BINDING PROTEIN TARGETING HER2, PREPARATION METHOD AND USE THEREOF
20230355814 · 2023-11-09
Inventors
- Jiong LI (Chengdu, CN)
- Nongyu HUANG (Chengdu, CN)
- Yang CAO (Chengdu, CN)
- Yuquan Wei (Chengdu, CN)
- Yang Zhang (Chengdu, CN)
Cpc classification
A61K51/088
HUMAN NECESSITIES
International classification
Abstract
Provided are a binding protein targeting HER2, a preparation method and use thereof. The binding protein includes the following amino acid sequence (a): NDEMRX.sub.1TYW X.sub.2IALF X.sub.3 X.sub.4ML X.sub.5N X.sub.6X.sub.7KR X.sub.8 X.sub.9IR X.sub.10LYDDP X.sub.11X.sub.12A X.sub.13 X.sub.14LEX.sub.15 X.sub.16A X.sub.17LEA X.sub.18 X.sub.19 X.sub.20. The binding protein can bind to HER2 and has an excellent affinity with HER2. A radionuclide molecular imaging probe may be prepared by means of nuclide labeling, and it can be used in the molecular imaging diagnosis and improve the tumor imaging diagnosis to a molecular level of specific expression of tumor cells, and the HER2 expression in possible tumor lesions in vivo can be monitored in real time before a treatment scheme is determined or in the process of monitoring a medicament treatment progress.
Claims
1. A binding protein targeting HER2, the binding protein comprising the following amino acid sequence (a): NDEMRX.sub.1TYW X.sub.2IALF X.sub.3 X.sub.4L X.sub.5N X.sub.6X.sub.7KR X.sub.8 X.sub.9IR X.sub.10LYDDP X.sub.11X.sub.12A X.sub.13 X.sub.14LEX.sub.15 X.sub.16A X.sub.17LEA X.sub.18 X.sub.19 X.sub.20, wherein: X.sub.1 is E, D, T, S, Q, V, A, H, I, L, M, or R; X.sub.2 is E, D, T, S, Q, V, A, H, I, L, M, or R; X.sub.3 is A, G, T, S, Q, N, or V; X.sub.4 is A, G, T, S, Q, V, or P; X.sub.5 is E, T, S, Q, V. A, K, H, I, L, M, or R; X.sub.6 is E, T, S, Q, V, A, K, H, I, L, M, or R; X.sub.7 is E, T, S, Q, V, D, K, H, I, L, M, or R; X.sub.8 is A, T, S, Q, V, D, K, H, I, L, M, or R; X.sub.9 is either Y or F; X.sub.10 is E, D, T, S, Q, V, A, H, I, L, M, or R; X.sub.11 is A, G, S, or T; X.sub.12 is E, D, T, S, V, A, K, H, I, L, M, or R; X.sub.13 is D, T, S, Q, V, A, K, H, I, L, M, or R; X.sub.14 is E, T, S, Q, V, A, K, H, I, L, M, or R; X.sub.15 is E, D, T, S, Q, V, A, H, I, L, M, or R; X.sub.16 is F, D, T, S, Q, V, K, H, I, L, M, or R; X.sub.17 is E, D, T, S, Q, V, A, H, L, M, or R; X.sub.18 is E, D, T, S, Q, V, A, K, H, I, L, M, or R; X.sub.19 is E, D, T, S, Q, V, A, K, H, I, L, M, or R; and X.sub.20 is V, I, L, or M.
2. The binding protein according to claim 1, wherein the amino acid sequence of the binding protein further comprises an amino acid sequence having at least 70% homology to the amino acid sequence (a).
3. The binding protein according to claim 1, wherein the amino acid sequence of the binding protein further comprises an amino acid sequence obtained by substituting, deleting, or adding 1 to 10 amino acids in the amino acid sequence (a).
4. The binding protein according to claim 3, wherein the substituted, deleted, or added amino acids in the amino acid sequence (a) are not at at least one of positions 4, 5, 7, 8, 9, 11, 12, 13, 14, 17, 19, 22, 23, 26, 27, 30, 31, 32, 33, 36, 39, 40, 43, or 47 in the amino acid sequence (a).
5. The binding protein according to claim 1, wherein in the amino acid sequence (a) comprised in the binding protein: X.sub.1 is I, L, M, or R; X.sub.2 is E, A, H, I, L, M, or R; X.sub.3 is A, S, Q, N, or V; X.sub.4 is A, S, Q, V, or P; X.sub.5 is E, T, S, Q, L, M, or R; X.sub.6 is E, T, S, Q, L, M, or R; X.sub.7 is H, I, L, M, or R; X.sub.8 is A, T, S, Q, M, or R; X.sub.9 is either Y or F; X.sub.10 is H, I, L, M, or R; X.sub.11 is A, G, S, or T; X.sub.12 is H, I, L, M, or R; X.sub.13 is D, T, S, Q, L, M, or R; X.sub.14 is E, T, S, I, L, M or R; X.sub.15 is E, D, I, L, M, or R; X.sub.16 is Q, V, K, H, I, L, M, or R; X.sub.17 is E, D, T, S L, M, or R; X.sub.18 S, Q, V, A, K, M, or R; X.sub.19 is V, A, K, H, M, or R; and X.sub.20 is V, I, L, or M.
6. The binding protein according to claim 1, wherein in the amino acid sequence (a) comprised in the binding protein: X.sub.1 is I; X.sub.2 is E, A, or H; X.sub.3 is A or Q; X.sub.4 is A or P; X.sub.5 is E; X.sub.6 is E; X.sub.7 is H; X.sub.8 is A; X.sub.9 is Y; X.sub.10 is R; X.sub.11 is S; X.sub.12 is R; X.sub.13 is D; X.sub.14 is E; X.sub.15 is E; X.sub.16 is K; X.sub.17 is E or R; X.sub.18 is K; X.sub.19 is A; and X.sub.20 is M.
7. A protein derivative capable of targeting HER2, the protein derivative being formed by an amino acid sequence obtained by substituting, deleting, or adding 1 to 10 amino acids in the amino acid sequence (a) as defined in claim 1.
8. A fusion protein, comprising a dimer or polymer formed by the binding proteins according to claim 1.
9. A polynucleotide, encoding the binding protein according to claim 1.
10. A derivative, being a derivative formed by binding, conjugating, or labeling the binding protein according to claim 1.
11. An expression vector, comprising the polynucleotide according to claim 9.
12. A host cell, comprising the expression vector according to claim 11.
13. A preparation method for a binding protein targeting HER2, the preparation method comprising: preparing DNA molecules encoding the binding protein according to claim 1; preparing an expression vector for the DNA molecules; introducing the expression vector into host cells; and expressing a target binding protein.
14. A preparation method for a medicament or reagent for diagnosis or treatment of a tumor, the preparation method comprising: preparing the medicament or reagent with the binding protein targeting HER2 prepared by the method according to claim 13, wherein: the medicament or reagent is a molecular imaging probe, a developing preparation of the molecular imaging probe comprising any one of a radionuclide, a radionuclide marker, or a molecular imaging preparation; and the tumor comprises a HER2-positive early-stage breast cancer, a HER2-positive metastatic breast cancer or a HER2-positive metastatic gastric cancer.
15. A molecular imaging probe, comprising: the binding protein according to claim 1; and a developing preparation, wherein the binding protein is conjugated to the developing preparation, wherein the developing preparation is selected from any one of a radionuclide, a radionuclide marker, or a molecular imaging preparation; and optionally, the developing preparation is selected from .sup.68Ga, .sup.18F, or .sup.99mTc.
16. (canceled)
17. A method for monitoring cancer progression, comprising: measuring a change in HER2 expression of a patient's tumor lesion in real time using the molecular imaging probe according to claim 15 or 16, to determine the cancer progression, wherein the cancer comprises a HER2-positive early-stage breast cancer, a HER2-positive metastatic breast cancer or a HER2-positive metastatic gastric cancer.
18. (canceled)
19. (canceled)
20. A method for diagnosing a cancer associated with HER2 expression, the method comprising: administering the molecular imaging probe according to claim 15 to a subject; and diagnosing, by means of molecular imaging diagnosis, whether the subject has the cancer associated with HER2 expression, wherein the method further comprises locating a patient's diseased site by using the molecular imaging probe; wherein the patient is suspected of having a cancer associated with HER2 expression; wherein the subject is suspected of having a HER2-positive early-stage breast cancer, a HER2-positive metastatic breast cancer or a HER2-positive metastatic gastric cancer.
21. Use of the molecular imaging probe according to claim 15 in the monitoring of a medicament treatment progress of a patient, wherein the patient has a HER2-positive early-stage breast cancer, a HER2-positive metastatic breast cancer or a HER2-positive metastatic gastric cancer.
22. A clinical medication guidance method for a patient having a cancer, the method comprising: comparing changes in HER2 expression of a tumor lesion of the patient before and after medication, to determine an effectiveness of a medicament; and performing clinical medication guidance, wherein the cancer comprises a HER2-positive early-stage breast cancer, a HER2-positive metastatic breast cancer or a HER2-positive metastatic gastric cancer.
23. (canceled)
24. A method for screening a medicament for the treatment of a cancer, the method comprising: administering a candidate medicament to a patient having a cancer associated with HER2 expression; comparing changes in HER2 expression in a tumor lesion of the patient before and after medication, to screen the medicament for the treatment of the cancer, wherein the patient has a HER2-positive early-stage breast cancer, a HER2-positive metastatic breast cancer or a HER2-positive metastatic gastric cancer.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0037] In order to clearly explain the technical solutions in the embodiments of the present application, the accompanying drawings required to be used in the description of the embodiments are briefly described below.
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
DETAILED DESCRIPTION
[0046] In order to clarify the objects, technical solutions and advantages of the present disclosure, the technical solutions of the present disclosure are clearly and thoroughly described below. Those technical solutions without specifying conditions in the following examples are usually carried out in accordance with conventional conditions or conditions suggested by manufacturers. The used reagents or instruments, the manufacturers of which are not specified, are conventional products that are commercially available.
[0047] The technical solutions of the present disclosure are described in detail below.
[0048] The present disclosure provides a binding protein targeting HER2, the binding protein including the following amino acid sequence (a): NDEMRX.sub.1TYW X.sub.2IALF X.sub.3 X.sub.4L X.sub.5N X.sub.6X.sub.7KR X.sub.8 X.sub.9IR X.sub.10LYDDP X.sub.11X.sub.12A X.sub.13 X.sub.14LEX.sub.15 X.sub.16A X.sub.17LEA X.sub.18 X.sub.19 X.sub.20. Preferably, X.sub.1 is E, D, T, S, Q, V, A, H, I, L, M, or R; X.sub.2 is E, D, T, S, Q, V, A, H, I, L, M, or R; X.sub.3 is A, G, T, S, Q, N, or V; X.sub.4 is A, G, T, S, Q, or P; X.sub.5 is E, T, S, Q, V, A, K, H, I, L, M, or R; X.sub.6 is E, T, S, Q, V, A, K, H, I, L, M, or R; X.sub.7 is E, T, S, Q, V, D, K, H, L, M, or R; X.sub.8 is A, T, S, Q, V, D, K, H, I, L, M, or R; X.sub.9 is either Y or F; X.sub.10 is E, D, T, S, Q, V, A, H, I, L, M, or R; X.sub.11 is A, G, S, or T; X.sub.12 is E, D, T, S, V, A, K, H, I, L, M, or R; X.sub.13 is D, T, S, Q, V, A, K, H, I, L, M, or R; X.sub.14 is E, T, S, Q, V, A, K, H I, L, M, or R; X.sub.15 is E, D, T, S, Q, V, A, H, I, L, M, or R; X.sub.16 is E, D, T, S, Q, V, K, H, I, L, M, or R; X.sub.17 is E, D, T, S, Q, V, A, H, I, L, M, or R; X.sub.18 is E, D, T, S, Q, V, A, K, H, I, L, M, or R; X.sub.19 is E, D, T, S, Q, V, A, K, H, I, L, M, or R; and X.sub.20 is V, I, L, or M.
[0049] Preferably, the amino acid sequence of the binding protein further includes an amino acid sequence having at least 70% homology to the amino acid sequence (a). Preferably, the amino acid sequence of the binding protein further includes an amino acid sequence having at least 80% homology to the amino acid sequence (a). Preferably, the amino acid sequence of the binding protein further includes an amino acid sequence having at least 90% homology to the amino acid sequence (a). Preferably, the amino acid sequence of the binding protein further includes an amino acid sequence having at least 95% homology to the amino acid sequence (a).
[0050] Preferably, the amino acid sequence of the binding protein further includes an amino acid sequence obtained by substituting, deleting, or adding 1 to 10 amino acids in the amino acid sequence (a). Preferably, the amino acid sequence of the binding protein further includes an amino acid sequence obtained by substituting, deleting, or adding 1 to 8 amino acids in the amino acid sequence (a). Preferably, the amino acid sequence of the binding protein further comprises an amino acid sequence obtained by substituting, deleting, or adding 1 to 5 amino acids in the amino acid sequence (a).
[0051] Preferably, the substituted, deleted, or added amino acids in the amino acid sequence (a) are not at Bind She least one of positions 4, 5, 7, 8, 9, 11, 12, 13, 14, 17, 19, 22, 23, 26, 27, 30, 31, 32, 33, 36, 39, 40, 43, or 47 in the amino acid sequence (a).
[0052] According to an embodiment of the present disclosure, in the amino acid sequence (a) includes in the binding protein, X.sub.1 is I, L, M, or R; X.sub.2 is E, A, H, I, L, M, or R; X.sub.3 is A, S, Q, N, or V; X.sub.4 is A, S, Q, V or P; X.sub.5 is E, T, S, Q, L, M, or R; X.sub.6 is E, T, S, Q, L, M, or R; X.sub.7 is H, I, L, M, or R; X.sub.8 is A, T, S, Q, M, or R; X.sub.9 is either Y or F; X.sub.10 is H, I, L, M, or R; X.sub.11 is A, G, S, or T; X.sub.12 is H, I, L, M, or R; X.sub.13 is D, T, S, Q, L, M, or R; X.sub.14 is E, T, S, I, L, M or R; X.sub.15 is E, D, I, L, M, or R; X.sub.16 is Q, V, K, H, I, L M, or R; X.sub.17 is E, D T, S, L, M, or R; X.sub.18 is S, Q, V, A, K, M, or R; X.sub.19 is V, A, K, H, M, or R; and X.sub.20 is V, I, L, or M.
[0053] According to an embodiment of the present disclosure, in the amino acid sequence (a) included in the binding protein, X.sub.1 is I; X.sub.2 is E, A, or H; X.sub.3 is A or Q; X.sub.4 is A or P; X.sub.5 is E; X.sub.6 is E; X.sub.7 is H; X.sub.8 is A; X.sub.9 is Y; X.sub.10 is R; X.sub.11 is S; X.sub.12 is R; X.sub.13 is D; X.sub.14 is E; X.sub.15 is E; X.sub.16 is K; X.sub.17 is E or R; X.sub.18 is K; X.sub.1 is A; and X.sub.20 is M.
[0054] The present disclosure further provides a protein derivative capable of targeting HER2, the protein derivative being formed by an amino acid sequence obtained by substituting, deleting, or adding 1 to 10 (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, and 10) amino acids in the amino acid sequence (a).
[0055] The present disclosure further provides a fusion protein, including a dimer or polymer formed by said binding proteins.
[0056] The present disclosure further provides a polynucleotide, encoding said binding protein.
[0057] The present disclosure further provides a derivative, which is a derivative formed by binding, conjugating, or labeling said binding protein.
[0058] The present disclosure further provides an expression vector, including said polynucleotide.
[0059] The present disclosure further provides a host cell, including said expression vector.
[0060] The present disclosure further provides a preparation method of a binding protein targeting HER2, the preparation method including: preparing DNA molecules encoding said binding protein; preparing an expression vector for the DNA molecules; introducing the expression vector into host cells; and expressing a target binding protein.
[0061] The present disclosure further provides use of said binding protein targeting HER2 in the preparation of a medicament or reagent for the diagnosis or treatment of a tumor. The medicament or reagent is a molecular imaging probe, and a developing preparation of the molecular imaging probe includes any one of a radionuclide, a radionuclide marker, or a molecular imaging preparation. The tumor includes a HER2-positive early-stage breast cancer, a HER2-positive metastatic breast cancer or a HER2-positive metastatic gastric cancer.
[0062] The present disclosure further provides a molecular imaging probe, including said binding protein and a developing preparation. The binding protein is conjugated to the developing preparation.
[0063] According to an embodiment of the present disclosure, the developing preparation is selected from any one of a radionuclide, a radionuclide marker, or a molecular imaging preparation; and optionally, the developing preparation is selected from .sup.68Ga, .sup.18F, or .sup.99mTc.
[0064] The present disclosure further provides a method for monitoring cancer progression. The method includes: a change in HER2 expression of a patient's tumor lesion in real time using said molecular imaging probe, to determine the cancer progression. The cancer includes a HER2-positive early-stage breast cancer, a HER2-positive metastatic breast cancer or a HER2-positive metastatic gastric cancer.
[0065] The present disclosure further provides use of said molecular imaging probe in the localization of a patient's diseased site. The patient is suspected of having a cancer associated with HER2 expression.
[0066] The present disclosure further provides use of said molecular imaging probe in the diagnosis of a cancer associated with HER2 expression.
[0067] The present disclosure further provides a method for diagnosing a cancer associated with HER2 expression. The method includes: administering said molecular imaging probe to a subject; and diagnosing, by means of molecular imaging diagnosis, whether the subject has the cancer associated with HER2 expression. The subject is suspected of having a HER2-positive early-stage breast cancer, a HER2-positive metastatic breast cancer or a HER2-positive metastatic gastric cancer.
[0068] The present disclosure further provides use of said molecular imaging probe in the monitoring of a medicament treatment progress of a patient. The patient has a HER2-positive early-stage breast cancer, a HER2-positive metastatic breast cancer or a HER2-positive metastatic gastric cancer.
[0069] The present disclosure further provides a clinical medication guidance method for a patient having a cancer. The method includes: comparing changes in HER2 expression of a tumor lesion of the patient before and after medication, to determine an effectiveness of a medicament; and performing clinical medication guidance. The cancer includes a HER2-positive early-stage breast cancer, a HER2-positive metastatic breast cancer or a HER2-positive metastatic gastric cancer.
[0070] The present disclosure further provides use of said molecular imaging probe in the screening of a medicament for the treatment of a cancer. The cancer includes a HER2-positive early-stage breast cancer, a HER2-positive metastatic breast cancer or a HER2-positive metastatic gastric cancer.
[0071] The present disclosure further provides a method for screening a medicament for the treatment of a cancer. The method including: administering a candidate medicament to a patient having a cancer associated with HER2 expression; comparing changes in HER2 expression in a tumor lesion of the patient before and after medication, to screen the medicament for the treatment of the cancer. The patient has a HER2-positive early-stage breast cancer, a HER2-positive metastatic breast cancer or a HER2-positive metastatic gastric cancer.
[0072] In the present disclosure, the term “BindHer” refers to proteins targeting HER2. The present disclosure further provides use of said binding protein targeting HER2 in the preparation of a medicament or reagent for the diagnosis or treatment of a tumor. The medicament or reagent is a molecular imaging probe, and a developing preparation of the molecular imaging probe includes any one of a radionuclide, a radionuclide marker, or a molecular imaging preparation. The tumor includes a HER2-positive early-stage breast cancer, a HER2-positive metastatic breast cancer or a HER2-positive metastatic gastric cancer.
[0073] The features and performances of the present disclosure are further described in detail in conjunction with examples.
EXAMPLE
[0074] Example 1: computer-assisting simulation and design of molecular HER2-targeting proteins
[0075] Based on a complex structure of HER2 (PDB: 3WSQ) or HER2-ZHER2:342 (PDB: 3MZW), protein design was performed by means of Evodesign software. In the second step of the design process, i.e., Monte Carlo simulation, assuming that a main chain structure is fixed and amino acid sequences of less than 10 sites on a binding surface of protein interactions are fixed, more than 40 other amino acids are randomly arranged and combined, and sequences capable of being folded into a target three-dimensional structure were screened. In the sequences generated by Monte Carlo simulation, hundreds of low free energy protein sequences were calculated and screened out as candidate proteins based on an energy function. Through the dynamic adjustment of interface residues, the combinations of interface residues with very low binding free energy were searched. For the analysis of candidate protein sequences, the possibility that the immunogenicity returns to the protein design process was optimized by means of MHC linear epitope recognition and antibody epitope recognition. Based on the sequences (arrangement and combination features, surface hydrophilicity, and hydrophobic kernel analysis) and structural methods, the possibility of aggregation is investigated. At last, 11 preferred amino acid sequences are screened out.
[0076] Example 2: screening of binding protein targeting HER2
[0077] 1. Target proteins were screen by using yeast surface display technology.
[0078] 1) Monoclonal yeast cells EBY100 were revived and picked into 5 mL of YPD medium, and cultured overnight at 30° C. at 220 rpm.
[0079] 2) 100 μl of yeast medium was pipetted into 5 mL of fresh YPD medium, and cultured overnight at 30° C. at 220 rpm;
[0080] 3) OD600 was measured on the next day, the yeast was diluted to OD600=0.2 with the fresh YPD medium, and further cultured at 30° C. for about 4 h until OD600=1.0 to 1.5;
[0081] 4) The yeasts were collected in a 50 ml centrifuge tube, centrifuged at 4° C., 2000 g for 5 min; a supernatant was discarded; 25 ml of pre-cooled sterile water was added; the yeasts were resuspended with a vortexer, centrifuged at 4° C. 2000 g for 5 min, and the supernatant was discarded.
[0082] 5) 5 ml of pre-cooled 0.1 M lithium acetate, which was filtered and sterilized, was added, followed by resuspending with the vortexer and centrifuging at 4° C., 2000 g for 5 min.
[0083] 6) The supernatant was discarded, 200 μl of pre-cooled 0.1 M lithium acetate was added, the precipitate was resuspended and then placed on ice, aliquoting into sterilized EP tubes with 100111 of resuspension solution per tube.
[0084] 7) Centrifugation was performed at 4° C., 2000 g for 5 min, the supernatant was carefully removed by pipetting, and 10 μl of salmon essence single-stranded DNA (boiled for 5 min and placed on ice for 2 min), 1 μg of plasmids, and 500 μl of yeast treatment solution (10 mM Tris PH=7.5, 100 nM lithium acetate, 0.4 mM EDTA, 40% PEG3350(w/v)) were added, followed by resuspending with the vortexer for well mixing.
[0085] 8) The resuspension solution was cultured statically at 30° C. for 30 min, followed by performing heat shock at 42° C. for 20 min, and placing on ice for 2 min.
[0086] 9) Centrifugation was performed at 2000 g for 5 min, the supernatant was discarded, 1 ml of YPD medium was added, and cultured at 30° C. with shaking for 1 to 2 h;
[0087] 10) Centrifugation was performed at 2000 g for 5 min, 1 ml of SDCAA medium was added and resuspended to obtain a resuspended product, 10 μl of the resuspended product was pipetted into 90 μl YPD, applying into a SDCAA plate, and a conversion rate was checked. 10 μl of bacterial solution was additionally pipetted into a liquid medium containing 5 ml of SDCAA, and cultured overnight at 30° C. at 220 rpm for flow cytometry.
[0088] 2. The targeting ability was detected by means of flow cytometry.
[0089] 1) OD value was measured on the next morning, 10 OD bacteria were pipetted and centrifuged at 2000 g for 5 min, and the supernatant was discarded; the cells were resuspended in 10 mL of fresh SDCAA medium until the OD reached 1, cultured at 30° C. till the OD reached 2 to 5, which was a logarithmic phase of yeasts.
[0090] 2) The yeast cells of 10 OD were pipetted and centrifuged at 900 g for 5 min, the supernatant was discarded, the cells were resuspended in 10 ml of SGCAA medium to allow the OD value to reach 1, and induced at 20° C. with shaking for 18 to 24 h.
[0091] 3) The corresponding volume of yeast cells was pipetted according to an amount of 10.sup.7/tube, centrifuged at 2000 g for 5 min, the supernatant was removed by pipetting, 5 ml of sterile PBS was added and mixed well, centrifuged at 2000 g for 5 min, the supernatant was removed by pipetting, 1 ml of sterile PBS was added for resuspending, followed by aliquoting into flow tubes.
[0092] 4) Centrifugation was performed at 2,000 g for 5 min, the supernatant was discarded, and 100 μl of liquid was left to resuspend the yeast thoroughly; Anti-cmyc was added at 0.5 μl/tube, and HER2-biotin was added at 1 μl/tube, followed by incubating in a shaker at room temperature for 30 min to ensure that the cells were in a suspended state.
[0093] 5) Centrifugation was performed at 4° C., 12,000 g for 30 s, the supernatant was removed by pipetting, 2 ml of pre-cooled PBS was added per tube, followed by resuspending and centrifuging, the cells were precipitated, 100 μl of pre-cooled PBS was added for resuspending, and then secondary antibodies were incubated: Goat Anti-Chicken IgG Antibody-Alexa Fluor 647 (1:100 in dilution, 1 μl/tube), Streptavidin-Alexa Fluor 488 (1:100 in dilution, 1 μl/tube).
[0094] 6) The resuspended cells were incubated on ice in the dark for 15 mm, and then centrifuged, and the supernatant was discarded; 2 ml of pre-cooled PBS was added for resuspending and then centrifuged, and the supernatant was discarded.
[0095] 7) 500 μl of 1% paraformaldehyde was added per tube, mixed well, kept at 4° C. for 30 min, followed by centrifuging and discarding the supernatant; 2 ml of pre-cooled PBS was added per tube to wash twice, and then 0.3 ml of pre-cooled PBS was added to fully resuspend the yeasts. The test samples were loaded on the machine.
[0096] Results in
[0097] The amino acid sequences having the capability of targeting HER2 respectively include:
TABLE-US-00002 amino acid sequence of artificially bound protein Seql1: (SEQ ID NO: 1) AEAKYNDEMRITYWEIALFAPLENEHKRAYIRRLYDDPSRADELEEKA ELEAKAMAQG; amino acid sequence of artificially bound protein Seq2: (SEQ ID NO: 2) AEAKYNEEMRITYWAIALFAPLENEHKRAYIRRLYDDPSRADELEEKA ELEAQAMAQG; amino acid sequence of artificially bound protein Seq3: (SEQ ID NO: 3) AEAKYNDEMRITYWHIALFAPLENEHKRAYIRRLYDDPSRADELEEKA RLEAKAMAQG; amino acid sequence of artificially bound protein Seq4: (SEQ ID NO: 4) AEAKYNDEMRITYWEIALFQALENEHKRAYIRRLYDDPSRADELEEKA ELEAKAMAQG; and amino acid sequence of artificially bound protein Seq5: (SEQ ID NO: 5) AEAKYNEEMRITYWAIALFQALENEHKRAYIRRLYDDPSRADELEEKA ELEAQAMAQG.
Example 3
[0098] This example relates to a preparation method for a binding protein targeting HER2 (BindHer).
[0099] 1. Gene synthesis and cloning construction of BindHer molecules
[0100] Gene synthesis was performed based on the amino acid sequences of the binding proteins obtained in Example 2 and having the capability of targeting HER2. Cysteine was introduced at a carboxyl end of BindHer to facilitate radionuclide labeling. For the convenience of expression, BindShe plasmids were subcloned into a pET29a vector to construct pET29a-BindShe plasmids. The plasmids were validated by enzyme digestion and sequenced using an automated sequencer. After it was validated that the vector had been successfully constructed, the vector was transformed into an E. coil BL21(DE3) expression strain.
[0101] 2. Expression and purification of recombinant protein
[0102] Monoclonal bacteria of E. coil BL21(DE3) containing pET29a-BindHer expression plasmids were inoculated into a kanamycin-containing LB liquid medium, cultured at 37° C. until an optical density (OD600 nm) reached 0.6 to 0.8; 0.1 μM of IPTG was added, induced overnight at 18° C.; a culture was collected by centrifugation (4500 rpm, 20 min), and the bacteria were collected and stored at −20° C.
[0103] The bacteria were suspended according to a volume ratio of wet bacteria to buffer (20 mM PB, 500 mM NaCl, pH 8.0) of 1:10, followed by performing ultrasonication for 30 min. After the ultrasonication of cells, the cells were centrifuged at 13,000 rpm for 30 min at 4° C., and the supernatant was collected; crude purification was performed on the supernatant by using 30 ml of affinity chromatography filler Chelating Sepharose™ Fast Flow (GE Healthcare Life Sciences, Sweden), desalt; and then further purification was performed by using cation exchange SP Sepharose™ Fast Flow (GE Healthcare Life Sciences, Sweden). The molecular weights thereof were analyzed by means of reduced SDS-polyacrylamide gel electrophoresis; and the purity was analyzed by means of non-reduced SDS-polyacrylamide gel electrophoresis and reversed-phase high performance liquid chromatography (RP-HPLC).
[0104] The results are shown in
Example 4
[0105] The affinity of BindHer for a HER2 protein is detected in this example.
[0106] The interactions between BindHer protein and HER2 was analyzed by means of surface plasmon resonance on a Biacore™ T200 system (GE Healthcare, USA).
[0107] 1) A recombinant HER2 extracellular domain (HER2-ECD) was fixed on a surface of a CM5 chip (amine coupling method). A HER2-ECD protein (10004-HCCH, Sino BiologicalInc., Beijing, China) was coupled by amines of a carboxylated dextran layer on the surface of a CMS sensing chip (BR-1000-12, GE Healthcare, USA).
[0108] a) Dextran surface activation: 0.4 M of N-ethyl-N′-(3-dimethylaminopropyl) carbodiimide and 0.1 M of N-hydroxysuccinimide were mixed in a ratio of 1:1 (vol/vol), running at a flow rate of 10 μL/min for 10 min.
[0109] b) HER2-ECD binding: 50 μg/mL HER2-ECD was taken and dissolved in a buffer of 10 mM acetic acid with pH of 4.5, running at a flow rate of 10 μL/min for 5 min.
[0110] c) The unbound HER2-ECD: 1 M of ethanolamine was removed, with pH of 8.5, running at a flow rate of 10 μL/min for 10 min, and the unbound HER2-ECD was removed. The signal of HER2 bound to the CM5 surface was approximately 2000 response units.
[0111] 2) Affinity detection
[0112] a) The protein to be detected was diluted with a buffer of 10 mM of HEPES and 150 mM of NaCl, with pH of 7.4, into different concentrations, and for each concentration, 10 μL/min was injected in 3 min; and then the system was equilibrated at 10 μL/min for 10 min.
[0113] b) Surface regeneration: 10 mM HCl with pH of 2.0, running at 10 μL/min for 2 min.
[0114] 3) Data processing:
[0115] A diagram was obtained by subtracting reference channel from the diagram obtained after the test samples arrived in the detection channel, reference correction was performed, and the obtained curve was described by using a 1:1 Lamgmuir model to fit a kinetic model. The Bia-evaluation analysis software was used for data processing, and the affinity kinetics of the test samples were calculated.
[0116] The results are shown in
Example 5
[0117] In the present example, the BindHer protein targets HER2-positive cells.
[0118] 1. Fluorescent labeling of BindHer protein
[0119] 1) Preparation of fluorescein: 4.273 mg of fluorescein-5-maleimide (62245, Thermo Fisher Scientific) was accurately weighed, 0.8 ml of DMSO was added for completely dissolving, and then the volume was adjusted to 1 ml, i.e., reaching a concentration of 10 mM, and the solution was stored in the dark.
[0120] 2) Pretreatment of protein: 1M TECP solution and BindHer protein solution were mixed well and then placed at room temperature for 1 h, and the final concentration of TECP was 10 mM; TECP was desalted and removed using NAP-5 (17085302, GE Healthcare) pre-equilibrated with 20 mM sodium phosphate, 150 mM NaCl, and pH 7.0 buffer, and a concentration was measured.
[0121] 3) Fluorescein-5-maleimide was added into the reaction system of BindHer protein at a molar amount of the fluorescein-5-maleimide to sulfhydryl groups to be coupled of 25:1, mixed well, and placed at room temperature for 2 h or overnight at 4° C. in the dark.
[0122] 4) The free fluorescein was desalted to remove with NAP-5 pre-equilibrated with 20 mM phosphate, 150 mM NaCl, and pH 7.0 buffer.
[0123] 5) Absorbance values were detected at wavelengths of 280 nm and 495 nm, respectively, and a fluorescent labeling rate and a protein concentration were calculated.
[0124] 2. Flow cytometry analysis of targeted binding
[0125] Conventionally HER2-positive cell lines SK-BR3 and BT474, and a negative cell line MDA-MB-231 were cultured. The cells in the logarithmic growth phase were collected by pancreatic digestion, washed with PBS three times. The cell suspension density was adjusted with PBS to 2×10.sup.6/ml, and 100 μl of each cell line was added into corresponding flow tubes. 100 μl of fluorescently labeled BindHer protein (100 nM) was added, incubated for 30 mM at room temperature. For a blocking group, 100-fold unlabeled BindShe protein was added prior to adding the fluorescently labeled BindShe protein, and incubated at 37° C. for 1 h. 3 ml of PBS was added and washed three times at 1500 rpm for 5 min. 300 μl of PBS was added at last. 10,000 cells were collected for loading on the machine, and detected at an excitation wavelength of 488 nm.
[0126] The results are shown in
[0127] In the Her2-positive cell line BT474 and SK-BR-3 cells, BindHer has an enhanced average fluorescence intensity relative to a blank control group and the blocking group, while the average fluorescence intensity is not enhanced in the Her2-negative cell line MDA-MB-231. It indicates that the binding effect of this probe against the HER2-positive cell lines depends on the binding specificity of BindShe molecules.
[0128] All the fluorescence signals of the BindHer protein molecular fluorescent probe binding to MDA-MB-231 cells are weak, indicating that the fluorescent labeled BindHer cannot specifically bind to HER2-negative MDA-MB-231 cells.
[0129] In summary, the BindHer protein fluorescent probes can specifically bind to BT474 and SK-BR-3 cells that highly express HER2, but unable to specifically bind to MDA-MB-231 cells serving as HER2-negative control.
Example 6
[0130] The thermal stability was analyzed in this example.
[0131] The samples were heated at 100° C. for 1 h, the detection was performed on a circular chromatograph (Aviv Model 400, Aviv Biomedical Inc., USA), and each sample and PBS control were detected in sequence, with setting parameters: temperature of 25° C., scanning wavelength ranging from 195 nm to 260 nm, and optical diameter of 2 mm.
[0132] The results are shown in
Example 7
[0133] The preparation of a .sup.99mTc-BindHer molecular probe and effects of specific binding to Her2 tumor exhibited in PET/CT imaging in a nude mouse with a HER2-positive cell transplant tumor are described in this example.
[0134] 1. Preparation of .sup.99mTc-BindHer molecular probe
[0135] 10 μl of sodium gluconate (1.28 mol/L), 10 μof EDTA (0.25 mol/L, pH 8.0), 10 μl of stannous chloride (5.6 mg/ml, prepared with 5% dilute hydrochloric acid), and 70 μl of BindHer protein (100 μg) were added into a labeling tube in sequence, and 100 μl of .sup.99mTcO4-solution (about 50 MBq) was added and mixed well, and incubated for 20 min at room temperature.
[0136] 2. Detection of labeling rate
[0137] With instant thin-layer chromatography-silica gel (iTLC-SG, SG10001), Rf of .sup.99mTcO4 was 1, and Rf of .sup.99mTc colloidal and Rf of technetium-labeled protein were 0, when using PBS as an developing agent; Rf of .sup.99mTcO4- and Rf of technetium-labeled protein were 1, and Rf of .sup.99mTc colloidal was 0, when using a developing agent of pyridine: glacial acetic acid: water=10:6:3. 1 μl of sample was taken and applied on a thin layer plate to generally form a dot. A distance between a baseline of sample application and a bottom edge was 1.0 to 1.5 cm, and a diameter of the sample dot was generally no more than 2 mm. The thin layer plate applied with the samples was placed into a small beaker with a developing agent. A depth of immersion into the developing agent was 5 mm from the origin. The beaker was sealed with a tin foil, and the thin layer plate was taken out when developing to a specified distance (generally 8 to 15 cm), and scanned with a y scanner to detect a radiological purity. The radiological purity of the .sup.99mTc-BindHer molecular probe was 98.4±0.38%.
[0138] 3. SPECT/CT imaging:
[0139] Female nude mice aged 4 to 6 weeks were purchased from Beijing Huafukang Biotechnology Company, and raised in an SPF nude mouse room of our laboratory animal center. The HER2-positive cell line SK-BR-3 and the HER2-negative cell line MDA-MB-231 were cultured conventionally. The SK-BR-3 cells in the logarithmic growth phase were collected by pancreatic digestion, washed with PBS three times, a density of a cell suspension was adjusted with PBS, and the right axilla of the nude mice were inoculated with the cell suspension at 1×107 cells/0.2 ml per mouse. The diet and mental state of each of the tumor-bearing nude mice was observed every day, and tumor size (volume V=π/6× tumor growth x tumor width.sup.2) and the body weight of each nude mouse were measured every three days. The tumors were ready for the experiment when the volume thereof reached 80 to 100 mm.sup.3.
[0140] .sup.99mTc-BindHer molecular probe (1MBq, 1nM) was injected into SK-BR-3 and MDA-MB-231 tumor mice (n=4) through tail veins, and animal image development was performed using single photon emission computed tomography (SPECT/CT) imaging instrument equipped with a pinhole collimator at 1, 2, 4 and 8 h after injection of a developer. All tumor-bearing mice were anesthetized with isoflurane prior to the development, and were allowed to lie prostrate on an examination table. Parameters were collected: a magnification of 3.2, a collection matrix of 256×256, and collection time of 20 min.
[0141] In a blocking experiment, .sup.99mTc-BindHer was injected together with 80 μg of unlabeled .sup.99mTc-BindHer into SK-BR-3 tumor-bearing mice (n=4) through the tail veins, followed by the developing as described above.
[0142] Image analysis was performed by means of Vivo-Scope Brower software. Positions of the tumor, heart, brain, lung, liver, kidney, muscle, bone, and bladder were determined according to CT positioning during the image analysis. The cross-section of the visceral organ was manually drawn to obtain the radioactivity count per unit volume. T/NT was calculated.
[0143] 4. Statistical processing:
[0144] Statistical processing was performed using Graph Pad Prim8.0 statistical software. The measurement data satisfying the normal distribution were expressed in the form of x±s, and one-way analysis of variance was used to compare T/NT before blocking, after blocking, and HER2 negative, with difference P<0.05 indicating statistically significance.
[0145] The results are shown in
Example 8
[0146] The preparation of a .sup.68Ga-BindHer molecular probe and effects specific binding to Her2 tumor exhibited in PET/CT imaging in a nude mouse with a HER2-positive cell transplant tumor are described in this example.
[0147] 1. Preparation of .sup.68Ga-BindHer molecular probe:
[0148] (1) Pretreatment of protein: TCEP was added to BindHer (3 mg/mL) in a ratio of 1 mM TCEP to 1 mg of protein and mixed well, and the mixture was placed at room temperature for 30 min. Then, solution replacement was performed using a NAP-5 (17-0853-01, GE Healthcare, USA) desalting column to replace the protein into a PBS solution while removing TCEP.
[0149] 2) Coupling reaction of solution protein and NOTA: a protein and a chelating agent were added to 50 mg/mL MMA-NOTA (B-622, Macrocyclics, USA) according to a molar ratio of the protein to the chelating agent of 1:3, and mixed well, and then the mixture was placed at room temperature overnight for reaction. Free MAL-NOTA was removed using the NAP-5 column according to the above loading and collection rules. The BindHer-NOTA sample was replaced into a 0.1 M, pH 4.0 sodium acetate solution
[0150] (3) .sup.68Ga labeling of BindHer-NOTA: 100 μL of precursor protein BindHer-NOTA (a buffer was a 0.1M, pH 4.0 sodium acetate solution, in which the precursor protein concentration was adjusted to 2 mg/mL) was added with 100 μIL of pre-buffered .sup.68Ga solution (about 10 MBq) and mixed well, and the mixture was incubated at 75° C. for 15 min. Solution displacement was performed with a NAP-5 desalting column, and 68Ga-BindHer was replaced into the PBS solution while removing free .sup.68Ga. The purify was performed with TLC, and the purity of the .sup.68Ga-BindHer molecular probe was 98.21±0.52%.
[0151] 2. In vivo PET/CT imaging
[0152] An animal tumor model was established in the same manner as described in Example 5. 10 μg (about 1.5 MBq/mouse, diluted to 100 μL with normal saline) of .sup.68Ga-BindHer molecular probe was injected into the breast cancer-bearing mice through the tail veins, and a PET/CT imaging instrument was used for dynamic imaging of the animals after injecting a developer.
[0153] The results are shown in
Example 9
[0154] The preparation of a .sup.18F-BindHer molecular probe and effects specific binding to Her2 tumor exhibited in PET/CT imaging in a nude mouse with a HER2-positive cell transplant tumor are described in this example.
[0155] 1. Preparation of .sup.18F-BindHer molecular probe:
[0156] 100 μL of precursor protein BindHer-NOTA (with a precursor protein concentration of 2 mg/mL, and a buffer was 0.1 M, pH 4.0 sodium acetate solution) was taken and added with 7.5 μL of 2 mM aluminum chloride solution (a molar ratio of protein to aluminum chloride=1: 0.6), and mixed well. Then, 20 μL of .sup.18F (370 MBq) was added, and an equal volume of absolute ethanol was added, mixed and then reacted at 100° C. for 15 min. 10 column volumes were equilibrated with PBS and purified with a NAP-5 column (a maximum loading volume of 500 μL), then the above reaction mixture was allowed to pass through the column, eluted with PBS, and the eluate was collected. The concentration of the collected sample was detected using Nanodrop, and its radiological purity was detected to be 93.2±0.62% by using iTLC.
[0157] 2. In vivo PET/CT imaging
[0158] An animal tumor model was established in the same manner as described in Example 5. 10 μg (about 1.5 MBq/mouse, diluted to 100 μL with normal saline) of .sup.18F-BindHer molecular probe was injected into the breast cancer-bearing mice through the tail veins, and a PET/CT imaging instrument was used for dynamic imaging of the animals after injecting a developer.
[0159] The results are shown in
[0160] The described examples are some embodiments, rather than all examples, of the present disclosure. The detailed description of examples of the present disclosure is not intended to limit the scope of the present disclosure, but merely indicating selected examples of the present disclosure. Based on the examples of the present disclosure, all other examples derived by those skilled in the art without paying creative efforts shall fall within the protection scope of the present disclosure.