Fc mutants with improved functional activity

11814438 · 2023-11-14

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates to a variant of a parent polypeptide comprising an Fc fragment, wherein the variant exhibits an increased affinity for at least one of the Fc (FcR) fragment receptors selected from among FcγRIIIa (CD16a), FcγRIIa (CD32a), and FcγRIIb (CD32b) receptors, relative to that of the parent polypeptide, characterized in that it comprises at least one mutation chosen from among K290G, Y296W, V240H, V240I, V240M, V240N, V240S, F241H, F241Y, L242A, L242F, L242G, L242H, L242I, L242K, L242P, L242S, L242T, L242V, F243L, F243S, E258G, E258I, E258R, E258M, E258Q, E258Y, V259C, V259I, V259L, T260A, T260H, T260I, T260M, T260N, T260R, T260S, T260W, V262A, V262S, V263T, V264L, V264S, V264T, V266L, V266M, S267A, S267Q, S267V, K290D, K290E, K290H, K290L, K290N, K290Q, K290R, K290S, K290Y, P291G, P291Q, P291R, R292I, R292L, E293A, E293D, E293G, E293M, E293Q, E293S, E293T, E294A, E294G, E294P, E294Q, E294R, E294T, E294V, Q295I, Q295M, Y296H, S298A, S298R, Y300I, Y300V, Y300W, R301A, R301M, R301P, R301S, V302A, V302F, V302L, V302M, V302R, V302S, V303S, V303Y, S304T, V305A, V305F, V305I, V305L, V305R and V305S of the Fc fragment, wherein the numbering is that of the EU index or equivalent in Kabat.

Claims

1. A variant of a parent polypeptide comprising a human IgG1 Fc fragment, wherein the variant has an increased affinity for at least one of the Fc (FcR) fragment receptors selected from among FcγRIIIa (CD16a), FcγRIIa (CD32a) and FcγRIIb (CD32b) receptors, relative to that of the parent polypeptide, wherein the variant comprises at least the mutation Y296W, of the Fc fragment; and (i) a mutation chosen from 334N, 378V and 397M; and ii) at least three mutations chosen from 334N, 352S, 378V and 397M, with the condition that mutations (i) and (ii) do not occur on the same amino acids, wherein the numbering is that of the EU index or equivalent in Kabat.

2. Variant according to claim 1, having an increased affinity for the FcγRIIIa (CD16a) receptor.

3. Variant according to claim 1, characterized in that it is selected from an isolated Fc fragment, a sequence derived from an isolated Fc fragment, an antibody and a fusion protein comprising an Fc fragment.

4. Variant of a parent polypeptide according to claim 1, characterized in that it is an antibody.

5. Variant according to claim 1, directed against an antigen selected from a tumor antigen, a viral antigen, a bacterial antigen, a fungal antigen, a toxin, a membrane or circulating cytokine and a membrane receptor.

6. Pharmaceutical composition comprising (1) a variant according to claim 1, and (2) at least one pharmaceutically acceptable excipient.

Description

CAPTIONS OF FIGURES

(1) FIG. 1 shows alignments of native human IgG1 sequences referring to positions 216 to 447 (according to the EU index) with the corresponding sequences of human IgG2 (SEQ ID NO: 7), human IgG3 (SEQ ID NO: 8) and human IgG4 (SEQ ID NO: 9). The IgG1 sequences refer to the G1m1.17 allotype (SEQ ID NO: 6) and the G1m3 allotype (SEQ ID NO: 10). The “CH2-CH3 lower hinge” domain of IgG1 begins with cysteine 226 (see arrow). The CH2 domain is highlighted in gray while the CH3 domain is italicized.

(2) FIG. 2 shows the forms G0, G0F, G1 and G1F of the glycan structures likely to be present on the Fc fragments of the invention.

DESCRIPTION OF THE INVENTION

(3) The present invention relates to a variant of a parent polypeptide comprising an Fc fragment, wherein the variant has a modified affinity, preferably increased for at least one of the Fc (FcR) fragment receptors selected from among FcγRIIIa (CD16a), FcγRIIa (CD32a), and FcγRIIb (CD32b) receptors relative to that of the parent polypeptide, characterized in that it comprises at least one mutation chosen from among V240H, V240I, V240M, V240N, V240S, F241H, F241Y, L242A, L242F, L242G, L242H, L242I, L242K, L242P, L242S, L242T, L242V, F243L, F243S, E258G, E258I, E258R, E258M, E258Q, E258Y, V259C, V259I, V259L, T260A, T260H, T260I, T260M, T260N, T260R, T260S, T260W, V262A, V262S, V263T, V264L, V264S, V264T, V266L, V266M, S267A, S267Q, S267V, K290D, K290E, K290G, K290H, K290L, K290N, K290Q, K290R, K290S, K290Y, P291G, P291Q, P291R, R292I, R292L, E293A, E293D, E293G, E293M, E293Q, E293S, E293T, E294A, E294G, E294P, E294Q, E294R, E294T, E294V, Q295I, Q295M, Y296H, Y296W, S298A, S298R, Y300I, Y300V, Y300W, R301A, R301M, R301P, R301S, V302A, V302F, V302L, V302M, V302R, V302S, V303S, V303Y, 5304T, V305A, V305F, V305I, V305L, V305R and V305S of the Fc fragment; wherein the numbering is that of the EU index or equivalent in Kabat.

(4) Such a variant of a parent polypeptide is called “variant according to the invention” in the present application.

(5) Throughout this application, the residue numbering in the Fc region is that of the immunoglobulin heavy chain according to the EU index or equivalent in Kabat et al. (Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service, National Institutes of Health, Bethesda, Maryland, 1991). The term “EU index or equivalent in Kabat” refers to the US numbering of human IgG1, IgG2, IgG3 or IgG4 antibody residues. This is illustrated on the IMGT website (http://www.imgt.org/IMGIScientificChart/Numbering/Hu_IGHGnber.html).

(6) FcR allow immune cells to take advantage of the specificity of the antibodies that bind to them to direct their cellular functions on the antigens and pathogens specific for that antibody.

(7) FcγR represent the most diverse group of FcR and are the main mediators of antibody functions in the body. There are three families of human FcγR: FcγRI (CD64); FcγRII (CD32); and FcγRIII (CD16).

(8) Three of them (FcγRI, FcγRIIa, FcγRIIIa) are activating receptors, which differ in their binding affinities and in their cellular expressions.

(9) The FcγRIIIa (CD16a) receptor is involved in antibody dependent cellular cytotoxicity (ADCC or Antibody-Dependent Cell-mediated Cytotoxicity), it has a V/F polymorphism at position 158. The FcγRIIa (CD32a) receptor is, for its part, involved in platelet activation and phagocytosis; it has an H/R polymorphism at position 131. The FcγRI (CD64) receptor is also involved in antibody-dependent cellular cytotoxicity (ADCC) and in phagocytosis mechanisms.

(10) Finally, the FcγRIIb (CD32b) receptor is involved in the inhibition of cellular activity. Among the Fc receptors defined in the context of the invention, the C1q complement is involved in the CDC or Complement Dependent Cytotoxicity activity.

(11) By “polypeptide” or “protein” is meant a sequence comprising at least 100 amino acids covalently attached.

(12) By “amino acid” is meant one of the 20 naturally occurring amino acids or unnatural analogues.

(13) The term “position” means a position in the sequence of a polypeptide. For the Fc region, the positions are numbered according to the EU index or equivalent in Kabat.

(14) The term “antibody” is used in the common sense. It corresponds to a tetramer that includes at least one Fc region, and two variable regions. Antibodies comprise, in particular, full-length immunoglobulins, monoclonal antibodies, multi-specific antibodies, chimeric antibodies, humanized antibodies, and fully human antibodies. The amino-terminal portion of each heavy chain comprises a variable region of about 100 to 110 amino acids responsible for antigen recognition. In each variable region, three loops are pooled to form an antigen binding site. Each of the loops is called a complementarity determining region (hereinafter referred to as a “CDR”). The carboxy-terminal portion of each heavy chain defines a constant region primarily responsible for the effector function.

(15) IgGs have several subclasses, including IgG1, IgG2, IgG3 and IgG4. IgM subclasses include IgM1 and IgM2. Thus, by “isotype” is meant one of the subclasses of immunoglobulins defined by the chemical and antigenic characteristics of their constant regions. The known isotypes of human immunoglobulins are IgG1, IgG2, IgG3, IgG4, IgA1, IgA2, IgM1, IgM2, IgD and IgE.

(16) Full-length IgG are tetramers and consist of two identical pairs of two immunoglobulin chains, wherein each pair has a light chain and a heavy chain, and wherein each light chain comprises the VL and CL domains, and each heavy chain comprises the domains VH, Cγ1 (also called CH1), Cγ2 (also called CH2), and Cγ3 (also called CH3). In the context of a human IgG1, “CH1” refers to positions 118 to 215, “CH2” refers to positions 231 to 340, and “CH3” refers to positions 341 to 447 according to the EU index or equivalent in Kabat. The IgG heavy chain also includes an N-terminal flexible hinge domain which refers to positions 216-230 in the case of IgG1. The lower hinge range refers to positions 226 to 230 according to the EU index or equivalent in Kabat.

(17) By “variable region” is meant the region of an immunoglobulin which comprises one or more Ig domains substantially encoded by any of the VK, VA and/or VH genes which make up the kappa, lambda and immunoglobulin heavy chains respectively. Variable regions include complementarity determining regions (CDRs) and framework regions (FRs).

(18) The term “Fc” or “Fc region” refers to the constant region of an antibody excluding the first immunoglobulin constant region (CH1) domain. Thus Fc refers to the last two domains (CH2 and CH3) of the IgG1 constant region, and to the flexible N-terminal hinge of these domains. For a human IgG1, the Fc region corresponds to the C226 residue at its carboxy terminal end, i.e. the residues of the position 226 to 447, wherein the numbering is according to the EU index or equivalent in Kabat. The Fc region used may further comprise a portion of the upper hinge region located between positions 216 to 226 according to the EU index or equivalent in Kabat; in this case, the Fc region used corresponds to the residues of the position 216 to 447, 217 to 447, 218 to 447, 219 to 447, 220 to 447, 221 to 447, 222 to 447, 223 to 447, 224 to 447 or 225 to 447, wherein the numbering is according to the EU index or equivalent in Kabat. Preferably in this case, the Fc region used corresponds to the residues of position 216 to 447, wherein the numbering is according to the EU index or equivalent in Kabat. Preferably, the Fc region used is chosen from the sequences SEQ ID NO: 1 to 10. Preferably, the Fc fragment used is chosen from the sequences SEQ ID NO: 1, 2, 3, 4 and 5. Preferably, the Fc fragment of the parent antibody has the sequence SEQ ID NO: 1. The sequences represented in SEQ ID NO: 1, 2, 3, 4 and 5 are free of an N-terminal hinge region. The sequences represented in SEQ ID NOs: 6, 7, 8, 9 and 10 respectively correspond to the sequences represented in SEQ ID NO: 1, 2, 3, 4 and 5 with their N-terminal hinge regions. Also, in a particular embodiment, the Fc fragment of the parent antibody is chosen from the sequences SEQ ID NO: 6, 7, 8, 9 and 10. Preferably, the Fc fragment of the parent antibody has a sequence corresponding to the positions 1-232, 2-232, 3-232, 4-232, 5-232, 6-232, 7-232, 8-232, 9-232, 10-232 or 11-232 of the sequence SEQ ID NO: 6.

(19) By “parent polypeptide” is meant a reference polypeptide. The parent polypeptide may be of natural or synthetic origin. In the context of the present invention, the parent polypeptide comprises an Fc region, referred to as the “parent Fc region”. This Fc region may be selected from the group of wild type Fc regions, their fragments and mutants. Preferably, the parent polypeptide comprises a human Fc region, preferably an Fc region of a human IgG1. The parent polypeptide may include preexisting amino acid modifications in the Fc region (e.g. Fc mutant) relative to wild type Fc regions. Advantageously, the parent polypeptide is an isolated Fc region (i.e. an Fc fragment as such), a sequence derived from an isolated Fc region, an antibody, a fusion protein comprising an Fc region or an Fc conjugate, wherein this list is not limiting. By “sequence derived from an isolated Fc region” is meant a sequence comprising at least two isolated Fc regions linked together, such as an scFc (single chain Fc) or a multimer Fc. By “fusion protein comprising an Fc region” is meant a polypeptide sequence fused to an Fc region, wherein the polypeptide sequence is preferably selected from the variable regions of any antibody, the binding sequences of a receptor to its ligand, the adhesion molecules, ligands, enzymes, cytokines and chemokines. By “Fc conjugate” is meant a compound which is the result of the chemical coupling of an Fc region with a conjugation partner. The conjugation partner may be protein or non-protein. The coupling reaction generally utilizes functional groups on the Fc region and the conjugation partner. Various linking groups are known by those in the art as being suitable for the synthesis of a conjugate; for example, homo- or heterobifunctional linking groups are well known (see, Pierce Chemical Company Catalog, 2005-2006, Technical Section on Crosslinking Agents, pages 321-350). Suitable conjugation partners include therapeutic proteins, labels, cytotoxic agents such as chemotherapeutic agents, toxins and their active fragments.

(20) Advantageously, the parent polypeptide—and therefore the variant according to the invention—consists of an Fc region.

(21) Advantageously, the parent polypeptide—and therefore the variant according to the invention—is an antibody.

(22) Finally, preferably, the parent polypeptide—and therefore the variant according to the invention—is a polypeptide produced in the milk of transgenic animals.

(23) By “mutation” is meant a change of at least one amino acid of the sequence of a polypeptide, including a change of at least one amino acid of the Fc region of the parent polypeptide. The mutated polypeptide thus obtained is a variant polypeptide; it is a variant according to the invention. Such a polypeptide comprises a mutated Fc region, relative to the parent polypeptide. Preferably, the mutation is a substitution, an insertion or a deletion of at least one amino acid. By “substitution” is meant the replacement of an amino acid at a particular position in a parent polypeptide sequence by another amino acid. For example, the N434S substitution refers to a variant polypeptide, in this case a variant for which asparagine at position 434 is replaced by serine. By “amino acid insertion” or “insertion” is meant the addition of an amino acid at a particular position in a parent polypeptide sequence. For example, the insertion G>235-236 designates a glycine insertion between positions 235 and 236. By “deletion of amino acids” or “deletion” is meant the deletion of an amino acid at a particular position in a parent polypeptide sequence. For example, E294del refers to the deletion of glutamic acid at position 294. Preferably, the following mutation label is used: “434S” or “N434S”, and means that the parent polypeptide comprises asparagine at position 434, which is replaced by serine in the variant. In the case of a combination of substitutions, the preferred format is “259I/315D/434Y” or “V259I/N315D/N434Y”. This means that there are three substitutions in the variant, at positions 259, 315 and 434, and that the amino acid at position 259 of the parent polypeptide, namely valine, is replaced by isoleucine, that the amino acid at position 315 of the parent polypeptide, asparagine, is replaced by aspartic acid and the amino acid at position 434 of the parent polypeptide, asparagine, is replaced by tyrosine.

(24) The variant according to the invention has a functional activity mediated by the modified Fc region, preferably increased relative to that of the parent polypeptide. By “functional activity mediated by the Fc region” is meant, in particular, the effector functions. Functional activity mediated by the Fc region thus includes, in particular, antibody-dependent cellular cytotoxicity (ADCC), complement-dependent cytotoxicity (CDC) or antibody-dependent cellular phagocytosis (ADCP), endocytosis activity, cytokine secretion, or a combination of at least two of these activities. Preferably, the functional activity mediated by the Fc region considered in the invention is selected from ADCC, ADCP, CDC and their combination. This functional activity may be evaluated by methods well known to those skilled in the art. The functional activity mediated by the Fc region of the variant according to the invention is increased relative to that of the parent polypeptide, typically by a ratio at least equal to 2, preferably greater than 5, preferably greater than 10, preferably greater than 15, preferably greater than 20, preferably greater than 25, and preferably greater than 30. Preferably, the mutated Fc region has a modified affinity, preferably increased, for at least one of the FcR. Preferably, the affinity is increased, relative to that of the parent Fc, by a ratio of at least 2, preferably greater than 5, preferably greater than 10, preferably greater than 15, preferably greater than 20, preferably greater than 25, and preferably greater than 30. In other words, the affinity of the mutated Fc region for a FcR is greater than that of the parent polypeptide.

(25) The affinity of a polypeptide comprising an Fc region for an FcR may be evaluated by methods well known to those skilled in the art. For example, those skilled in the art can determine affinity (Kd) using surface plasmon resonance (SPR). Alternatively, those skilled in the art may perform an appropriate ELISA test. An appropriate ELISA assay compares the binding forces of the parent Fc and the mutated Fc. The detected signals specific to the mutated Fc and the parent Fc are compared. Binding affinity may be determined either by evaluating whole polypeptides or evaluating isolated Fc regions thereof.

(26) Preferably, the mutated Fc region of the variant according to the invention comprises from 1 to 20 mutations relative to the parent polypeptide, preferably from 2 to 20 mutations. By “from 1 to 20 amino acid changes” is meant 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 and 20 amino acid mutations. Preferably, it comprises from 1 to 15 mutations, preferably from 2 to 15 mutations, preferably from 1 to 10 mutations relative to the parent polypeptide, preferably from 2 to 10 mutations.

(27) Preferably, the variant according to the invention is characterized in that the mutation is chosen from an insertion, a substitution, preferably one-off, and a deletion.

(28) Preferably, the variant according to the invention comprises at least one mutation i) chosen from among V240H, V240I, V240M, V240N, V240S, F241H, F241Y, L242A, L242F, L242G, L242H, L242I, L242K, L242P, L242S, L242T, L242V, F243L, F243S, E258G, E258I, E258R, E258M, E258Q, E258Y, V259C, V259I, V259L, T260A, T260H, T260I, T260M, T260N, T260R, T260S, T260W, V262A, V262S, V263T, V264L, V264S, V264T, V266L, V266M, S267A, S267Q, S267V, K290D, K290E, K290G, K290H, K290L, K290N, K290Q, K290R, K290S, K290Y, P291G, P291Q, P291R, R292I, R292L, E293A, E293D, E293G, E293M, E293Q, E293S, E293T, E294A, E294G, E294P, E294Q, E294R, E294T, E294V, Q295I, Q295M, Y296H, Y296W, S298A, S298R, Y300I, Y300V, Y300W, R301A, R301M, R301P, R301S, V302A, V302F, V302L, V302M, V302R, V302S, V303S, V303Y, S304I, V305A, V305F, V305I, V305L, V305R and V305S of the Fc fragment; wherein the numbering is that of the EU index or equivalent in Kabat.

(29) In a particular embodiment, the invention relates to a variant of a parent polypeptide comprising an Fc fragment, wherein the variant has a modified affinity, preferably increased for at least one of the Fc (FcR) fragment receptors selected from among the FcγRIIIa (CD16a), FcγRIIa (CD32a) and FcγRIIb (CD32b) receptors relative to that of the parent polypeptide, characterized in that it comprises a single mutation i) chosen from among V240H, V240I, V240M, V240N, V240S, F241H, F241Y, L242A, L242F, L242G, L242H, L242I, L242K, L242P, L242S, L242T, L242V, F243L, F243S, E258G, E258I, E258R, E258M, E258Q, E258Y, V259C, V259I, V259L, T260A, T260H, T260I, T260M, T260N, T260R, T260S, T260W, V262A, V262S, V263T, V264L, V264S, V264T, V266L, V266M, S267A, S267Q, S267V, K290D, K290E, K290G, K290H, K290L, K290N, K290Q, K290R, K290S, K290Y, P291G, P291Q, P291R, R292I, R292L, E293A, E293D, E293G, E293M, E293Q, E293S, E293T, E294A, E294G, E294P, E294Q, E294R, E294T, E294V, 02951, Q295M, Y296H, Y296W, S298A, S298R, Y300I, Y300V, Y300W, R301A, R301M, R301P, R301S, V302A, V302F, V302L, V302M, V302R, V302S, V303S, V303Y, S304I, V305A, V305F, V305I, V305L, V305R and V305S of the Fc fragment; wherein the numbering is that of the EU index or equivalent in Kabat.

(30) Thus, in a particular embodiment, the variant according to the invention comprises a single mutation i) chosen from among V240H, V240I, V240M, V240N, V240S, F241H, F241Y, L242A, L242F, L242G, L242H, L242I, L242K, L242P, L242S, L242T, L242V, F243L, F243S, E258G, E258I, E258R, E258M, E258Q, E258Y, V259C, V259I, V259L, T260A, T260H, T260I, T260M, T260N, T260R, T260S, T260W, V262A, V262S, V263T, V264L, V264S, V264T, V266L, V266M, S267A, S267Q, S267V, K290D, K290E, K290G, K290H, K290L, K290N, K290Q, K290R, K290S, K290Y, P291G, P291Q, P291R, R292I, R292L, E293A, E293D, E293G, E293M, E293Q, E293S, E293T, E294A, E294G, E294P, E294Q, E294R, E294T, E294V, 02951, Q295M, Y296H, Y296W, S298A, S298R, Y300I, Y300V, Y300W, R301A, R301M, R301P, R301S, V302A, V302F, V302L, V302M, V302R, V302S, V303S, V303Y, S304T, V305A, V305F, V305I, V305L, V305R and V305S of the Fc fragment; wherein the numbering is that of the EU index or equivalent in Kabat.

(31) In another particular embodiment, the variant Fc comprises at least two mutations i), wherein the mutations are chosen from among i) V240H, V240I, V240M, V240N, V240S, F241H, F241Y, L242A, L242F, L242G, L242H, L242I, L242K, L242P, L242S, L242T, L242V, F243L, F243S, E258G, E258I, E258R, E258M, E258Q, E258Y, V259C, V259I, V259L, T260A, T260H, T260I, T260M, T260N, T260R, T260S, T260W, V262A, V262S, V263T, V264L, V264S, V264T, V266L, V266M, S267A, S267Q, S267V, K290D, K290E, K290G, K290H, K290L, K290N, K290Q, K290R, K290S, K290Y, P291G, P291Q, P291R, R292I, R292L, E293A, E293D, E293G, E293M, E293Q, E293S, E293T, E294A, E294G, E294P, E294Q, E294R, E294T, E294V, 02951, Q295M, Y296H, Y296W, S298A, S298R, Y300I, Y300V, Y300W, R301A, R301M, R301P, R301S, V302A, V302F, V302L, V302M, V302R, V302S, V303S, V303Y, S304T, V305A, V305F, V305I, V305L, V305R and V305S of the Fc fragment; wherein the numbering is that of the EU index or equivalent in Kabat and with the condition that the mutations are not identical.

(32) In a more particular embodiment, the variant Fc comprises at least three mutations i), wherein the mutations i) are chosen from among V240H, V240I, V240M, V240N, V240S, F241H, F241Y, L242A, L242F, L242G, L242H, L242I, L242K, L242P, L242S, L242T, L242V, F243L, F243S, E258G, E258I, E258R, E258M, E258Q, E258Y, V259C, V259I, V259L, T260A, T260H, T260I, T260M, T260N, T260R, T260S, T260W, V262A, V262S, V263T, V264L, V264S, V264T, V266L, V266M, S267A, S267Q, S267V, K290D, K290E, K290G, K290H, K290L, K290N, K290Q, K290R, K290S, K290Y, P291G, P291Q, P291R, R292I, R292L, E293A, E293D, E293G, E293M, E293Q, E293S, E293T, E294A, E294G, E294P, E294A, E294R, E294T, E294V, 02951, Q295M, Y296H, Y296W, S298A, S298R, Y300I, Y300V, Y300W, R301A, R301M, R301P, R301S, V302A, V302F, V302L, V302M, V302R, V302S, V303S, V303Y, S304I, V305A, V305F, V305I, V305L, V305R and V305S of the Fc fragment; wherein the numbering is that of the EU index or equivalent in Kabat and with the condition that the mutations are not identical.

(33) In a more particular embodiment, the variant Fc comprises at least four mutations i), wherein the mutations i) are chosen from among V240H, V240I, V240M, V240N, V240S, F241H, F241Y, L242A, L242F, L242G, L242H, L242I, L242K, L242P, L242S, L242T, L242V, F243L, F243S, E258G, E258I, E258R, E258M, E258Q, E258Y, V259C, V259I, V259L, T260A, T260H, T260I, T260M, T260N, T260R, T260S, T260W, V262A, V262S, V263T, V264L, V264S, V264T, V266L, V266M, S267A, S267Q, S267V, K290D, K290E, K290G, K290H, K290L, K290N, K290Q, K290R, K290S, K290Y, P291G, P291Q, P291R, R292I, R292L, E293A, E293D, E293G, E293M, E293Q, E293S, E293T, E294A, E294G, E294P, E294A, E294R, E294T, E294V, 02951, Q295M, Y296H, Y296W, S298A, S298R, Y300I, Y300V, Y300W, R301A, R301M, R301P, R301S, V302A, V302F, V302L, V302M, V302R, V302S, V303S, V303Y, S304I, V305A, V305F, V305I, V305L, V305R and V305S of the Fc fragment; wherein the numbering is that of the EU index or equivalent in Kabat and with the condition that the mutations are not identical.

(34) In one embodiment, the variant according to the invention has an increased affinity for the FcγRIIIa (CD16a) receptor. In this particular embodiment, the variant comprises at least one mutation i) chosen from among S298A, S298R, F243S, F243L, L242A, L242F, L242G, L242I, L242K, L242S, L242V, V240I, V240M, V240N, V240S, E258I, T260A, K290D, K290E, K290G, K290H, K290Q, K290S, K290Y, Y296H, Y296W of the Fc fragment; wherein the numbering is that of the EU index or equivalent in Kabat.

(35) In another embodiment, the variant according to the invention has an increased affinity for the FcγRIIa (CD32a) receptor. In this particular embodiment, the variant comprises at least one mutation i) chosen from among F241H, F241Y, F243L, L242A, L242F, L242G, L242H, L242I, L242K, L242P, L242S, L242T, L242V, V240H, V240I, V240M, V240S, E258G, E258I, E258R, E258M, E258Q, E258Y, S267A, S267Q, S267V, T260A, T260H, T260I, T260M, T260N, T260R, T260S, T260W, V259C, V259I, V259L, V262A, V262S, V263T, V264L, V264S, V264T, V266L, V266M, E293A, E293D, E293G, E293M, E293Q, E293S, E293T, E294A, E294G, E294P, E294Q, E294R, E294T, E294V, K290D, K290E, K290G, K290H, K290L, K290N, K290Q, K290R, K290S, K290Y, P291G, P291Q, P291R, Q295I, Q295M, R292I, R292L, R301A, R301P, R301S, S304I, V302A, V302F, V302L, V302M, V302R, V302S, V303Y, V305A, V305F, V305L, V305R, V305S, Y300I, Y300V or Y300W; wherein the numbering is that of the EU index or equivalent in Kabat.

(36) In another embodiment, the variant according to the invention has an increased affinity for the FcγRIIb (CD32b) receptor. In this particular embodiment, the variant comprises at least one mutation i) chosen from among E258R, E258Y, V262A, S267A, S267Q, S267V, V264S, V266L, V266M, K290R, R301A, R301M, S304I, V302A, V302L, V302R, V303S, V305A, V305F, V305I, V305R, Y300V of the Fc fragment; wherein the numbering is that of the EU index or equivalent in Kabat.

(37) Preferably, the variant according to the invention is characterized in that the Fc fragment of the parent polypeptide already comprises at least: (ii) a mutation selected from 378V, 378T, 434Y and 434S; and (iii) at least one mutation selected from 226G, P228L, P228R, 230S, 230T, 230L, 241L, 264E, 307P, 315D, 330V, 362R, 378V, 378T, 389T, 389K, 434Y and 434S,

(38) wherein the numbering is that of the EU index or equivalent in Kabat and with the condition that mutations (ii) and (iii) do not occur on the same amino acids.

(39) Thus according to a particular aspect, the invention relates to a variant of a parent polypeptide comprising an Fc fragment, wherein the variant has a modified affinity, preferably increased, for at least one of the Fc (FcR) fragment receptors chosen from among the FcγRIIIa (CD16a), FcγRIIa (CD32a), and FcγRIIb (CD32b) receptors relative to that of the parent polypeptide, characterized in that it comprises at least one mutation i) chosen from among V240H, V240I, V240M, V240N, V240S, F241H, F241Y, L242A, L242F, L242G, L242H, L242I, L242K, L242P, L242S, L242T, L242V, F243L, F243S, E258G, E258I, E258R, E258M, E258Q, E258Y, V259C, V259I, V259L, T260A, T260H, T260I, T260M, T260N, T260R, T260S, T260W, V262A, V262S, V263T, V264L, V264S, V264T, V266L, V266M, S267A, S267Q, S267V, K290D, K290E, K290G, K290H, K290L, K290N, K290Q, K290R, K290S, K290Y, P291G, P291Q, P291R, R292I, R292L, E293A, E293D, E293G, E293M, E293Q, E293S, E293T, E294A, E294G, E294P, E294Q, E294R, E294T, E294V, Q295I, Q295M, Y296H, Y296W, S298A, S298R, Y300I, Y300V, Y300W, R301A, R301M, R301P, R301S, V302A, V302F, V302L, V302M, V302R, V302S, V303S, V303Y, S304I, V305A, V305F, V305I, V305L, V305R and V305S of the Fc fragment; and further comprising at least: (ii) a mutation selected from among 378V, 378T, 434Y and 434S; and (iii) at least one mutation selected from among 226G, P228L, P228R, 230S, 230T, 230L, 241L, 264E, 307P, 315D, 330V, 362R, 378V, 378T, 389T, 389K, 434Y and 434S, with the condition that the mutations (ii) and (iii) do not occur on the same amino acids, wherein the numbering is that of the EU index or equivalent in Kabat.

(40) In a particular embodiment, the variant comprises at least one combination of mutations selected from the group consisting of 226G/315D/434Y, 230S/315D/434Y, 230T/315D/434Y, 230T/264E/434S, 230T/389T/434S, 241 L/264E/378V, 241 L/264E/434S, 250A/389K/434Y, 259I/315D/434Y, 264E/378T/396L, 264E/378V/416K, 264E/378V/434S, 264E/396L/434S, 294del/307P/434Y, 307P/378V/434Y, 315D/330V/434Y, 315D/382V/434Y and 378V/383N/434Y, wherein it should be understood that the numbering of the amino acid positions of the Fc fragment is that of the EU index or equivalent in Kabat.

(41) In a particular embodiment, the variant further comprises at least one mutation selected from among the group consisting of 226G, 227L, 230S, 230T, 230L, 231T, 241L, 243L, 250A, 256N, 259I, 264E, 265G, 267R, 290E, 294del, 303A, 305A, 307P, 307A, 308I, 315D, 322R, 325S, 327V, 330V, 342R, 347R, 352S, 361D, 362R, 362E, 370R, 378V, 378T, 382V, 383N, 386R, 386K, 387T, 389T, 389K, 392R, 395A, 396L, 397M, 403T, 404L, 415N, 416K, 421T, 426T, 428L, 433R, 434Y, 434S and 439R, wherein it should be understood that the numbering of the amino acid positions of the Fc fragment is that of the EU index or equivalent in Kabat.

(42) In a particular embodiment, the variant comprises at least one combination of mutations selected from the group consisting of 307A/315D/330V/382V/389T/434Y, 256N/378V/383N/434Y, 315D/330V/361D/378V/434Y, 259I/315D/434Y, 230S/315D/428L/434Y, 241L/264E/307P/378V/433R, 250A/389K/434Y, 305A/315D/330V/395A/434Y, 264E/386R/396L/434S/439R, 315D/330V/362R/434Y, 294del/307P/434Y, 305A/315D/330V/389K/434Y, 315D/327V/330V/397M/434Y, 2301/241L/264E/265G/378V/4211, 264E/396L/415N/434S, 227L/264E/378V/434S, 264E/378T/396L, 230T/315D/362R/426T/434Y, 226G/315D/330V/434Y, 230L/241L/243L/264E/307P/378V, 250A/315D/325S/330V/434Y, 290E/315D/342R/382V/434Y, 241L/315D/330V/392R/434Y, 241 L/264E/307P/378V/434S, 230T/264E/403T/434S, 264E/378V/416K, 230T/315D/362E/434Y, 226G/315D/434Y, 226G/315D/362R/434Y, 226G/264E/347R/370R/378V/434S, 308I/315D/330V/382V/434Y, 230T/264E/378V/434S, 2311/241 L/264E/378T/397M/434S, 230 L/264E/378V/434S, 2301/315D/330V/386K/434Y, 226G/315D/330V/389T/434Y, 267R/307P/378V/421T/434Y, 230S/315D/387T/434Y, 230S/264E/352S/378V/434S and 230T/303A/322R/389T/404L/434S, wherein it should be understood that the numbering of the amino acid positions of the Fc fragment is that of the EU index or equivalent in Kabat.

(43) In a particular embodiment, the variant according to the invention comprises at least one mutation i), preferably a single mutation i), chosen from among V240H, V240I, V240M, V240N, V240S, F241H, F241Y, L242A, L242F, L242G, L242H, L242I, L242K, L242P, L242S, L242T, L242V, F243L, F243S, E258G, E258I, E258R, E258M, E258Q, E258Y, V259C, V259I, V259L, T260A, T260H, 1260I, T260M, T260N, T260R, T260S, T260W, V262A, V262S, V263T, V264L, V264S, V264T, V266L, V266M, S267A, S267Q, S267V, K290D, K290E, K290G, K290H, K290L, K290N, K290Q, K290R, K290S, K290Y, P291G, P291Q, P291R, R292I, R292L, E293A, E293D, E293G, E293M, E293Q, E293S, E293T, E294A, E294G, E294P, E294Q, E294R, E294T, E294V, 02951, Q295M, Y296H, Y296W, S298A, S298R, Y300I, Y300V, Y300W, R301A, R301M, R301P, R301S, V302A, V302F, V302L, V302M, V302R, V302S, V303S, V303Y, S304I, V305A, V305F, V305I, V305L, V305R and V305S of the Fc fragment; and a combination of mutations ii) and iii) selected from among 315D/330V/361D/378V/434Y, 230S/315D/428L/434Y, 307A/315D/330V/382V/389T/434Y, 259I/315D/434Y, 256N/378V/383N/434Y.

(44) Preferably, the variant according to the invention is characterized in that the Fc fragment of the parent polypeptide already comprises at least: (iv) a mutation selected from 307N, 326E, 326T, 334N, 334R, 352L, 378V, 378T, 394P, 396L, 397M, 421T; and (v) at least one mutation selected from among 226Y, 227S, 230S, 231V, 234P, 2431, 243L, 246R, 246E, 247T, 248E, 253F, 254F, 255W, 259A, 261R, 262A, 263A, 266M, 267N, 267G, 274E, 274R, 276S, 278H, 282A, 283G, 284L, 2861, 286Y, 287T, 288E, 288R, 290E, 298N, 302A, 305A, 307P, 308A, 308I, 308G, 309P, 312G, 315D, 316D, 319H, 320T, 320R, 320M, 322E, 3231, 325S, 333G, 334N, 334R, 336T, 339T, 340E, 343S, 345G, 349S, 349H, 350A 352S, 359A, 361H, 362R, 3631, 366A, 373D, 375R, 377T, 378V, 378T, 379A, 380G, 383R, 385R, 389S, 389T, 392R, 393A, 393I, 394P, 396L, 3971, 397M, 398P, 405V, 405L, 410R, 412M, 414R, 421T, 421S, 423L, 423Y, 423S, 423P, 428T, 431V, 431T, 434K, 434S, 435R, 436H, 439R, 440G, 440N, 442F, 442P and 447N, wherein the numbering is that of the EU index or equivalent in Kabat and with the condition that mutations (iv) and (v) do not occur on the same amino acids.

(45) Thus according to a particular aspect, the invention relates to a variant of a parent polypeptide comprising an Fc fragment, wherein the variant has a modified affinity, preferably increased, for at least one of the Fc (FcR) fragment receptors chosen from among the FcγRIIIa (CD16a), FcγRIIa (CD32a), and FcγRIIb (CD32b) receptors relative to that of the parent polypeptide, characterized in that it comprises at least one mutation i) chosen from among V240H, V240I, V240M, V240N, V240S, F241H, F241Y, L242A, L242F, L242G, L242H, L242I, L242K, L242P, L242S, L242T, L242V, F243L, F243S, E258G, E258I, E258R, E258M, E258Q, E258Y, V259C, V259I, V259L, T260A, T260H, T260I, T260M, T260N, T260R, T260S, T260W, V262A, V262S, V263T, V264L, V264S, V264T, V266L, V266M, S267A, S267Q, S267V, K290D, K290E, K290G, K290H, K290L, K290N, K290Q, K290R, K290S, K290Y, P291G, P291Q, P291R, R292I, R292L, E293A, E293D, E293G, E293M, E293Q, E293S, E293T, E294A, E294G, E294P, E294Q, E294R, E294T, E294V, Q295I, Q295M, Y296H, Y296W, S298A, S298R, Y300I, Y300V, Y300W, R301A, R301M, R301P, R301S, V302A, V302F, V302L, V302M, V302R, V302S, V303S, V303Y, S304T, V305A, V305F, V305I, V305L, V305R and V305S of the Fc fragment; and further comprising at least: (iv) a mutation selected from among 307N, 326E, 326T, 334N, 334R, 352L, 378V, 378T, 394P, 396L, 397M, 421T; and (v) at least one mutation selected from among 226Y, 227S, 230S, 231V, 234P, 2431, 243L, 246R, 246E, 247T, 248E, 253F, 254F, 255W, 259A, 261R, 262A, 263A, 266M, 267N, 267G, 274E, 274R, 276S, 278H, 282A, 283G, 284L, 2861, 286Y, 287T, 288E, 288R, 290E, 298N, 302A, 305A, 307P, 308A, 308I, 308G, 309P, 312G, 315D, 316D, 319H, 320T, 320R, 320M, 322E, 3231, 325S, 333G, 334N, 334R, 336T, 339T, 340E, 343S, 345G, 349S, 349H, 350A 352S, 359A, 361H, 362R, 3631, 366A, 373D, 375R, 377T, 378V, 378T, 379A, 380G, 383R, 385R, 389S, 389T, 392R, 393A, 393I, 394P, 396L, 3971, 397M, 398P, 405V, 405L, 410R, 412M, 414R, 421T, 421S, 423L, 423Y, 423S, 423P, 428T, 431V, 431T, 434K, 434S, 435R, 436H, 439R, 440G, 440N, 442F, 442P and 447N, wherein the numbering is that of the EU index or equivalent in Kabat and with the proviso that mutations (i), (iv) and (v) do not occur on the same amino acids.

(46) Preferably, the mutation (iv) is selected from among 378V, 396L and 397M. Preferably, the polypeptide further comprises a mutation selected from among 248E, 326T, 333G and 423Y.

(47) Preferably, the mutation (v) according to the invention is chosen from among 226Y, 227S, 230S, 231V, 234P, 2431, 243L, 246R, 246E, 247T, 248E, 253F, 254F, 255W, 259A, 261R, 262A, 263A, 266M, 267G, 274E, 274R, 276S, 278H, 282A, 283G, 284L, 2861, 286Y, 287T, 288E, 288R, 290E, 298N, 302A, 305A, 307P, 308A, 308I, 308G, 309P, 312G, 316D, 319H, 320T, 320R, 320M, 322E, 3231, 325S, 333G, 334N, 334R, 336T, 339T, 340E, 343S, 345G, 349S, 349H, 350A 352S, 359A, 361H, 362R, 3631, 366A, 373D, 375R, 377T, 378T, 379A, 380G, 383R, 385R, 389S, 389T, 392R, 393A, 393I, 394P, 396L, 3971, 398P, 405V, 405L, 410R, 412M, 414R, 421T, 421S, 423L, 423Y, 423S, 423P, 428T, 431V, 431T, 434K, 434S, 435R, 436H, 439R, 440G, 440N, 442F, 442P and 447N.

(48) In one embodiment, the mutation (iv) is selected from 378V, 396L and 397M and the mutation (v) is selected from 248E, 316D, 326E, 333G, 378T, 396L and 421T.

(49) In another embodiment, mutation (iv) is 378V and mutation (v) is selected from among 298N and 336T.

(50) In another embodiment, the mutation (iv) is selected from among 378V, 396L and 397M; and mutation (v) is selected from among 231V, 2861, 286Y, 290E, 315D, 334N, 352S, 361H, 366A, 378T, 397M, 412M, 421T and 423Y.

(51) In another embodiment, the mutation (iv) is 378V; and mutation (v) is selected from among 248E, 308A, 334R, 447N.

(52) In another embodiment, the mutation (iv) is selected from among 378V, 326E, 397M, 334N and 396L; and mutation (v) is selected from among 316D, 397M, 334N, 248E, 231V, 246R, 336T, 421T, 361H, 366A, 439R, 290E, 394P, 307P, 378V, 378T, 2861, 286Y and 298N.

(53) In another embodiment, the mutation (iv) is selected from among 378V, 326E, 397M, 307N, 394P, 326T, 396L and 334N; and mutation (v) is selected from among 316D, 334R, 334N, 3231, 231V, 246R, 336T, 378T, 286Y, 2861, 352S, 383R, 359A, 421T, 361H, 315D, 366A, 290E, 307P and 439R. Preferably, mutation (v) is selected from among 316D, 334R, 334N, 3231, 231V, 246R, 336T, 378T, 286Y, 2861, 352S, 383R, 359A, 421T, 361H, 366A, 290E, 307P and 439R.

(54) In another embodiment, the mutation (iv) is selected from among 326E, 326T, 378V, 397M, 352L, 394P, 396L and 421T; and mutation (v) is selected from among 316D, 334R, 248E, 334N, 418P, 231V, 320E, 402D, 359A, 383R, 421T and 361H.

(55) In another embodiment, the mutation (iv) is selected from among 378V, 378T, 396L, 421T, 334R and 326E; and mutation (v) is selected from among 361H, 290E, 316D, 248E, 410R, 421T, 334R, 394P, 307P, 447N, 378V, 284L, 421T, 396L, 2861, 315D and 397M.

(56) In another embodiment, the mutation (iv) is selected from among 378V, 326E, 397M, 334N and 396L; and mutation (v) is selected from among 316D, 397M, 334N, 248E, 231V, 246R, 336T, 421T, 361H, 366A, 439R, 290E, 394P, 307P, 378V, 378T, 2861, 286Y and 298N.

(57) In another embodiment, the mutation (iv) is selected from among 326E, 326T, 352L, 378V, 378T, 396L, 397M, 421T, 334N, 334R, 307N and 394P, and mutation (v) consists of at least 2 mutations selected from among 226Y, 227S, 230S, 231V, 234P, 2431, 243L, 246R, 246E, 247T, 248E, 253F, 254F, 255W, 259A, 261R, 262A, 263A, 266M, 267N, 267G, 274E, 274R, 276S, 278H, 282A, 283G, 284L, 2861, 286Y, 287T, 288E, 288R, 290E, 298N, 302A, 305A, 307P, 308A, 308I, 308G, 309P, 312G, 315D, 316D, 319H, 320T, 320R, 320M, 322E, 3231, 325S, 333G, 334N, 334R, 336T, 339T, 340E, 343S, 345G, 349S, 349H, 350A 352S, 359A, 361H, 362R, 3631, 366A, 373D, 375R, 377T, 378V, 378T, 379A, 380G, 383R, 385R, 389S, 389T, 392R, 393A, 393I, 394P, 396L, 3971, 397M, 398P, 405V, 405L, 410R, 412M, 414R, 421T, 421S, 423L, 423Y, 423S, 423P, 428T, 431V, 431T, 434K, 434S, 435R, 436H, 439R, 440G, 440N, 442F, 442P and 447N.

(58) Preferably, the at least 2 mutations (v) are selected from among 226Y, 227S, 230S, 231V, 234P, 2431, 243L, 246R, 246E, 247T, 248E, 253F, 254F, 255W, 259A, 261R, 262A, 263A, 266M, 267G, 274E, 274R, 276S, 278H, 282A, 283G, 284L, 2861, 286Y, 287T, 288E, 288R, 290E, 298N, 302A, 305A, 307P, 308A, 308I, 308G, 309P, 312G, 316D, 319H, 320T, 320R, 320M, 322E, 3231, 325S, 333G, 334N, 334R, 336T, 339T, 340E, 343S, 345G, 349S, 349H, 350A 352S, 359A, 361H, 362R, 3631, 366A, 373D, 375R, 377T, 378T, 379A, 380G, 383R, 385R, 389S, 389T, 392R, 393A, 393I, 394P, 396L, 3971, 398P, 405V, 405L, 410R, 412M, 414R, 421T, 421S, 423L, 423Y, 423S, 423P, 428T, 431V, 431T, 434K, 434S, 435R, 436H, 439R, 440G, 440N, 442F, 442P, and 447N.

(59) Preferably, the mutated Fc region of the polypeptide according to the invention comprises a combination of mutations chosen from among the combinations:

(60) K320E/T394P/G402D;

(61) K290E/K320E/T350A/P396L;

(62) T359A/S383R/V397M.

(63) According to another aspect of the invention, there is used a composition comprising a plurality of variants of a parent polypeptide comprising an Fc fragment, all of which have substantially the same sequence, wherein the variants comprise Fc fragments which, taken as a whole, exhibit a particular glycosylation profile.

(64) According to one particular aspect, the Fc fragments of the variants within a composition used in the context of the invention, have N-glycans on their glycosylation site (Asn 297, wherein the numbering is that of the EU index or equivalent in Kabat), characterized in that the N-glycans of the Fc fragments have a degree of fucosylation of less than 65%, preferably less than 60%, preferably less than 55%, preferably less than 50%, preferably less than 45%, preferably less than 40%, preferably less than 35%, preferably less than 30%, preferably less than 25%, preferably less than 20%.

(65) According to another aspect, the Fc fragments of the variants within a composition used in the context of the invention have N-glycans on their glycosylation site (Asn 297), characterized in that the N-glycans of the fragments Fc have a glycan structure of biantennary type, with short chains, a weak sialylation, presenting non-intermediate terminal N-acetylglucosamines.

(66) According to a more particular aspect, the Fc fragments of the variants within a composition used in the context of the invention have N-glycans on their glycosylation site (Asn 297), characterized in that the N-glycans of the Fc fragments have a content greater than 60% for the forms G0+G1+G0F+G1F, wherein the G0F+G1F forms are less than 50%.

(67) According to another more particular aspect, the Fc fragments of the variants within a composition used in the context of the invention have N-glycans at their glycosylation site (Asn 297), characterized in that the N-glycans of Fc fragments have a content greater than 60% for the forms G0+G1+G0F+G1F, wherein the fucose content is less than 65%. According to another even more particular aspect, the Fc fragments of the variants within a composition used in the context of the invention have N-glycans on their glycosylation site (Asn 297), characterized in that the N-glycans of the Fc fragments have a content of less than 40% for G1F+G0F forms.

(68) According to a more particular aspect, the Fc fragments of the variants within a composition used in the context of the invention have N-glycans at their glycosylation site (Asn 297), wherein the N-glycans of the Fc fragments have a fucosylation equal to 0%. The invention thus provides a composition comprising variants of a parent polypeptide comprising an Fc fragment, wherein the Fc fragments of the variants have N-glycans on the Asn297 glycosylation site characterized in that said N-glycans of the Fc fragments are devoid of fucose.

(69) Also, according to one particular aspect, the Fc fragments of the variants within a composition used in the context of the invention have N-glycans on the Asn297 glycosylation site, characterized in that the N-glycans of the Fc fragments present a fucosylation rate of between 20% and 55%. In particular, the invention provides a composition comprising variants of a parent polypeptide comprising an Fc fragment, wherein the Fc fragments of the variants have N-glycans on the Asn297 glycosylation site characterized in that the N-glycans of the Fc fragments present a fucosylation rate of between 20% and 50%, between 25% and 55%, between 25% and 50%, between 20% and 45% or between 25% and 45%.

(70) According to a more particular aspect, a composition that is useful according to the invention comprises variants of a parent polypeptide comprising an Fc fragment, wherein the Fc fragments of the variants have N-glycans on the Asn297 glycosylation site, characterized in that Fc fragments have a content greater than 60%, preferably greater than 80%, for the forms G0+G1+G0F+G1F, while the forms G0F+G1F have less than 50%, preferably less than 40%, or 30%.

(71) According to another more particular aspect, the N-glycans of the Fc fragments within the composition have a content greater than 60% for the forms G0+G1+G0F+G1F, wherein the fucose content is less than 65%.

(72) According to yet another more particular aspect, the N-glycans of the Fc fragments within the composition have a content of less than 50% for the G1F+G0F forms, preferably less than 40%, or 30%.

(73) The G0, G0F, G1 and G1F forms are selected from the forms shown in FIG. 2.

(74) Advantageously, the N-glycans of the Fc fragments within the variant composition have an average sialic acid content of less than 25%, 20%, 15%, or 10%, preferably 5%, 4% or 3%. 2%.

(75) A composition which may be used in the context of the invention comprises variants of a parent polypeptide comprising an Fc fragment, wherein the Fc fragments of the variants have N-glycans on their glycosylation site (Asn 297), wherein the N-glycans of the Fc fragments have a glycan structure of biantennary type, with short chains, weak sialylation, and low fucosylation, while the N-glycans have, for example, a content greater than 60% for the G0+G1+G0F+G1F forms, and fucosylation of less than 60%, preferably less than 55%, while the N-glycans have, for example, a content of less than 50% of the G0F+G1F forms and a fucosylation of less than 55%.

(76) In a particular embodiment, the Fc fragments according to the invention have glycanic structures as described in the patent application WO01/77181.

(77) According to an advantageous embodiment, the Fc fragments used in the invention comprise at least one mutation of an amino acid with respect to a parent Fc fragment, and have N-glycans on their glycosylation site (Asn 297), wherein the N-glycans of the Fc fragments have a degree of fucosylation of less than 65%, preferably less than 60%, preferably less than 55%, preferably less than 50%, preferably less than 45%, preferably less than 40% preferably less than 35%, preferably less than 30%, preferably less than 25%, preferably less than 20%. Preferably, the Fc fragments carry at least one mutation i) chosen from among V240H, V240I, V240M, V240N, V240S, F241H, F241Y, L242A, L242F, L242G, L242H, L242I, L242K, L242P, L242S, L242T, L242V, F243L, F243S, E258G, E258I, E258R, E258M, E258Q, E258Y, V259C, V259I, V259L, T260A, T260H, T260I, T260M, T260N, T260R, T260S, T260W, V262A, V262S, V263T, V264L, V264S, V264T, V266L, V266M, S267A, S267Q, S267V, K290D, K290E, K290G, K290H, K290L, K290N, K290Q, K290R, K290S, K290Y, P291G, P291Q, P291R, R292I, R292L, E293A, E293D, E293G, E293M, E293A, E293S, E293T, E294A, E294G, E294P, E294Q, E294R, E294T, E294V, Q295I, Q295M, Y296H, Y296W, S298A, S298R, Y300I, Y300V, Y300W, R301A, R301M, R301P, R301S, V302A, V302F, V302L, V302M, V302R, V302S, V303S, V303Y, S304I, V305A, V305F, V305I, V305L, V305R and V305S of the Fc fragment; wherein the numbering is that of the EU index or equivalent in Kabat, and furthermore have N-glycans on their glycosylation site (Asn 297), wherein the N-glycans have a fucosylation level of less than 55%, preferably less than 50%, of preferably less than 45%, preferably less than 40%, preferably less than 35%, preferably less than 30%, preferably less than 25%, preferably less than 20%.

(78) More preferably, the Fc fragments of the composition according to the invention carry a mutation i) chosen from among V240H, F241H, F241Y, L242H, L242P, L242T, E258G, E258R, E258M, E258Q, E258Y, V259C, V259I, V259L, T260H, T260I, T260M, T260N, T260R, T260S, T260W, V262A, V262S, V263T, V264L, V264S, V264T, V266L, V266M, S267A, S267Q, S267V, K290L, K290N, K290R, P291G, P291Q, P291R, R292I, R292L, E293A, E293D, E293G, E293M, E293Q, E293S, E293T, E294A, E294G, E294P, E294Q, E294R, E294T, E294V, 02951, Q295M, Y300I, Y300V, Y300W, R301A, R301M, R301P, R301S, V302A, V302F, V302L, V302M, V302R, V302S, V303S, V303Y, S304I, V305A, V305F, V305I, V305L, V305R and V305S, of the Fc fragment; wherein the numbering is that of the EU index or equivalent in Kabat, and furthermore have N-glycans on their glycosylation site (Asn 297), wherein the N-glycans have a fucosylation level of less than 55%, preferably less than 50%, preferably less than 45%, preferably less than 40%, preferably less than 35%, preferably less than 30%, preferably less than 25%, preferably less than 20%.

(79) Advantageously, the Fc fragments having a modified glycosylation at the site of glycosylation at position 297, in particular a low fucosylation, show an increase in the binding of the fragment to Fc gamma (FcγR) receptors, in particular the FcγRIIIa (CD16a) receptor.

(80) Preferably, the Fc fragments have an affinity for CD16a of at least 2×10.sup.6 M.sup.−1, at least equal to 2×10.sup.7 M.sup.−1, 2×10.sup.8 M.sup.−1 or 2×10.sup.9 M.sup.−1, as determined by Scatchard analysis or BIAcore technology (label-free surface plasmon resonance based technology).

(81) Preferably, the variant according to the invention is characterized in that it comprises from 1 to 20 mutations of the Fc fragment, preferably from 1 to 10 mutations.

(82) Preferably, the variant according to the invention is characterized in that the parent polypeptide comprises a parent Fc fragment, which is a human Fc fragment, preferably an Fc fragment of a human IgG1 or a human IgG2.

(83) Preferably, the variant according to the invention is characterized in that it is chosen from an isolated Fc fragment, a sequence derived from an isolated Fc fragment, an antibody and a fusion protein comprising an Fc fragment.

(84) Preferably, the variant according to the invention is characterized in that it is an antibody.

(85) The present invention also relates to a polypeptide composition according to the invention.

(86) The present invention also relates to a pharmaceutical composition comprising (1) a variant according to the invention or a composition as described in the preceding paragraph, and (2) at least one pharmaceutically acceptable excipient.

(87) The object of the present invention is also the variant according to the invention or the composition as described above, for its use as a medicament.

(88) As indicated previously, advantageously, the parent polypeptide—and therefore the variant according to the invention—is an antibody. In this case, the antibody may be directed against an antigen selected from a tumor antigen, a viral antigen, a bacterial antigen, a fungal antigen, a toxin, a membrane or circulating cytokine and a membrane receptor.

(89) When the antibody is directed against a tumor antigen, its use is particularly suitable in the treatment of cancers. By “cancer” is meant any physiological condition characterized by an abnormal proliferation of cells. Examples of cancers include carcinomas, lymphomas, blastomas, sarcomas (including liposarcomas), neuroendocrine tumors, mesotheliomas, meningiomas, adenocarcinomas, melanomas, leukemias and lymphoid malignancies, wherein this list is not exhaustive.

(90) When the antibody is directed against a viral antigen, its use is particularly suitable for the treatment of viral infections. Viral infections include infections caused by HIV, a retrovirus, a Coxsackie virus, smallpox virus, influenza, yellow fever, West Nile, a cytomegalovirus, rotavirus or Hepatitis B or C, wherein this list is not exhaustive.

(91) When the antibody is directed against a toxin, its use is particularly suitable for the treatment of bacterial infections, for example infections with tetanus toxin, diphtheria toxin, anthrax toxins Bacillus anthracis, or in the treatment of infections by botulinum toxins, ricin toxins, shigatoxins, wherein this list is not exhaustive.

(92) When the antibody is directed against a cytokine, its use is particularly useful in the treatment of inflammatory and/or autoimmune diseases. Inflammatory and/or autoimmune diseases include thrombotic thrombocytopenic purpura (ITP), transplant or organ rejection, graft-versus-host disease, rheumatoid arthritis, systemic lupus erythematosus, various types of sclerosis, primary Sjögren's syndrome (or Sjögren's syndrome), autoimmune polyneuropathies such as multiple sclerosis, type I diabetes, autoimmune hepatitis, ankylosing spondylitis, Reiter's syndrome, gout arthritis, celiac disease, Crohn's disease, chronic Hashimoto's thyroiditis (hypothyroidism), Adisson's disease, autoimmune hepatitis, Graves' disease (hyperthyroidism), ulcerative colitis, vasculitis like systemic vasculitis associated with ANCAs (anti-cytoplasmic antibodies to neutrophils), autoimmune cytopenia and other haematological complications in adults and children, such as acute or chronic autoimmune thrombocytopenia, autoimmune haemolytic anemias, haemolytic disease of the newborn (MHN), cold agglutinin disease, autoimmune acquired haemophilia; Goodpasture syndrome, extra-membranous nephropathies, autoimmune bullous skin disorders, refractory myasthenia gravis, mixed cryoglobulinemia, psoriasis, juvenile chronic arthritis, inflammatory myositis, dermatomyositis and systemic autoimmune disorders of the child including antiphospholipid syndrome, connective tissue disease, pulmonary autoimmune inflammation, Guillain-Barré syndrome, chronic inflammatory demyelinating polyradiculoneuropathy (PDCI), autoimmune thyroiditis, diabetes mellitus, myasthenia gravis, inflammatory autoimmune disease of the eye, optic neuromyelitis (Devic's disease), scleroderma, pemphigus, insulin resistance diabetes, polymyositis, Biermer's anemia, glomerulonephritis, Wegener's disease, Horton's disease, periarthritis nodosa and Churg and Strauss syndrome, Still's disease, polychondritis trophic, Behçet's disease, monoclonal gammopathy, Wegener's granulomatosis, lupus, ulcerative colitis, psoriatic arthritis, sarcoidosis, collagenous colitis, dermatitis herpetiformis, familial Mediterranean fever, IgA-deposition glomerulonephritis Lambert-Eaton myasthenic syndrome, sympathetic ophthalmia, Fiessinger-Leroy-Reiter syndrome and uveo-meningoencephalic syndrome.

(93) Other inflammatory diseases are also concerned, such as acute respiratory distress syndrome (ARDS), acute septic arthritis, adjuvant arthritis, allergic encephalomyelitis, allergic rhinitis, allergic vasculitis, allergy, asthma, atherosclerosis, chronic inflammation due to chronic bacterial or viral infections, chronic obstructive pulmonary disease (COPD), coronary heart disease, encephalitis, inflammatory bowel disease, inflammatory osteolysis, inflammation associated with acute and delayed hypersensitivity reactions, inflammation associated with tumors, peripheral nerve injury or demyelinating diseases, inflammation associated with tissue trauma such as burns and ischemia, inflammation due to meningitis, multiorgan organ dysfunction syndrome (MODS), pulmonary fibrosis, sepsis and septic shock, Stevens-Johnson syndrome, undifferentiated arthritis, and undifferentiated spondyloarthropathies.

(94) In a particular embodiment of the invention, the autoimmune disease is idiopathic thrombotic purpura (ITP) and chronic inflammatory demyelinating polyradiculoneuropathy (PDCI).

(95) The object of the present invention is also a method for producing a variant of a parent polypeptide comprising an Fc fragment, wherein the variant has an increased affinity for at least one of the Fc (FcR) fragment receptors selected from among FcγRIIIa (CD16a), FcγRIIa (CD32a), and FcγRIIb (CD32b) receptors relative to that of the parent polypeptide, which comprises a step of mutating at least one amino acid, the mutation being chosen from among V240H, V240I, V240M, V240N, V240S, F241H, F241Y, L242A, L242F, L242G, L242H, L242I, L242K, L242P, L242S, L242T, L242V, F243L, F243S, E258G, E258I, E258R, E258M, E258Q, E258Y, V259C, V259I, V259L, T260A, T260H, T260I, T260M, T260N, T260R, T260S, T260W, V262A, V262S, V263T, V264L, V264S, V264T, V266L, V266M, S267A, S267Q, S267V, K290D, K290E, K290G, K290H, K290L, K290N, K290Q, K290R, K290S, K290Y, P291G, P291Q, P291R, R292I, R292L, E293A, E293D, E293G, E293M, E293A, E293S, E293T, E294A, E294G, E294P, E294Q, E294R, E294T, E294V, Q295I, Q295M, Y296H, Y296W, S298A, S298R, Y300I, Y300V, Y300W, R301A, R301M, R301P, R301S, V302A, V302F, V302L, V302M, V302R, V302S, V303S, V303Y, S304T, V305A, V305F, V305I, V305L, V305R and V305S, of the Fc fragment; wherein the numbering is that of the EU index or equivalent in Kabat.

(96) The object of the present invention is, in particular, a method for producing a variant of a polypeptide comprising an Fc fragment, wherein the variant has an increased affinity for at least one of the Fc (FcR) fragment receptors selected from among FcγRIIIa (CD16a), FcγRIIa (CD32a), and FcγRIIb (CD32b) receptors, relative to that of the parent polypeptide, a ratio at least equal to 2, preferably greater than 5, preferably greater than 10, preferably greater than 15, preferably greater than 20, preferably greater than 25, preferably greater than 30, and which comprises a step of mutating at least one amino acid, wherein the mutation is chosen from among V240H, V240I, V240M, V240N, V240S, F241H, F241Y, L242A, L242F, L242G, L242H, L242I, L242K, L242P, L242S, L242T, L242V, F243L, F243S, E258G, E258I, E258R, E258M, E258Q, E258Y, V259C, V259I, V259L, T260A, T260H, T260I, T260M, T260N, T260R, T260S, T260W, V262A, V262S, V263T, V264L, V264S, V264T, V266L, V266M, S267A, S267Q, S267V, K290D, K290E, K290G, K290H, K290L, K290N, K290Q, K290R, K290S, K290Y, P291G, P291Q, P291R, R292I, R292L, E293A, E293D, E293G, E293M, E293A, E293S, E293T, E294A, E294G, E294P, E294Q, E294R, E294T, E294V, 02951, Q295M, Y296H, Y296W, S298A, S298R, Y300I, Y300V, Y300W, R301A, R301M, R301P, R301S, V302A, V302F, V302L, V302M, V302R, V302S, V303S, V303Y, S304T, V305A, V305F, V305I, V305L, V305R and V305S, of the Fc fragment; wherein the numbering is that of the EU index or equivalent in Kabat.

(97) The sequences described in this application may be summarized as follows:

(98) TABLE-US-00001 SEQ ID NO: Protein Sequence  1 Fc  CPPCPAPELLGGPSVFLFPPKPKDTLMISRTP region  EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKT of human  KPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC IgG1 KVSNKALPAPIEKTISKAKGQPREPQVYTLPP G1m1.17 SRDELTKNQVSLTCLVKGFYPSDIAVEWESNG (residues QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW 226-447 QQGNVFSCSVMHEALHNHYTQKSLSLSPGK according  to the EU index or equiva- lent in Kabat)  without an N- terminal upper  hinge region  2 Fc  CPPCPAPPVAGPSVFLFPPKPKDTLMISRTPE region  VTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTK of human  PREEQFNSTFRVVSVLTVVHQDWLNGKEYKCK IgG2 VSNKGLPAPIEKTISKTKGQPREPQVYTLPPS without  REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ an N- PENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQ terminal  QGNVFSCSVMHEALHNHYTQKSLSLSPGK upper hinge  region  3 Human  CPRCPAPELLGGPSVFLFPPKPKDTLMISRTP IgG3 Fc EVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKT region  KPREEQYNSTFRVVSVLTVLHQDWLNGKEYKC without KVSNKALPAPIEKTISKTKGQPREPQVYTLPP N- SREEMTKNQVSLTCLVKGFYPSDIAVEWESSG terminal QPENNYNTTPPMLDSDGSFFLYSKLTVDKSRW upper  QQGNIFSCSVMHEALHNRFTQKSLSLSPGK hinge region  4 Human  CPSCPAPEFLGGPSVFLFPPKPKDTLMISRTP IgG4 Fc EVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKT region  KPREEQFNSTYRVVSVLTVLHQDWLNGKEYKC without KVSNKGLPSSIEKTISKAKGQPREPQVYTLPP N- SQEEMTKNQVSL terminal TCLVKGFYPSDIAVEWESNGQPENNYKTTPPV upper  LDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH hinge NEALHHYTQKSLSLSLGK region  5 Fc  CPPCPAPELLGGPSVFLFPPKPKDTLMISRTP region  EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKT of human  KPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC IgG1 KVSNKALPAPIEKTISKAKGQPREPQVYTLPP G1m3  SREEMTKNQVSLTCLVKGFYPSDIAVEWESNG without QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW N- QQGNVFSCSVMHEALHNHYTQKSLSLSPGK terminal upper  hinge region  6 Fc  EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKP region  KDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV of human  DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ IgG1 DWLNGKEYKCKVSNKALPAPIEKTISKAKGQP G1m1.17  REPQVYTLPPSR with N- DELTKNQVSLTCLVKGFYPSDIAVEWESNGQP terminal ENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ upper  GNVFSCSVMHEALHNHYTQKSLSLSPGK hinge region  (residues 216-447 according  to the EU index or equiva- lent in Kabat)  7 Fc  ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTL Region  MISRTPEVTCVVVDVSHEDPEVQFNWYVDGVE of Human  VHNAKTKPREEQFNSTFRVVSVLTVVHQDWLN IgG2 GKEYKCKVSNKGLPAPIEKTISKTKGQPREPQ with N- VYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV terminal EWESNGQPENNYKTTPPMLDSDGSFFLYSKLT upper  VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL hinge SPGK region  8 Human  ELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCP IgG3 Fc  EPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAP region  ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV with N-  DVSHEDPEVQFKWYVDGVEVHNAKTKPREEQY terminal NSTFRVVSVLTV upper LHQDWLNGKEYKCKVSNKALPAPIEKTISKTK hinge GQPREPQVYTLPPSREEMTKNQVSLTCLVKGF region YPSDIAVEWESSGQPENNYNTTPPMLDSDGSF FLYSKLTVDKSRWQQGNIFSCSVMHEALHNRF TQKSLSLSPGK  9 Human  ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDT IgG4 Fc LMISRTPEVTCVVVDVSQEDPEVQFNWYVDGV region  EVHNAKTKPREEQFNSTYRVVSVLTVLHQDWL with N- NGKEYKCKVSNKGLPSSIEKTISKAKGQPREP terminal  QVYTLPPSQEEM upper TKNQVSLTCLVKGFYPSDIAVEWESNGQPENN hinge  YKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNV region FSCSVMHEALHNHYTQKSLSLSLGK G1m3  human IgG1 10 Fc   EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKP region KDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV with N- DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ terminal DWLNGKEYKCKVSNKALPAPIEKTISKAKGQP upper REPQVYTLPPSR hinge EEMTKNQVSLTCLVKGFYPSDIAVEWESNGQP region ENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPGK

EXAMPLES

(99) The following examples are given to illustrate various embodiments of the invention.

Example 1 Production of Fc Variants According to the Invention by Directed Mutagenesis

(100) 1. Construction of Fc Variants:

(101) Each mutation of interest in the Fc fragment was inserted independently into an expression vector containing the anti-CD20 heavy chain by overlap PCR using two sets of primers adapted to integrate a deletion or a degenerate codon (NNN or NNK) in a targeted position (240 to 243, 258 to 267, 290 to 296, 298 to 305). The fragments thus obtained by PCR were combined and the resulting fragment was amplified by PCR using standard protocols. The PCR product was purified on 1% (w/v) agarose gels, digested with the appropriate restriction enzymes and cloned into the eukaryotic expression vector pMGM05-CD20 (pCEP4 InvitroGen), which contains cloning sites for the Fc fragment (BamHI and NotI) and the VH variable chain of the anti-CD20 antibody. This construction leads to the mutation of two amino acids in Fc (aa224 and 225, HT changed to GS) and the addition of the EFAAA sequence to the C-terminal of Fc, but makes it possible to very rapidly test a very large number of clones. Initially, it was verified that these mutations did not modify the binding of IgG-WT to the different receptors.

(102) The DNA of isolated clones was sequenced on colonies after PCR. After bioinformatic analyzes, clones with new mutations were frozen at −80° C. with XL1-Blue bacteria and the sequences included in our database.

(103) 2. Production of Variant IgG in HEK293 Cells:

(104) The light chain of the anti-CD20 was inserted in a pCEP4 vector identical to the vector used for the heavy chain, denoted pMGM01-CDC20 (pCEP4 InvitroGen). HEK293-F Freestyle™ cells (Invitrogen), grown in 24-well plates, were co-transfected with pMGM01-CD20 and pMGM05-CD20 vectors (Fc-WT and variants) in equimolar amounts (250 ng/ml). with a transfection reagent (1 μl/ml) using standard protocols (Invitrogen). The cells were cultured in suspension in serum-free medium for 7-9 days post-transfection and the IgG-containing supernatants (1 ml) were harvested after centrifugation of the cells at 100 g for 10 min. IgG secreted in the supernatants were quantified using an ELISA test (FastELISA, R&D biotech).

(105) TABLE-US-00002 TABLE 1 list of mutants generated Name of the mutant mutations ZAC1-36 V240H ZAC1-136 V240I ZAC1-123 V240M ZAC1-78 V240N ZAC1-226 V240S ZAC1-100 F241H ZAC1-220 F241Y ZAC1-134 L242A ZAC1-121 L242F ZAC1-110 L242G ZAC1-150 L242H ZAC1-09 L242I ZAC1-66 L242K ZAC1-17 L242P ZAC1-224 L242S ZAC1-229 L242T ZAC1-177 L242V ZAC1-08 F243L ZAC1-115 F243S ZAC2-158 E258G ZAC2-167 E258I ZAC2-210 E258R ZAC2-30 E258M ZAC2-111 E258Q ZAC2-86 E258Y ZAC2-150 V259C ZAC2-74 V259I ZAC2-180 V259L ZAC2-36 T260H ZAC2-114 T260I ZAC2-250 T260M ZAC2-162 T260N ZAC2-124 T260R ZAC2-110 T260S ZAC2-258 T260W ZAC2-85 T260A ZAC2-226 V262A ZAC2-153 V262S ZAC2-39 V263T ZAC2-107 V264L ZAC2-42 V264S ZAC2-156 V264T ZAC2-148 V266L ZAC2-122 V266M ZAC2-225 S267A ZAC2-64 S267Q ZAC2-121 S267V ZAC3-182 K290D ZAC3-174 K290E ZAC3-83 K290G ZAC3-70 K290H ZAC3-62 K290L ZAC3-246 K290N ZAC3-54 K290Q ZAC3-41 K290R ZAC3-203 K290S ZAC3-172 K290Y ZAC3-39 P291G ZAC3-08 P291Q ZAC3-185 P291R ZAC3-13 R292I ZAC3-71 R292L ZAC3-196 E293A ZAC3-178 E293D ZAC3-61 E293G ZAC3-126 E293M ZAC3-120 E293Q ZAC3-10 E293S ZAC3-15 E293T ZAC3-118 E294A ZAC3-53 E294G ZAC3-82 E294P ZAC3-80 E294Q ZAC3-02 E294R ZAC3-105 E294T ZAC3-66 E294V ZAC3-48 Q295I ZAC3-254 Q295M ZAC3-110 Y296H ZAC3-42 Y296W ZAC4-192 S298A ZAC4-130 S298R ZAC4-233 Y300I ZAC4-14 Y300V ZAC4-71 Y300W ZAC4-187 R301A ZAC4-218 R301M ZAC4-255 R301P ZAC4-03 R301S ZAC4-268 V302A ZAC4-131 V302F ZAC4-237 V302L ZAC4-53 V302M ZAC4-236 V302R ZAC4-29 V302S ZAC4-208 V303S ZAC4-144 V303Y ZAC4-219 S304T ZAC4-33 V305A ZAC4-229 V305F ZAC4-262 V305I ZAC4-139 V305L ZAC4-36 V305R ZAC4-179 V305S

Example 2: Fc Receptor Binding Tests

(106) 1. Recombinant Fc Receptors Used:

(107) CD16a is an activating receptor that has a V/F polymorphism at position 158 at the Fc binding site. The affinity is better for CD16aV. CD16aV is commercially available (R&D system).

(108) CD32a is an activating receptor that has an H/R polymorphism at position 131 at the Fc binding site. Affinity is better for CD32aH. CD32aH was produced by PX'Therapeutics. CD32aR and CD32b are commercially available (R&D system).

(109) 2. ELISA Assays of IgG Variants Produced in the Supernatants of HEK293-F Cells:

(110) IgG variants were tested for binding to several human FcR and FcR by ELISA. Maxisorp immunoplates were coated with 0.1 μg CD32aH/well, or 0.2 μg CD16a/well in PBS or 0.25 μg FcRn in P6 (100 mM sodium phosphate, 50 mM sodium chloride pH6.0). NiNTA plates (HisGrab Pierce) were coated with 0.05 μg CD32aR/well, or 0.2 μg CD32b/well in PBS. After coating overnight at 4° C., the plates were washed twice with PBS (or P6)/0.05% Tween-20 and saturated with PBS/4% BSA (or P6 4% skim-milk) for 2 hours at 37° C. In parallel, the supernatants were diluted in PBS (or P6 for the FcRn test) to a final concentration of 0.5 μg of IgG/ml and mixed with F(ab′)2 of IgG HRP from goat anti-human at the same concentration for 2 hours at room temperature. IgG aggregated with F(ab′)2 are then incubated with gentle shaking for 1 hour at 30° C. on saturated ELISA plates without dilution for CD16aV, CD32aR and CD32b (i.e. IgG at 0.5 μg/ml), diluted in PBS at 0.25 μg/ml for CD32aH and diluted in P6 at 0.035 μg/ml for FcRn. The plates are then revealed with TMB (Pierce) and the absorbance is read at 450 nm.

(111) Using this ELISA test, the constructed variants were tested in comparison with the wild-type Fc (Fc-WT) and their variant/Fc-WT ratio was calculated, as indicated in Table 2 below. The ELISA tests performed on these variants show a ratio greater than 2 for at least one of the FcγRs tested.

(112) TABLE-US-00003 TABLE 2 ELISA CD16aV, CD32aH, CD32aR and CD32b receptor binding assays. The results are expressed in an Fc ratio variant according to the invention/Fc-WT Variant ELISA test results name Mutations CD16aV CD32aH CD32aR CD32b ZAC1-36 V240H 1.91 2.00 0.82 0.78 ZAC1-136 V240I 3.91 3.59 1.71 1.45 ZAC1-123 V240M 4.10 2.16 1.08 1.03 ZAC1-78 V240N 2.44 1.42 0.64 0.89 ZAC1-226 V240S 3.82 2.51 0.82 0.81 ZAC1-100 F241H 0.77 3.47 1.44 1.44 ZAC1-220 F241Y 1.60 5.50 1.84 1.10 ZAC1-134 L242A 3.75 3.06 1.75 1.41 ZAC1-121 L242F 5.89 5.31 1.47 1.38 ZAC1-110 L242G 4.40 2.71 1.43 1.35 ZAC1-150 L242H 1.19 2.04 1.14 1.36 ZAC1-09 L242I 5.11 4.99 1.77 1.58 ZAC1-66 L242K 7.27 2.87 3.04 1.32 ZAC1-17 L242P 1.47 2.50 1.19 1.14 ZAC1-224 L242S 3.34 2.00 0.88 0.91 ZAC1-229 L242T 1.49 2.11 1.65 1.40 ZAC1-177 L242V 2.49 6.68 1.96 1.70 ZAC1-08 F243L 5.15 2.23 1.60 1.46 ZAC1-115 F243S 2.25 1.48 1.50 1.38 ZAC2-158 E258G 1.16 6.81 1.45 1.29 ZAC2-167 E258I 2.03 6.78 1.83 1.29 ZAC2-30 E258M 1.28 4.52 1.56 1.52 ZAC2-111 E258Q 1.88 8.75 1.55 0.85 ZAC2-210 E258R 1.66 8.17 3.70 2.60 ZAC2-86 E258Y 1.53 5.86 2.30 2.70 ZAC2-150 V259C 1.23 2.91 2.03 1.44 ZAC2-74 V259I 1.06 2.20 1.47 1.10 ZAC2-180 V259L 1.19 3.08 2.14 1.84 ZAC2-85 T260A 4.68 3.89 1.65 1.55 ZAC2-36 T260H 1.16 2.43 1.19 0.91 ZAC2-114 T260I 1.91 7.06 1.46 1.00 ZAC2-250 T260M 1.06 3.80 1.29 1.71 ZAC2-162 T260N 0.94 2.99 1.57 1.27 ZAC2-124 T260R 1.09 3.45 2.60 1.42 ZAC2-110 T260S 1.44 3.71 1.74 0.91 ZAC2-258 T260W 1.49 3.54 1.40 1.24 ZAC2-226 V262A 0.91 5.84 3.78 2.42 ZAC2-153 V262S 1,01 3.64 1.14 1.03 ZAC2-39 V263T 1.13 4.80 1.27 1.01 ZAC2-107 V264L 0.82 2.67 2.13 1.34 ZAC2-42 V264S 0.67 1.40 2.30 2.07 ZAC2-156 V264T 0.91 6.24 1.86 1.42 ZAC2-148 V266L 1.12 2.10 4.67 3.68 ZAC2-122 V266M 0.47 0.34 2.44 2.32 ZAC2-225 S267A 1.26 4.26 5.82 4.75 ZAC2-64 S267Q 0.63 0.43 2.49 3.00 ZAC2-121 S267V 0.59 0.29 2.36 2.02 ZAC3-172 K290Y 4.79 6.72 2.16 1.00 ZAC3-203 K290S 2.28 4.70 1.76 1.21 ZAC3-41 K290R 1.12 1.58 2.15 2.39 ZAC3-54 K290Q 2.47 3.85 1.52 1.50 ZAC3-246 K290N 1.36 3.22 1.71 NA ZAC3-62 K290L 1.51 2.65 1.35 0.63 ZAC3-70 K290H 3.49 6.48 2.64 1.66 ZAC3-83 K290G 4.20 5.78 1.86 1.83 ZAC3-174 K290E 2.83 4.89 1.66 1.83 ZAC3-182 K290D 2.04 3.38 2.23 NA ZAC3-185 P291R 0.64 2.57 1.93 NA ZAC3-08 P291Q 1.61 2.32 0.99 0.96 ZAC3-39 P291G 1.32 2.39 1.28 1.65 ZAC3-71 R292L 1.67 2.22 0.71 0.41 ZAC3-13 R292I 0.81 2.19 0.48 0.53 ZAC3-15 E293T 0.41 1.40 2.07 1.81 ZAC3-10 E293S 1.02 2.95 1.18 1.51 ZAC3-120 E293Q 1.78 2.17 1.49 NA ZAC3-126 E293M 1.32 2.42 1.81 NA ZAC3-61 E293G 0.48 1.37 2.44 0.89 ZAC3-178 E293D 0.79 2.68 1.80 NA ZAC3-196 E293A 0.89 2.99 1.91 NA ZAC3-66 E294V 1.00 1.91 3.03 0.93 ZAC3-105 E294T 0.80 2.34 1.13 NA ZAC3-02 E294R 0.71 0.90 2.09 1.58 ZAC3-80 E294Q 0.88 1.26 2.78 1.01 ZAC3-82 E294P 0.87 1.32 2.43 0.70 ZAC3-53 E294G 0.57 3.30 2.34 0.52 ZAC3-118 E294A 1.86 5.10 1.57 1.25 ZAC3-254 Q295M 1.74 2.81 1.10 NA ZAC3-48 Q295I 0.92 5.36 1.29 0.58 ZAC3-42 Y296W 3.83 1.49 1.20 1.60 ZAC3-110 Y296H 2.17 0.86 0.98 NA ZAC4-192 S298A 5.53 0.24 0.48 0.51 ZAC4-130 S298R 4.37 0.66 1.09 0.66 ZAC4-233 Y300I 0.69 2.25 1.01 1.04 ZAC4-14 Y300V 0.76 2.37 0.78 2.05 ZAC4-71 Y300W 0.87 2.34 1.14 1.06 ZAC4-187 R301A 0.81 1.25 2.06 2.11 ZAC4-218 R301M 0.95 1.22 1.78 2.07 ZAC4-255 R301P 0.63 4.64 0.06 0.24 ZAC4-03 R301S 1.29 2.42 1.16 1.06 ZAC4-268 V302A 1.00 2.38 1.86 3.09 ZAC4-131 V302F 0.76 2.82 1.06 0.71 ZAC4-237 V302L 0.46 0.31 3.15 4.69 ZAC4-53 V302M 0.63 1.50 2.25 1.56 ZAC4-236 V302R 0.45 0.38 5.08 10.56  ZAC4-29 V302S 1.10 2.51 1.87 1.71 ZAC4-208 V303S 0.96 1.39 1.64 2.27 ZAC4-144 V303Y 1.00 3.50 2.10 1.03 ZAC4-219 S304T 0.98 1.82 2.14 2.34 ZAC4-33 V305A 0.55 1.00 2.20 2.04 ZAC4-229 V305F 1.34 1.11 2.15 2.40 ZAC4-262 V305I 1.22 1.26 1.87 2.22 ZAC4-139 V305L 1.19 2.72 1.87 0.82 ZAC4-36 V305R 1.33 3.50 1.71 2.42 ZAC4-179 V305S 1.29 1.65 2.03 1.66

Example 3: Binding Tests for Purified IgG Variants on Fc Receptors

(113) 1. ELISA Binding Tests of Purified IgG Variants:

(114) The variants produced in the HEK293-F cell supernatants as described in Example 1, were purified by a conventional protein A affinity chromatography method.

(115) The constructed and purified variants were tested in comparison with wild-type Fc (Fc-WT), according to the protocols below. Their variant/Fc-WT ratio was calculated as shown in Table 3 below.

(116) Human FcRn Binding (hFcRn):

(117) Maxisorp immunoplates were coated with FcRn in pH6 phosphate buffer (250 ng per well) overnight at 4° C. (100 μl/well). After saturation of the plates for 2 hours in pH6 phosphate buffer and 5% skimmed milk, the variant IgG solutions were added to each well at increasing concentrations (from 0.00488 to 10 μg/ml) for 1 h at 37° C., then were contacted with IgG HRP goat anti-Fab human F(ab′)2 for 1 h at 37° C. The bound IgGs were detected after revelation at TMB by absorbance measurement at 450 nm.

(118) Human CD64 Binding (hCD64):

(119) Maxisorp immunoplates were coated with the human CD64 receptor (100 ng/well) overnight at 4° C. (100 μl/well). After saturation of the plates for 2 hours in PBS buffer and 4% BSA, the variant IgG solutions were added to each well at increasing concentrations (0.03125 to 1 μg/ml) for 1 h at 37° C. and then placed in contact with goat anti-CK human F(ab′)2 of IgG HRP for 1 h at 37° C. The bound IgG were detected after revelation at TMB by absorbance measurement at 450 nm.

(120) Linkage to Human FcγRs:

(121) Maxisorp immunoplates were coated with 50 ng hCD32aH/well, 200 ng hCD16aF/well or 75 ng hCD16aV/well in PBS. Immobilizing nickel chelating plates (Hisgrab Pierce) were coated with 50 ng hCD32aR/well or 100 ng hCD32b/well in PBS. After coating overnight at 4° C., the plates were washed twice with PBS/0.05% Tween-20 and saturated with PBS/4% BSA for 2 hours at 37° C. In parallel, the variant IgG solutions were diluted in PBS to a final concentration of 1 μg of IgG/ml and mixed with F(ab′)2 of IgG HRP of goat anti-Fab at the same concentration for 2 hours at room temperature. The F(ab′)2 aggregated IgG were then incubated with gentle shaking for 1 hour at 30° C. on saturated ELISA plates at different dilutions in PBS. Plates were then revealed with TMB and the absorbance read at 450 nm.

(122) TABLE-US-00004 TABLE 3 hCD16aV, hCD16aF, hCD32aH, hCD32aR, hCD32b, hCD64 and hFcRn ELISA receptor binding tests with purified variants. The results are expressed in Fc ratio variant according to the invention/Fc-WT hCD16aV hCD16aF hCD64 Ratio at Ratio at Ratio at 0.25 μg/ml 0.25 μg/ml 0.5 μg/ml Variant name Mutations AVERAGE AVERAGE AVERAGE A3A-184A K334N/P352S/ 3.53 ± 0.15 2.19 ± 0.36 2.11 ± 0.26 A378V/V397M A3A-184E Y296W/K334N/ 4.58 ± 0.83 4.27 ± 0.13 1.54 ± 0.18 P352S/A378V/ V397M ZAC3-42 Y296W 2.36 ± 0.07 1.63 ± 0.11 0.91 ± 0.13 ZAC3-83 K290G 1.91 ± 0.10 1.43 ± 0.22 1.18 ± 0.33 ZAC2-210 E258R 1.44 ± 0.97 1.26 ± 0.38 0.97 ± 0.14 ZAC2-226 V262A 0.53 ± 0.10 0.77 ± 0.06 0.80 ± 0.05 hFcRn hCD32aR hCD32b hCD32aH Ratio at Ratio at Ratio at Ratio at 1.25 μg/ml 0.125 μg/ml 0.125 μg/ml 0.25 μg/ml Variant name Mutations AVERAGE AVERAGE AVERAGE AVERAGE A3A-184A K334N/P352S/ 11.31 ± 1.48  1.42 ± 0.14 1.96 ± 0.20 1.73 ± 0.09 A378V/V397M A3A-184E Y296W/K334N/ 9.45 ± 1.02 1.33 ± 0.04 1.79 ± 0.47 1.73 ± 0.07 P352S/A378V/ V397M ZAC3-42 Y296W 0.90 ± 0.14 1.01 ± 0.04 1.14 ± 0.25 1.01 ± 0.19 ZAC3-83 K290G 0.93 ± 0.14 1.17 ± 0.06 1.31 ± 0.11 1.23 ± 0.03 ZAC2-210 E258R 0.79 ± 0.45 0.53 ± ND  0.68 ± ND  1.22 ± 0.45 ZAC2-226 V262A 0.60 ± 0.32 0.48 ± ND  0.63 ± ND  0.73 ± 0.00

(123) 2. Octet® Binding Assays (BLI “Bio-Layer Interferometry” Technology, Pall):

(124) Anti Penta-HIS Biosensors (HIS 1K) are used. The hCD16aV receptor (R&D Systems) diluted to 1 μg/ml is immobilized in Kinetics Buffer, i.e. 44 nM. The variant IgG were tested at 1000, 500, 250, 125, 62.5, 31.25, 15 and 0 nM in Kinetics Buffer. KD analysis was performed using a 1:1 association model.

(125) The results are shown in Table 4.

(126) TABLE-US-00005 TABLE 4 Octet ® binding assays with purified variants KD hCD16aV [BLI] Ratio KD Variant name Mutations (nM) WT/variant A3A-184A K334N/P352S/ 47 12.39 A378V/V397M A3A-184E Y296W/K334N/ 80 7.25 P352S/A378V/ V397M ZAC3-42 Y296W 288 2.02 ZAC3-83 K290G 326 1.78 ZAC2-210 E258R 411 1.41 ZAC1-08 F243L 472 1.23 ZAC2-85 T260A 472 1.23 ZAC1-123 V240M 491 1.18 ZAC1-121 L242F 512 1.13 ZAC2-226 V262A 518 1.12 ZAC1-110 L242G 541 1.07 Fc-WT SEQ ID NO: 1 580 1.00

Example 3: Production of Additional IgG Variants in HEK293 Cells

(127) Combinations of mutants comprising at least one mutation i) according to the invention were produced from an Fc fragment comprising the N315D/A330V/N361D/A378V/N434Y (T5A-74 mutant) or V259I/N315D/N434Y (C6A_74 mutant) or N315D/N361D/A378V/N434Y (T5A_74A mutant) or K334N/P352S/V397M/A378V (A3A_184A mutant). They are shown in Table 5.

(128) TABLE-US-00006 TABLE 5 Additional variants generated in the context of the invention Mutation i) according Va to the Starting invention List of mutations Name variant added combined T5A-74I T5A-74 T260A T260A/N315D/A330V/ N361D/A378V/N434Y T5A-74J T5A-74 E258I E258I/N315D/A330V/ N361D/A378V/N434Y T5A-74K T5A-74 K290Y K290Y/N315D/A330V/ N361D/A378V/N434Y T5A-74L T5A-74 E294A E294A/N315D/A330V/ N361D/A378V/N434Y T5A-74M T5A-74 Y296W Y296W/N315D/A330V/ N361D/A378V/N434Y C6A_74W C6A_74 Y296W Y296W/V259I/N315D/ N434Y C6A_74G C6A_74 K290G K290G/V259I/N315D/ N434Y T5A-74MA T5A_74A Y296W Y296W/N315D/N361D/ A378V/N434Y T5A_74AG T5A_74A K290G K290G/N315D/N361D/ A378V/N434Y A3A_184AY A3A_184A N434Y N434Y/K334N/P352S/ V397M/A378V A3A_184E A3A_184A Y296W Y296W/K334N/P352S/ V397M/A378V A3A_184AG A3A_184A K290G K290G/K334N/P352S/ V397M/A378V