pD/E20J T5 phage Agttcgatgagagcgataaccctctacaaataattttg 0.913 0.999 [Ref 1] tttaa (149) 2 pH207J T5 phage ataaattgataaacaaaaacctctacaaataattttgt 0.679 0.991 [Ref 1] ttaa (150) 3 pN25J T5 phage ataaatttgagagaggagttcctctacaaataattttg 0.349 0.991 [Ref 2] tttaa (151) 4 pG25J T5 phage attaaagaggagaaattaaccctctacaaataattttg 0.370 0.998 [Ref 1] tttaa (152) 5 pJ5J T5 phage aaacctaatggatcgaccttcctctacaaataattttg 6.49 0.996 [Ref 1] tttaa (153) 6 pA1J T7 phage atcgagagggacacggcgacctctacaaataattttgt 0.421 0.996 [Ref 1] ttaa (154) 7 pA2J T7 phage gctaggtaacactagcagccctctacaaataattttgt 0.862 0.998 [Ref 1] ttaa (155) 8 pA3J T7 phage atgaaacgacagtgagtcacctctacaaataattttgt 1.407 0.990 [Ref 1] ttaa (156) 9 phi10J T7 phage agggagaccacaacggtttccctctacaaataattttg 0.582 0.995 [Ref 3] tttaa (157) 10 DG146aJ High- attaaaaaacctgctaggatcctctacaaataattttg 1.693 0.995 [Ref 4] transcription tttaa (158) escape 11 DG122J High- ataaaggaaaacggtcaggtcctctacaaataattttg N/A N/A [Ref 4] transcription tttaa (159) escape 12 DG131aJ High- ataggttaaaagcctgtcatcctctacaaataattttg 2.708 0.996 [Ref 4] transcription tttaa (160) escape 13 MhpR3hppJ Carbon acaataaaaaatcatttacatgtttcctctacaaataa 2.215 0.884 [Ref 10] utilization ttttgtttaa (161) 14 GlcCJ Carbon agaagcagcgcgcaaaaatcagctgcctctacaaataa 0.319 0.990 [Ref 10] utilization ttttgtttaa (162) 15 FucRPfucPJ Carbon atgagttcatttcagacaggcaaatcctctacaaataa 1.336 0.996 [Ref 10] utilization ttttgtttaa (163) 16 FuncRPfucAJ Carbon aacttgcagttatttactgtgattacctctacaaataa 0.899 0.998 [Ref 10] utilization ttttgtttaa (164) 17 ChbRNagCJ Carbon agccacaaaaaaagtcatgttggttcctctacaaataa 1.104 0.971 [Ref 10] utilization ttttgtttaa (165) 18 AraCJ Carbon acacagtcacttatcttttagttaaaaggtcctctaca 0.961 0.998 [Ref 10] utilization aataattttgtttaa (166) 19 AntiescapeJ Anti-escaping atccggaatcctcttcccggcctctacaaataattttg 2.245 0.995 [Ref 5] sequences tttaa (167) 20 LeiQiJ aacaaaataaaaaggagtcgctcaccctctacaaataa 0.112 0.396 [Ref 6] ttttgtttaa (168) 21 pD/E20RBS T5 phage agttcgatgagagcgataacagttccagattcaggaac 0.216 0.994 [Ref 1] tataa (169) 22 pH207RBS T5 phage ataaattgataaacaaaaaagttccagattcaggaact 0.509 0.999 [Ref 1] ataa (170) 23 pN25RBS T5 phage ataaatttgagagaggagttagttccagattcaggaac 1.058 0.998 [Ref 2] tataa (171) 24 pG25RBS T5 phage attaaagaggagaaattaacagttccagattcaggaac 0.806 0.999 [Ref 1] tataa (172) 25 pJ5RBS T5 phage aaacctaatggatcgaccttagttccagattcaggaac 0.454 0.999 [Ref 1] tataa (173) 26 pA1RBS T7 phage atcgagagggacacggcgaagttccagattcaggaact 2.532 0.999 [Ref 1] ataa (174) 27 pA2RBS T7 phage gctaggtaacactagcagcagttccagattcaggaact N/A N/A [Ref 1] ataa (175) 28 pA3RBS T7 phage atgaaacgacagtgagtcaagttccagattcaggaact N/A N/A [Ref 1] ataa (176) 29 phi10RBS T7 phage agggagaccacaacggtttcagttccagattcaggaac 0.363 0.999 [Ref 3] tataa (177) 30 DG146aRBS High- attaaaaaacctgctaggatagttccagattcaggaac 1.779 0.997 [Ref 4] transcription tataa (178) escape 31 DG122RBS High- ataaaggaaaacggtcaggtagttccagattcaggaac 0.514 0.998 [Ref 4] transcription tataa (179) escape 32 DG131aRBS High- ataggttaaaagcctgtcatagttccagattcaggaac 0.118 0.997 [Ref 4] transcription tataa (180) escape 33 MhpR3hppRBS Carbon acaataaaaaatcatttacatgtttagttccagattca 3.849 0.998 [Ref 10] utilization ggaactataa (181) 34 GlcCRBS Carbon agaagcagcgcgcaaaaatcagctgagttccagattca 0.329 0.989 [Ref 10] utilization ggaactataa (182) 35 FucRPfucPRBS Carbon atgagttcatttcagacaggcaaatagttccagattca 0.388 0.999 [Ref 10] utilization ggaactataa (183) 36 FuncRPfucARBS Carbon aacttgcagttatttactgtgattaagttccagattca 0.248 0.994 [Ref 10] utilization ggaactataa (184) 37 ChbRNagCRBS Carbon agccacaaaaaaagtcatgttggttagttccagattca N/A N/A [Ref 10] utilization ggaactataa (185) 38 AraCRBS Carbon acacagtcacttatcttttagttaaaaggtagttccag 0.539 0.959 [Ref 10] utilization attcaggaactataa (186) 39 AntiescapeRBS Anti-escaping atccggaatcctcttcccggagttccagattcaggaac 5.543 0.983 [Ref 5] sequences tataa (187) 40 LeiQiRBS aacaaaataaaaaggagtcgctcacagttccagattca N/A N/A [Ref 6] ggaactataa (188) 41 OmpA4 Stem loops gatcaccagggggatcccccggtgaaggat (189) 0.369 0.949 [Ref 7] 42 OmpA952 Stem loops gatcgcccaccggcagctgccggtgggcgatcaaggat 0.282 0.691 [Ref 7] (190) 43 OmpA29 Stem loops gatcatcggtagagttaatattgagcagatcccccggt 4.039 0.994 [Ref 7] gaaggat (191) 44 papA Stem loops attgatctggttattaaaggtaatcgggtcatttta 1.583 0.990 [Ref 7] (192) 45 pufBA Stem loops gttctccacgggtgggatgagcccctcgtggtggaaat 2.353 0.975 [Ref 7] gcg (193) 46 gene32 Stem loops agcatgaggtaaagtgtcatgcaccaa (194) 0.052 0.767 [Ref 7] 47 pHP4 Stem loops acgtcgacttatctcgagtgagatattgttgacggtac 1.381 0.972 [Ref 8] (195) 48 pHP10 Stem loops acgtcgacttatctcgagtgagataagttgacggtac 1.620 0.999 [Ref 8] (196) 49 pHP17 Stem loops acgtcgacttatctcgagactgcagttcaatagagata 0.155 0.961 [Ref 8] ttgttgacggtac (197) 50 Ribo50 Stem loops gactgtcaccggatgtgctttccggtctgatgagtccg 0.341 0.971 [Ref 9] (Ribozyme) tgaggacgaaacag (198) 51 OmpA952J Stem loops gatcaccagggggatcccccggtgaaggatcctctaca 0.908 0.991 [Ref 7] aataattttgtttaa (199) 52 OmpA64J Stem loops Gatcgcccaccggcagctgccggtgggcgatcaaggat N/A N/A [Ref 7] cctctacaaataattttgtttaa (200) 53 OmpA29J Stem loops gatcatcggtagagttaatattgagcagatcccccggt 0.776 0.958 [Ref 7] gaaggatcctctacaaataattttgtttaa (201) 54 papAJ Stem loops attgatctggttattaaaggtaatcgggtcattttacc 0.049 0.671 [Ref 7] tctacaaataattttgtttaa (202) 55 pufBAJ Stem loops Gttctccacgggtgggatgagcccctcgtggtggaaat 0.046 0.699 [Ref 7] gcgcctctacaaataattttgtttaa (203) 56 gene32 Stem loops agcatgaggtaaagtgtcatgcaccaacctctacaaat 0.667 0.937 [Ref 7] aattttgtttaa (204) 57 pHP4J Stem loops Acgtcgacttatctgagtgagatattgttgacggtacc 1.125 0.952 [Ref 8] ctctacaaataattttgtttaa (205) 58 pHP10J Stem loops Acgtcgacttatctcgagtgagataagttgacggtacc 0.070 0.447 [Ref 8] ctctacaaataattttgtttaa (206) 59 pHP17J Stem loops acgtcgacttatctcgagactgcagttcaatagagata 0.546 0.986 [Ref 8] ttgttgacggtaccctctacaaataattttgtttaa (207) 60 RiboJ Stem loops gactgtcaccggatgtgctttccggtctgatgagtccg 1.050 0.996 [Ref 9] (Ribozyme) tgaggacgaaacagcctctacaaataattttgtttaa (208) 1. Deuschle U, Kammerer W, Gentz R, Bujard H: Promoters of Escherichia coli: a hierarchy of in vivo strength indicates alternate structures. EMBO J 1986, 5:2987-2994. 2. Kammerer W, Deuschle U, Gentz R, Bujard H: Functional dissection of Escherichia coli promoters: information in the transcribed region is involved in late steps of the overall process. EMBO J 1986, 5:2995-3000. 3. Davis J H, Rubin A J, Sauer R T: Design, construction and characterization of a set of insulated bacterial promoters. Nucleic Acids Res 2011, 39:1131-1141. 4. Hsu L M, Cobb I M, Ozmore J R, Khoo M, Nahm G, Xia L, Bao Y, Ahin C: Initial transcribed sequence mutations specifically affect promoter escape properties. Biochemistry 2006, 45:8841-8854. 5. Chan C L, Gross C A: The anti-initial transcribed sequence, a portable sequence that impedes promoter escape, requires sigma70 for function. J. Biol. Chem 2001, 276:38201-38209. 6. Lynch S A, Desai S K, Sajja H K, Gallivan J P: A high-throughput screen for synthetic riboswitches reveals mechanistic insights into their function. Chem. Biol 2007, 14:173-184. 7. Emory S A, Bouvet P, Belasco J G: A 5′-terminal stem-loop structure can stabilize mRNA in Escherichia coli. Genes Dev 1992, 6:135-148. 8. Carrier T A, Keasling J D: Library of synthetic 5′ secondary structures to manipulate mRNA stability in Escherichia coli. Biotechnol. Prog 1999, 15:58-64. 9. Nelson J A, Shepotinovskaya I, Uhlenbeck O C: Hammerheads derived from sTRSV show enhanced cleavage and ligation rate constants. Biochemistry 2005, 44:14577-14585. 10. Website: on the world wide web biocyc.org/.
(248) We tested the Ribozyme spacer (RiboJ) under all three tested upstream promoters. For all three promoters, the riboJ spacer can process the transcribed mRNA and remove the transcribed promoter region from the mRNA. As a result, the transcripts of gfp, cI-gfp and cI genes become unique, even though their promoter region and transcribed 5′leading sequence of mRNA are completely different. Our experimental data showed the slope for GFP and CI-GFP relation converged into a same value (about 1.16) after adding the RiboJ spacer. The slope for the Pbad promoter increased from 0.25 to 1.19, while the slope for Ptac promoter decrease from 2.31 to 1.14. See,
(249) Part Mining Additional Insulator Parts
(250) Genetic programs are getting larger, requiring the functional connection of multiple genetic circuits. The reliable connection of these circuits will require the routine incorporation of insulator parts into the circuit design. The ribozyme function is locally implemented, so orthogonality and crosstalk is not a problem as it is in the scale-up of the number of circuits. However, re-using the same 75 bp part in a design could lead to homologous recombination and evolutionary instability (Galdzicki, M., Rodriguez, C., Chandran, D., Sauro, H. M. & Gennari, J. H. Standard Biological Parts Knowledgebase. PLoS One 6, (2011)). To expand the number of available insulators, the NCBI sequence database was searched for sequences similar to the sTRSV-ribozyme. Nine additional ribozymes were identified and screened for their insulating capability (see table below). These sequences share only an average of 75% sequence identity.
(251) Each ribozyme was tested for its ability to produce the same ratio of CI-GFP to GFP, whether under the control pTAC or pBAD (Table 2). Each ribozyme differed in its capability to rectify the ratios. Out of this library, five were identified that function as insulators: sLTSV+ (Forster, A. C. & Symons, R. H. Cell 50, 9-16 (1987)), Scc+ (Di Serio, F., Daròs, J. A., Ragozzino, A. & Flores, R. J Virol. 71, 6603-6610 (1997)), SarMV+ (Kaper, J. M., Tousignant, M. E. & Steger, G. Biochem. Biophys. Res. Commun. 154, 318-325 (1988)), PLMVd-(Hernández, C. & Flores, R. Proc. Natl. Acad. Sci. U.S.A. 89, 3711-3715 (1992)), sVTMoV+ (Roossinck, M. J., Sleat, D. & Palukaitis, P. Satellite RNAs of plant viruses: structures and biological effects. Microbiol. Rev. 56, 265-279 (1992)). This demonstrates that the insulating function is a general property of the ribozyme function, and not specific to the sTRSV-ribozyme.
(252) TABLE-US-00011 Performance of Ribozymes Obtained via Part Mining Slope.sup.c Slope.sup.c Name.sup.a Sequence (SEQ ID NOS: 209-218).sup.b pBAD pTAC LtsvJ AGTACGTCTGAGCGTGATACCCGCTCACTGAAGATGGCCCGGTAGGGCCGAAACGTACCTCTACAAATA 0.6 0.6 ATTTTGATTAA SccJ AGATGCTGTAGTGGGATGTGTGATCTCACCTGAAGAGTACAAAAGTCCGAAACGGTATCCTCTACAAAT 1.1 1.2 AATTTAGTTTAA RiboJ AGCTGTCACCGGATGTGCTTTCCGGATCTGATGAGTCCGTGAGGACGAAACAGCCTCTACAAATAATTT 1.4 1.3 TGTTTAA SarJ AGACTGTCGCCGGATGTGTATCCGACCTGACGATGGCCCAAAAGGGCCGAAACAGTCCTCTACAAATAA 2.2 2.4 TTTTGTTTAA PlmJ AGTCATAAGTCTGGGCTAAGCCCACTGATGAGTCGCTGAAATGCGACGAAACTTATGACCTCTACAAAT 1.6 1.8 AATTTTGTTTAA VtmoJ AGTCCGTAGTGGATGTGTATCCACTCTGATGAGTCCGAAAGGACGAAACGGACCTCTACAAATAATTTT 1.0 1.3 GTTTAA ChmJ AGAAGAGGTCGGCACCTGACGTCGGTGTCCTGATGAAGATCCATGACAGGATCGAAACCTCTTCCTCTA 1.9 2.4 CAAATAATTTTGTTTAA ScvmJ AGTACTGTCGCCAGACGTGGACCCGGCCTGATGAGTCCGAAAGGACGAAACAGTACCTCTACAAATAAT 0.8 1.4 TTTGTTTAA SltJ AGGACGTATGAGACTGACTGAAACGCCGTCTCACTGATGAGGCCATGGCAGGCCGAAACGTCCCTCTAC 2.2 1.4 AAATAATTTTGTTTAA PlmvJ AGGAAGAGTCTGTTGCTAAGCACACTGACGAGTCTCTGAGATGAGACGAAACTCTTCCCTCTACAAATAATTTTGT 2.0 5.9 TTAA .sup.aAll the names were changed on the base of their original names in the reference.sup.7,8, as an additional hairpin was added to expose the SD sequence in the RBS. .sup.bThe green residues forming the stem I, the blue residues forming the stem II and the red residues as the conserved catalytic core come from these ribozymes. The pink residues forming the stem III come from the additional hairpin. .sup.cThe slope of the expression of gfp and cI-gfp genes under the control of two promoters. The slopes are calculated as the average of at least three experiments on different days. The average error was 14%. The detailed measurements, including standard deviations are provided in the additional table below.
Performances of 10 Ribozyme Spacers
(253) Besides the RiboJ-ribozyme spacer, we also tested nine other ribozymes under the pTAC and pBAD promoter in order to discover alternative insulators. For each spacer, we measured the expression of GFP and CI-GFP for both the pTAC and pBAD inducible systems. The relationship of GFP and CI-GFP was fitted with a linear curve by origin software (OriginLab Inc.). The slopes are provided in Table S3.
(254) TABLE-US-00012 Summary of performances of Ribozyme spacers Slopes Rank Name promoter name Day 1 Day 2 Day 3 Day 4 Mean ± std 1 LtsvJ pBAD 0.603 0.587 0.547 0.566 0.575 ± 0.0244 pTAC 0.605 0.533 0.581 0.523 0.56 ± 0.039 2 SccJ pBAD 1.24 1.097 1.08 1.088 1.13 ± 0.0762 pTAC 1.389 1.09 1.172 0.936 1.15 ± 0.189 3 RiboJ pBAD 1.13 1.68 1.37 1.59 1.44 ± 0.246 pTAC 1.141 1.66 1.075 1.25 1.28 ± 0.262 4 SarJ pBAD 2.36 2.27 1.95 2.19 2.19 ± 0.176 pTAC 2.44 2.55 2.37 2.13 2.37 ± 0.178 5 PlmJ pBAD 1.77 1.49 1.33 1.69 1.57 ± 0.197 pTAC 1.89 1.76 1.76 1.77 1.79 ± 0.0635 6 VtmoJ pBAD 1.065 1.04 0.999 0.927 1.01 ± 0.0603 pTAC 1.43 1.25 1.226 1.162 1.27 ± 0.115 7 ChmJ pBAD 1.91 1.82 1.85 2.11 1.92 ± 0.130 pTAC 2.28 2.4 2.73 2.14 2.39 ± 0.252 8 ScvmJ pBAD 0.91 0.77 0.79 0.81 0.82 ± 0.0622 pTAC 1.56 1.377 1.277 1.41 ± 0.144 9 SltJ pBAD 2.07 2.0 1.74 2.95 2.19 ± 0.526 pTAC 1.5 1.45 1.22 1.22 1.43 ± 0.149 10 PlmvJ pBAD 2.32 1.96 1.39 2.42 2.02 ± 0.466 pTAC 5.74 7.57 4.86 5.62 5.95 ± 1.15
Example 6. AND Gates
(255) AND Gates
(256) Three 2-input AND gates have been constructed and fully characterized. See,
(257) Three other activator-chaperone pairs have been recruited from Shigella flexneri, Yersinia enterocolitica, and Pseudomonas aeruginosa. The YsaE-SycB (activator-chaperone) pair from Yersinia enterocolitica did not work in E. coli DH10B, but all other three pairs (InvF-SicA, MxiE-IpgC, and ExsDA-ExsC) work as AND gates. The mechanism for the ExsDA-ExsC system is different from that of InvF-SicA and MxiE-IpgC. ExsA is an activator and activates the pexsC promoter without forming complex with chaperone protein. Instead, there is ExsD molecule in the system, which sequesters and prevents ExsA from binding to the promoter. Consequently, when the two genes (exsD and exsA) are under the same promoter control (in this case, pTet), inducing this promoter by adding aTc (inducer) does not lead to activation of pexsC promoter. Once the chaperone ExsC coexists in the system, however, ExsC binds to ExsD more tightly than ExsA does. Thus, if all three proteins coexist and ExsC sequesters ExsD enough to release free ExsA, the pexsC promoter can be turned on.
(258) The AND gates consist of three parts (middle three portion of
(259) Gate Orthogonality
(260) When the AND gates are connected, these gates should be orthogonal. That is, each activator-chaperone pair should interact only with its cognate partner and promoter, not with the other partners and promoters. All the possible interaction combinations have been tested, and orthogonality of the three AND gates were confirmed (see the middle and right heat-maps of
(261) The wild-type SicA cross-talks (interacts) with MxiE. To eliminate such cross-talk, the sicA gene was mutated and a SicA mutant (SicA*F62Y) was found to be orthogonal to the other partners. To obtain this sicA variant, error-prone PCR was performed and library of SicA mutant proteins was screened as follows: Random mutations were introduced by PCR reactions which were performed using 1×PCR buffer (Invitrogen, Carlsbad, Calif.) supplemented with 7 mM MgCl.sub.2, 0.3 mM MnCl.sub.2, 0.2 mM of dATP and dGTP, 1 mM of dCTP and dTTP, and 0.05U Taq DNA polymerase (Invitrogen, Carlsbad, Calif.). Using the same experimental procedure as described above, strains containing the mutated sicA gene, the invF gene, and psicA promoter were screened, and positive clones with high fluorescence (compared to a positive control that contains wild type sicA-invF-psicA) were selected at 5 mM Ara and 100 ng/ml aTc. The selected sicA mutant genes were transformed into strains containing MxiE and the pipaH9.8 promoter, and the negative clone (containing SicA*) with low fluorescence (compared to a negative control that contains wild type sicA-invF-pipaH9.8) was selected at 5 mM Ara and 100 ng/ml aTc.
The promoter pipaH9.8 was mutated to reduce its basal expression level. Its high basal expression level can be problematic when the AND gate containing it is connected with other gates. One issue is a so-called impedance matching problem. Imagine a simple cascade circuit where an input promoter of the first module generates an activator, which turns on an output promoter of the second module. If the promoter of the first module has too high a basal activity, the activator is always expressed enough to turn on the output of the second module, and the entire circuit is always on. To improve its dynamic range, the −10 region of the pipaH9.8 promoter was changed from TATAAT to TAAGAT by using saturation mutagenesis. The forward and reverse primers for saturation mutagenesis are as follows: NNATAAAAAAGTGCTGAATTCAC (SEQ ID NO:219) and NNATAAGGATAAACAAAATTGGCTG (SEQ ID NO:220), respectively.
4-Input AND Gate
(262) The three 2-input AND gates constructed above (see AND GATE Section) were connected (as shown in the left of
(263) The sensor module consists of 4 input promoters (pBAD, pTac, pLux, and pTet) and the genes encoding their regulatory proteins (AraC, Lacd, LuxR, and TetR). The four inputs for the four sensor promoters are Ara, IPTG, AI-1 (30C6), and aTc. Each input promoter is connected with the gene(s) encoding the regulatory protein(s) from T3SS (IpgC, MxiE, ExsC, ExsD/ExsA). Note that the input promoter for mxiE is switched from pTet (see the middle diagram in the Section 1) to pTac. In addition, the output gene rfp for the pipaH9.8 and pexsC promoters (see the middle of
(264) 1. pXCPi-epA containing
(265) araC and lac under constitutive promoter control,
(266) ipgC under pBAD control,
(267) mxiE under pTac control, and
(268) sicA* under pipaH9.8 control
(269) 2. pCDAC-invF containing
(270) luxR and tetR under constitutive promoter control,
(271) exsC under pLux control,
(272) exsDA under pTet control
(273) invF under pexsC control
(274) 3. psicA-rfp containing rfp under psicA control
(275) The examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes.