COMPOUND FOR THE SEQUESTRATION OF UNDESIRABLE ANTI-PEG ANTIBODIES IN A PATIENT

20230355660 · 2023-11-09

    Inventors

    Cpc classification

    International classification

    Abstract

    A compound for the sequestration of undesirable anti-polyethylene glycol (PEG) antibodies interfering with therapy by PEGylated active agents (such as PEGylated enzymes or antibodies) in a patient is provided. The compound includes an inert biopolymer scaffold and one or more PEG chains. Also provided are pharmaceutical compositions including the compound, as well as a method of sequestering one or more anti-PEG antibodies present in an individual and a method of inhibiting an immune reaction to a treatment with a PEGylated active agent.

    Claims

    1. A compound comprising: a biopolymer scaffold; and one or more polyethylene glycol (PEG) chains.

    2. The compound of claim 1, wherein said one or more PEG chains comprise at least two PEG chains, each of the two PEG chains having a molecular weight of 100-10,000 Da.

    3. The compound of claim 2, wherein said molecular weight is 1500-2500 Da.

    4. The compound of claim 1, wherein said one or more PEG chains comprise at least one PEG chain having a free methoxy end group or a free hydroxyl end group.

    5. The compound of claim 1, wherein the biopolymer scaffold is selected from the group consisting of alpha1-globulins, alpha2-globulins, beta-globulins and albumin.

    6. The compound of claim 1, wherein at least a portion of the one or more PEG chains are covalently bound to the biopolymer scaffold via at least one linker, wherein the linker comprises a peptide or a single amino acid such as a cysteine.

    7. The compound of claim 1, wherein the compound is non-immunogenic in a mammal, in a human, in a non-human primate, in a sheep, in a pig, in a dog or in a rodent.

    8. A pharmaceutical composition comprising the compound of claim 1 and at least one pharmaceutically acceptable excipient.

    9. The pharmaceutical composition of claim 8, wherein the composition is non-immunogenic in humans.

    10. The pharmaceutical composition of claim 8 for use in therapy.

    11. The pharmaceutical composition for use according to claim 10, for use in inhibiting an immune reaction of an individual to a treatment with an active agent, wherein the active agent comprises at least one PEG wherein the active agent is PEGylated; wherein the pharmaceutical composition is administered at least twice within a 96-hour window, wherein the window is followed by administration of the active agent within 24 hours.

    12. The pharmaceutical composition for use according to claim 10, for use in inhibiting neutralization of an active agent in an individual, wherein the active agent comprises at least one PEG wherein the pharmaceutical composition is administered at least twice within a 96-hour window, wherein the window is followed by administration of the active agent within 24 hours.

    13. The pharmaceutical composition for use according to claim 11, wherein the active agent is a protein or peptide, wherein the active agent is selected from the group of enzymes, enzyme inhibitors, antibodies, antibody fragments, antibody mimetics, antibody-drug conjugates, hormones, growth factors, clotting factors and cytokines; or wherein the active agent is a viral vector such as a viral vector for gene therapy or vaccination.

    14. The pharmaceutical composition for use according to claim 11, wherein the active agent is a nucleic acid-lipid particle, a nucleic acid-polymer particle, a nucleic acid-lipid-polymer particle, or a nucleic acid; wherein the nucleic acid is RNA, mRNA or siRNA, or DNA.

    15. A method of sequestering one or more antibodies present in an individual, comprising obtaining a pharmaceutical composition as defined in claim 8, wherein the composition is non-immunogenic in the individual and wherein the one or more antibodies are anti-PEG antibodies; and administering the pharmaceutical composition to the individual.

    16. A pharmaceutical composition, comprising the compound of claim 1 and further comprising an active agent and at least one pharmaceutically acceptable excipient, wherein the active agent comprises at least one PEG, wherein the active agent is PEGylated.

    17. The pharmaceutical composition of claim 16, wherein the active agent is a viral vector or a protein or peptide, selected from the group of enzymes, enzyme inhibitors, antibodies, antibody fragments, antibody mimetics, antibody-drug conjugates, hormones, growth factors, clotting factors and cytokines.

    18. The pharmaceutical composition of claim 16, wherein the active agent is a nucleic acid-lipid particle, a nucleic acid-polymer particle, a nucleic acid-lipid-polymer particle, or a nucleic acid; wherein the nucleic acid is RNA, mRNA or siRNA, or DNA.

    19. A method of inhibiting an immune reaction to a treatment with an active agent in an individual in need of treatment with the active agent, comprising: obtaining a pharmaceutical composition as defined in claim 16; wherein the compound of the pharmaceutical composition is non-immunogenic in the individual; and administering the pharmaceutical composition to the individual.

    Description

    [0336] The present invention is further illustrated by the following figures and examples, without being restricted thereto. In the context of the following figures and examples the compound on which the inventive approach is based is also referred to as “Selective Antibody Depletion Compound” (SADC).

    [0337] FIG. 1: SADCs successfully reduce the titre of undesired antibodies. Each SADC was applied at time point 0 by i.p. injection into Balb/c mice pre-immunized by peptide immunization against a defined antigen. Each top panel shows anti-peptide titers (0.5×dilution steps; X-axis shows log(X) dilutions) against OD values (y-axis) according to a standard ELISA detecting the corresponding antibody. Each bottom panel shows titers Log IC50 (y-axis) before injection of each SADC (i.e. titers at −48 h and −24 h) and after application of each SADC (i.e. titers +24 h, +48 h and +72 h after injection; indicated on the x-axis). (A) Compound with albumin as the biopolymer scaffold that binds to antibodies directed against EBNA1 (associated with pre-eclampsia). The mice were pre-immunized with a peptide vaccine carrying the EBNA-1 model epitope. (B) Compound with albumin as the biopolymer scaffold that binds to antibodies directed against a peptide derived from the human AChR protein MIR (associated with myasthenia gravis). The mice were pre-immunized with a peptide vaccine carrying the AChR MIR model epitope. (C) Compound with immunoglobulin as the biopolymer scaffold that binds to antibodies directed against EBNA1 (associated with pre-eclampsia). The mice were pre-immunized with a peptide vaccine carrying the EBNA-1 model epitope. (D) Compound with haptoglobin as the biopolymer scaffold that binds to antibodies directed against EBNA1 (associated with pre-eclampsia). The mice were pre-immunized with a peptide vaccine carrying the EBNA-1 model epitope. (E) Demonstration of selectivity using the same immunoglobulin-based SADC binding to antibodies directed against EBNA1 that was used in the experiment shown in panel C. The mice were pre-immunized with an unrelated amino acid sequence. No titre reduction occurred, demonstrating selectivity of the compound.

    [0338] FIG. 2: SADCs are non-immunogenic and do not induce antibody formation after repeated injection into mice. Animals C1-C4 as well as animals C5-C8 were treated i.p. with two different SADCs. Control animal C was vaccinated with a KLH-peptide derived from the human AChR protein MIR. Using BSA-conjugated peptide probes T3-1, T9-1 and E005 (grey bars, as indicated in the graph), respectively, for antibody titer detection by standard ELISA at a dilution of 1:100, it could be demonstrated that antibody induction was absent in animals treated with an SADC, when compared to the vaccine-treated control animal C (y-axis, OD450 nm).

    [0339] FIG. 3: Successful in vitro depletion of antibodies using SADCs carrying multiple copies of monovalent or divalent peptides. SADCs with mono- or divalent peptides were very suitable to adsorb antibodies and thereby deplete them. “Monovalent” means that peptide monomers are bound to the biopolymer scaffold (i.e. n=1) whereas “divalent” means that peptide dimers are bound to the biopolymer scaffold (i.e. n=2). In the present case, the divalent peptides were “homodivalent”, i.e. the peptide n-mer of the SADC is E006-spacer-E006).

    [0340] FIG. 4: Rapid, selective antibody depletion in mice using various SADC biopolymer scaffolds. Treated groups exhibited rapid and pronounced antibody reduction already at 24 hrs (in particular SADC-TF) when compared to the mock treated control group SADC-CTL (containing an unrelated peptide). SADC with albumin scaffold—SADC-ALB, SADC with immunoglobulin scaffold—SADC-IG, SADC with haptoglobin scaffold—SADC-HP, and SADC with transferrin scaffold—SADC-TF.

    [0341] FIG. 5: Detection of SADCs in plasma via their peptide moieties 24 hrs after SADC injection. Both haptoglobin-scaffold-based SADCs (SADC-HP and SADC-CTL) exhibited a relatively shorter plasma half life which represents an advantage over SADCs with other biopolymer scaffolds such as SADC-ALB, SADC-IG oder SADC-TF. SADC with albumin scaffold—SADC-ALB, SADC with immunoglobulin scaffold—SADC-IG, SADC with haptoglobin scaffold—SADC-HP, and SADC with transferrin scaffold—SADC-TF.

    [0342] FIG. 6: Detection of SADC-IgG complexes in plasma 24 hrs after SADC injection. Haptoglobin based SADCs were subject to accelerated clearance when compared to SADCs with other biopolymer scaffolds. SADC with albumin scaffold—SADC-ALB, SADC with immunoglobulin scaffold—SADC-IG, SADC with haptoglobin scaffold—SADC-HP, and SADC with transferrin scaffold—SADC-TF.

    [0343] FIG. 7: In vitro analysis of SADC-IgG complex formation. Animals SADC-TF and -ALB showed pronounced immunocomplex formation and binding to C1q as reflected by the strong signals and by sharp signal lowering in case 1000 ng/ml SADC-TF due to the transition from antigen-antibody equilibrium to antigen excess. In contrast, in vitro immunocomplex formation with SADC-HP or SADC-IG were much less efficient when measured in the present assay. These findings corroborate the finding that haptoglobin scaffolds are advantageous over other SADC biopolymer scaffolds because of the reduced propensity to activate the complement system. SADC with albumin scaffold—SADC-ALB, SADC with immunoglobulin scaffold—SADC-IG, SADC with haptoglobin scaffold—SADC-HP, and SADC with transferrin scaffold—SADC-TF.

    [0344] FIG. 8: Determination of IgG capturing by SADCs in vitro. SADC-HP showed markedly less antibody binding capacity in vitro when compared to SADC-TF or SADC-ALB. SADC with albumin scaffold—SADC-ALB, SADC with immunoglobulin scaffold—SADC-IG, SADC with haptoglobin scaffold—SADC-HP, and SADC with transferrin scaffold—SADC-TF.

    [0345] FIG. 9: Blood clearance of an anti-CD163-antibody-based biopolymer scaffold. In a mouse model, mAb E10B10 (specific for murine CD163) is much more rapidly cleared from circulation than mAb Mac2-158 (specific for human CD163 but not for murine CD163, thus serving as negative control in this experiment).

    [0346] FIG. 10: PEG was efficiently coupled to a transferrin biopolymer scaffold to yield a compound of the present invention. 2.5 μg human apo-transferrin coupled to PEG (10 kDa, 5 kDa, 2 kDa, 750 Da) as analysed by SDS page. All conjugates show a complete shift according to the size of their conjugated PEG molecule (lanes 3-6, PEG size 10 kDa, 5 kDa, 2 kDa, 750 Da, respectively), when compared to the unconjugated apo-transferrin (lane 2) which delineates the migration of the unconjugated scaffold protein. The original human apo-transferrin band (lane 2) completely disappears upon conjugation of PEG (lanes 3-6) thereby providing a quality proof and consistency check for functional animal experiments with PEG-SADCs. Lane 1 contains a protein ladder.

    [0347] FIG. 11: Selective anti-PEG antibody depletion by a compound of the present invention in vivo. Unexpectedly, 2 kDa, 5 kDa and 750 Da PEG-SADC provide effective and rapid anti-PEG antibody signal lowering. The 2 kDa PEG-SADC formulation is most effective and causes long lasting anti-PEG antibody lowering until the end of the experiment at timepoint (T) 120 hours (T120). In contrast, the 10 kDa PEG-SADC formulation is less effective. Importantly, the previously suggested free PEG 10 kDa formulation (“PEG 10 kDa”, no biopolymer scaffold) does not show any lowering of the antibody signal at the comparable dose. Neither does the biopolymer scaffold (“hu-apo-TF”) alone.

    [0348] FIG. 12: Compounds of the present invention are non-immunogenic. PEG-SADCs do not induce any detectable anti-PEG antibody increase after repeated injections.

    [0349] FIG. 13: Comparison between 2 kDa PEG-SADC and 10 kDa PEG-SADC. An independent experiment corroborates the surprising results shown in FIG. 11, over a longer observation period. The 2 kDa PEG-SADC formulation is most effective and causes long lasting anti-PEG antibody lowering. In contrast, the 10 kDa PEG-SADC formulation still achieves anti-PEG antibody lowering but is less effective.

    EXAMPLES

    [0350] Examples 1-8 demonstrate that SADCs are very well suited for selective removal of undesirable antibodies (as shown with antibodies binding to peptide epitopes, i.e. on the basis of peptide-based SADCs). Example 9-11 contain more details on anti-CD163 antibody scaffolds. Finally, the SADC concept was successfully extended to undesirable anti-PEG antibodies, as shown in Examples 12-16.

    Example 1: SADCs Effectively Reduce the Titre of Undesired Antibodies

    [0351] Animal models: In order to provide in vivo models with measurable titers of prototypic undesired antibodies in human indications, BALB/c mice were immunized using standard experimental vaccination with KLH-conjugated peptide vaccines derived from established human autoantigens or anti-drug antibodies. After titer evaluation by standard peptide ELISA, immunized animals were treated with the corresponding test SADCs to demonstrate selective antibody lowering by SADC treatment. All experiments were performed in compliance with the guidelines by the corresponding animal ethics authorities.

    [0352] Immunization of mice with model antigens: Female BALB/c mice (aged 8-10 weeks) were supplied by Janvier (France), maintained under a 12 h light/12 h dark cycle and given free access to food and water. Immunizations were performed by s.c. application of KLH carrier-conjugated peptide vaccines injected 3 times in biweekly intervals. KLH conjugates were generated with peptide T3-2 (SEQ ID NO. 33: CGRPQKRPSCIGCKG), which represents an example for molecular mimicry between a viral antigen (EBNA-1) and an endogenous human receptor antigen, namely the placental GPR50 protein, that was shown to be relevant to preeclampsia (Elliott et al.). In order to confirm the generality of this approach, a larger antigenic peptide derived from the autoimmune condition myasthenia gravis was used for immunization of mice with a human autoepitope. In analogy to peptide T3-2, animals were immunized with peptide T1-1 (SEQ ID NO. 34: LKWNPDDYGGVKKIHIPSEKGC), derived from the MIR (main immunogenic region) of the human AChR protein which plays a fundamental role in pathogenesis of the disease (Luo et al.). The T1-1 peptide was used for immunizing mice with a surrogate partial model epitope of the human AChR autoantigen. The peptide T8-1 (SEQ ID NO. 35: DHTLYTPYHTHPG) was used to immunize control mice to provide a control titer for proof of selectivity of the system. For vaccine conjugate preparation, KLH carrier (Sigma) was activated with sulfo-GMBS (Cat. Nr. 22324 Thermo), according to the manufacturer's instructions, followed by addition of either N- or C-terminally cysteinylated peptides T3-2 and T1-1 and final addition of Alhydrogel® before injection into the flank of the animals. The doses for vaccines T3-2 and T1-1 were 15 μg of conjugate in a volume of 100 ul per injection containing Alhydrogel® (InvivoGen VAC-Alu-250) at a final concentration of 1% per dose.

    [0353] Generation of prototypic SADCs: For testing selective antibody lowering activity by SADCs of T3-2 and T1-1 immunized mice, SADCs were prepared with mouse serum albumin (MSA) or mouse immunoglobulin (mouse-Ig) as biopolymer scaffold in order to provide an autologous biopolymer scaffold, that will not induce any immune reaction in mice, or non-autologuous human haptoglobin as biopolymer scaffold (that did not induce an allogenic reaction after one-time injection within 72 hours). N-terminally cysteinylated SADC peptide E049 (SEQ ID NO. 13: GRPQKRPSCIG) and/or C-terminally cysteinylated SADC peptide E006 (SEQ ID NO. 36: VKKIHIPSEKG) were linked to the scaffold using sulfo-GMBS (Cat. Nr. 22324 Thermo)-activated MSA (Sigma; Cat. Nr. A3559) or -mouse-Ig (Sigma, 15381) or -human haptoglobin (Sigma H0138) according to the instructions of the manufacturer, thereby providing MSA-, Ig- and haptoglobin-based SADCs with the corresponding cysteinylated peptides, that were covalently attached to the lysines of the corresponding biopolymer scaffold. Beside conjugation of the cysteinylated peptides to the lysines via a bifunctional amine-to-sulfhydryl crosslinker, a portion of the added cysteinylated SADC peptides directly reacted with sulfhydryl groups of cysteins of the albumin scaffold protein, which can be detected by treating the conjugates with DTT followed by subsequent detection of free peptides using mass spectrometry or any other analytical method that detects free peptide. Finally, these SADC conjugates were dialysed against water using Pur-A-Lyzer™ (Sigma) and subsequently lyophilized. The lyophilized material was resuspended in PBS before injection into animals.

    [0354] In vivo functional testing of SADCs: Prototypic SADCs, SADC-E049 and SADC-E006 were injected intraperitoneally (i.p.; as a surrogate for an intended intravenous application in humans and larger animals) into the mice that had previously been immunized with peptide vaccine T3-2 (carrying the EBNA-1 model epitope) and peptide vaccine T1-1 (carrying the AChR MIR model epitope). The applied dose was 30 μg SADC conjugate in a volume of 50 μl PBS. Blood takes were performed by submandibular vein puncture, before (−48 h, −24 h) and after (+24 h, +48 h, +72 h, etc.) i.p. SADC injections, respectively, using capillary micro-hematocrit tubes. Using ELISA analysis (see below), it was found that both prototypic SADCs were able to clearly reduce the titers over a period of at least 72 hrs in the present animal model. It could therefore be concluded that SADCs can be used to effectively reduce titers in vivo.

    [0355] Titer analysis: Peptide ELISAs were performed according to standard procedures using 96-well plates (Nunc Medisorp plates; Thermofisher, Cat Nr 467320) coated for 1 h at RT with BSA-coupled peptides (30 nM, dissolved in PBS) and incubated with the appropriate buffers while shaking (blocking buffer, 1% BSA, lx PBS; washing buffer, 1×PBS/0.1% Tween; dilution buffer, 1×PBS/0.1% BSA/0.1% Tween). After serum incubation (dilutions starting at 1:50 in PBS; typically in 1:3 or 1:2 titration steps), bound antibodies were detected using Horseradish Peroxidase-conjugated goat anti-mouse IgG (Fc) from Jackson immunoresearch (115-035-008). After stopping the reaction, plates were measured at 450 nm for 20 min using TMB. EC50 were calculated from readout values using curve fitting with a 4-parameter logistic regression model (GraphPad Prism) according to the procedures recommended by the manufacturer. Constraining parameters for ceiling and floor values were set accordingly, providing curve fitting quality levels of R.sup.2>0.98.

    [0356] FIG. 1A shows an in vivo proof of concept in a mouse model for in vivo selective plasma-lowering activity of a prototypic albumin-based SADC candidate that binds to antibodies directed against EBNA1, as a model for autoantibodies and mimicry in preeclampsia (Elliott et al.). For these mouse experiments, mouse albumin was used, in order to avoid any reactivity against a protein from a foreign species. Antibody titers were induced in 6 months old Balb/c mice by standard peptide vaccination. The bottom panel demonstrates that titers Log IC50 (y-axis) before SADC injection (i.e. titers at −48 h and −24 h) were higher than titers Log IC50 after SADC application (i.e. titers+24 h, +48 h and +72 h after injection; indicated on the x-axis).

    [0357] A similar example is shown in FIG. 1B, using an alternative example of a peptidic antibody binding moiety for a different disease indication. Antibody lowering activity of an albumin-based SADC in a mouse model that was pre-immunized with a different peptide derived from the human AChR protein MIR region (Luo et al.) in order to mimic the situation in myasthenia gravis. The induced antibody titers against the AChR-MIR region were used as surrogate for anti-AChR-MIR autoantibodies known to play a causative role in myasthenia gravis (reviewed by Vincent et al.). A clear titer reduction was seen after SADC application.

    [0358] FIGS. 1C and 1D demonstrate the functionality of SADC variants comprising alternative biopolymer scaffolds. Specifically, FIG. 1C shows that an immunoglobulin scaffold can be successfully used whereas FIG. 1D demonstrates the use of a haptoglobin-scaffold for constructing an SADC. Both examples show an in vivo proof of concept for selective antibody lowering by an SADC, carrying covalently bound example peptide E049.

    [0359] The haptoglobin-based SADC was generated using human Haptoglobin as a surrogate although the autologuous scaffold protein would be preferred. In order to avoid formation of anti-human-haptoglobin antibodies, only one single SADC injection per mouse of the non-autologuous scaffold haptoglobin was used for the present experimental conditions. As expected, under the present experimental conditions (i.e. one-time application), no antibody reactivity was observed against the present surrogate haptoglobin homologue.

    [0360] FIG. 1E demonstrates the selectivity of the SADC system. The immunoglobulin-based SADC carrying the peptide E049 (i.e. the same as in FIG. 1C) cannot reduce the Ig-titer that was induced by a peptide vaccine with an unrelated, irrelevant amino acid sequence, designated peptide T8-1 (SEQ ID NO. 35: DHTLYTPYHTHPG). The example shows an in vivo proof of concept for the selectivity of the system. The top panel shows anti-peptide T8-1 titers (0.5×dilution steps starting from 1:50 to 1:102400; X-axis shows log(X) dilutions) against OD values (y-axis) according to a standard ELISA. T8-1-titers are unaffected by administration of SADC-Ig-E049 after application. The bottom panel demonstrates that the initial titers Log IC50 (y-axis) before SADC injection (i.e. titers at −48 h and −24 h) are unaffected by administration of SADC-Ig-E049 (arrow) when compared to the titers Log IC50 after SADC application (i.e. titers+24 h, +48 h and +72 h; as indicated on the x-axis), thereby demonstrating the selectivity of the system.

    Example 2: Immunogenicity of SADCs

    [0361] In order to exclude immunogenicity of SADCs, prototypic candidate SADCs were tested for their propensity to induce antibodies upon repeated injection. Peptides T3-1 and T9-1 were used for this test. T3-1 is a 10-amino acid peptide derived from a reference epitope of the Angiotensin receptor, against which agonistic autoantibodies are formed in a pre-eclampsia animal model (Zhou et al.); T9-1 is a 12-amino acid peptide derived from a reference anti-drug antibody epitope of human IFN gamma (Lin et al.). These control SADC conjugates were injected 8× every two weeks i.p. into naïve, non-immunized female BALB/c mice starting at an age of 8-10 weeks.

    [0362] Animals C1-C4 were treated i.p. (as described in example 1) with SADC T3-1. Animals C5-C8 were treated i.p. with an SADC carrying the peptide T9-1. As a reference signal for ELISA analysis, plasma from a control animal that was vaccinated 3 times with KLH-peptide T1-1 (derived from the AChR-MIR, explained in Example 1) was used. Using BSA-conjugated peptide probes T3-1, T9-1 and E005 (SEQ ID NO. 37: GGVKKIHIPSEK), respectively, for antibody titer detection by standard ELISA at a dilution of 1:100, it could be demonstrated that antibody induction was absent in SADC-treated animals, when compared to the vaccine-treated control animal C (see FIG. 2). The plasmas were obtained by submandibular blood collection, 1 week after the 3rd vaccine injection (control animal C) and after the last of 8 consecutive SADC injections in 2-weeks intervals (animals C1-C8), respectively. Thus it was demonstrated that SADCs are non-immunogenic and do not induce antibody formation after repeated injection into mice.

    Example 3: Successful In Vitro Depletion of Antibodies Using SADCs Carrying Multiple Copies of Monovalent or Divalent Peptides

    [0363] Plasma of E006-KLH (VKKIHIPSEKG (SEQ ID NO: 36) with C-terminal cysteine, conjugated to KLH) vaccinated mice was diluted 1:3200 in dilution buffer (PBS+0.1% w/v BSA+0.1% Tween20) and incubated (100 μl, room temperature) sequentially (10 min/well) four times on single wells of a microtiter plate that was coated with 2.5 μg/ml (250 ng/well) of SADC or 5 μg/ml (500 ng/well) albumin as negative control.

    [0364] In order to determine the amount of free, unbound antibody present before and after incubation on SADC coated wells, 50 μl of the diluted serum were taken before and after the depletion and quantified by standard ELISA using E006-BSA coated plates (10 nM peptide) and detection by goat anti mouse IgG bio (Southern Biotech, diluted 1:2000). Subsequently, the biotinylated antibody was detected with Streptavidin-HRP (Thermo Scientific, diluted 1:5000) using TMB as substrate. Development of the signal was stopped with 0.5 M sulfuric acid.

    [0365] ELISA was measured at OD450 nm (y-axis). As a result, the antibody was efficiently adsorbed by either coated mono- or divalent SADCs containing peptide E006 with C-terminal cysteine (sequence VKKIHIPSEKGC, SEQ ID NO: 36) (before=non-depleted starting material; mono-divalent corresponds to peptides displayed on the SADC surface; neg. control was albumin; indicated on the x-axis). See FIG. 3. (“Monovalent” means that peptide monomers are bound to the biopolymer scaffold (i.e. n=1) whereas “divalent” means that peptide dimers are bound to the biopolymer scaffold (i.e. n=2). In the present case, the divalent peptides were “homodivalent”, i.e. the peptide n-mer of the SADC is E006-S-E006.)

    [0366] This demonstrates that SADCs with mono- or divalent peptides are very suitable to adsorb antibodies and thereby deplete them.

    Example 4: Rapid, Selective Antibody Depletion in Mice Using Various SADC Biopolymer Scaffolds

    [0367] 10 μg of model undesired antibody mAB anti V5 (Thermo Scientific) was injected i.p. into female Balb/c mice (5 animals per treatment group; aged 9-11 weeks) followed by intravenous injection of 50 μg SADC (different biopolymer scaffolds with tagged V5 peptides bound, see below) 48 hrs after the initial antibody administration. Blood was collected at 24 hrs intervals from the submandibular vein. Blood samples for time point 0 hrs were taken just before SADC administration.

    [0368] Blood was collected every 24 hrs until time point 120 hrs after the SADC administration (x-axis). The decay and reduction of plasma anti-V5 IgG levels after SADC administration was determined by anti V5 titer readout using standard ELISA procedures in combination with coated V5-peptide-BSA (peptide sequence IPNPLLGLDC—SEQ ID NO: 57) and detection by goat anti mouse IgG bio (Southern Biotech, diluted 1:2000) as shown in FIG. 4. In addition, SADC levels (see Example 6) and immunocomplex formation (see Example 7) were analyzed.

    [0369] EC50 [OD450] values were determined using 4 parameter logistic curve fitting and relative signal decay between the initial level (set to 1 at time point 0) and the following time points (x-axis) was calculated as ratio of the EC50 values (y-axis, fold signal reduction EC50). All SADC peptides contained tags for direct detection of SADC and immunocomplexes from plasma samples; peptide sequences used for SADCs were: IPNPLLGLDGGSGDYKDDDDKGK (SEQ ID NO: 38)-(BiotinAca)GC (SADC with albumin scaffold—SADC-ALB, SADC with immunoglobulin scaffold—SADC-IG, SADC with haptoglobin scaffold—SADC-HP, and SADC with transferrin scaffold—SADC-TF) and unrelated peptide VKKIHIPSEKGGSGDYKDDDDKGK (SEQ ID NO: 39)-(BiotinAca)GC as negative control SADC (SADC-CTR).

    [0370] The SADC scaffolds for the different treatment groups of 5 animals are displayed in black/grey shades (see inset of FIG. 4).

    [0371] Treated groups exhibited rapid and pronounced antibody reduction already at 24 hrs (in particular SADC-TF) when compared to the mock treated control group SADC-CTL. SADC-CTR was used as reference for a normal antibody decay since it has no antibody lowering activity because its peptide sequence is not recognized by the administered anti V5 antibody. The decay of SADC-CTR is thus marked with a trend line, emphasizing the antibody level differences between treated and mock treated animals.

    [0372] In order to determine the effectivity of selective antibody lowering under these experimental conditions, a two-way ANOVA test was performed using a Dunnett's multiple comparison test. 48 hrs after SADC administration, the antibody EC50 was highly significantly reduced in all SADC groups (p<0.0001) compared to the SADC-CTR reference group (trend line). At 120 hrs after SADC administration, antibody decrease was highly significant in the SADC-ALB and SADC-TF groups (both p<0.0001) and significant in the SADC-HP group (p=0.0292), whereas the SADC-IG group showed a trend towards an EC50 reduction (p=0.0722) 120 hrs after SADC administration. Of note, selective antibody reduction was highly significant (p<0.0001) in the SADC-ALB and SADC-TF groups at all tested time-points after SADC administration.

    [0373] It is concluded that all SADC biopolymer scaffolds were able to selectively reduce antibody levels. Titer reduction was most pronounced with SADC-ALB and SADC-TF and no rebound or recycling of antibody levels was detected towards the last time points suggesting that undesired antibodies are degraded as intended.

    Example 5: Detection of SADCs in Plasma 24 Hrs after SADC Injection

    [0374] Plasma levels of different SADC variants at 24 hrs after i.v. injection into Balb/c mice. Determination of Plasma levels (y-axis) of SADC-ALB, -IG, -HP, -TF and the negative control SADC-CTR (x-axis), were detected in the plasmas from the animals already described in example 5. Injected plasma SADC levels were detected by standard ELISA whereby SADCs were captured via their biotin moieties of their peptides in combination with streptavidin coated plates (Thermo Scientific). Captured SADCs were detected by mouse anti Flag-HRP antibody (Thermo Scientific, 1:2,000 diluted) detecting the Flag-tagged peptides (see also example 7):

    [0375] Assuming a theoretical amount in the order of 25 μg/ml in blood after injecting 50 μg SADC i.v., the detectable amount of SADC ranged between 799 and 623 ng/ml for SADC-ALB or SADC-IG and up to approximately 5000 ng/ml for SADC-TF, 24 hrs after SADC injection. However surprisingly and in contrast, SADC-HP and control SADC-CTR (which is also a SADC-HP variant, however carrying the in this case unrelated negative control peptide E006, see previous examples), had completely disappeared from circulation 24 hrs after injection, and were not detectable anymore. See FIG. 5.

    [0376] This demonstrates that both Haptoglobin scaffold-based SADCs tested in the present example ((namely SADC-HP and SADC-CTR) exhibit a relatively shorter plasma half-life which represents an advantage over SADCs such as SADC-ALB, SADC-IG oder SADC-TF in regard of their potential role in complement-dependent vascular and renal damage due to the in vivo risk of immunocomplex formation. Another advantage of SADC-HP is the accelerated clearance rate of their unwanted target antibody from blood in cases where a rapid therapeutic effect is needed. The present results demonstrate that Haptoglobin-based SADC scaffolds (as represented by SADC-HP and SADC-CTR) are subject to rapid clearance from the blood, regardless of whether SADC-binding antibodies are present in the blood, thereby minimizing undesirable immunocomplex formation and showing rapid and efficient clearance. Haptoglobin-based SADCs such as SADC-HP in the present example thus provide a therapeutically relevant advantage over other SADC biopolymer scaffolds, such as demonstrated by SADC-TF or SADC-ALB, both of which are still detectable 24 hrs after injection under the described conditions, in contrast to SADC-HP or SADC-CTR which both are completely cleared 24 hrs after injection.

    Example 6: Detection of SADC-IgG Complexes in Plasma 24 Hrs after SADC Injection

    [0377] In order to determine the amount IgG bound to SADCs in vivo, after i.v. injection of 10 μg anti V5 IgG (Thermo Scientific) followed by injection of SADC-ALB, -HP, -TF and -CTR (50 μg) administered i.v. 48 h after antibody injection, plasma was collected from the submandibular vein, 24 hrs after SADC injection, and incubated on streptavidin plates for capturing SADCs from plasma via their biotinylated SADC-V5-peptide [IPNPLLGLDGGSGDYKDDDDKGK (SEQ ID NO: 38)(BiotinAca)GC or in case of SADC-CTR the negative control peptide VKKIHIPSEKGGSGDYKDDDDKGK (SEQ ID NO: 39)(BiotinAca)GC]. IgG bound to the streptavidin-captured SADCs was detected by ELISA using a goat anti mouse IgG HRP antibody (Jackson Immuno Research, diluted 1:2,000) for detection of the SADC-antibody complexes present in plasma 24 hrs after SADC injection. OD450 nm values (y-axis) obtained for a negative control serum from untreated animals were subtracted from the OD450 nm values of the test groups (x-axis) for background correction.

    [0378] As shown in FIG. 6, pronounced anti-V5 antibody signals were seen in case of SADC-ALB and SADC-TF injected mice (black bars represent background corrected OD values at a dilution of 1:25, mean value of 5 mice; standard deviation error bars), whereas no antibody signal could be detected in plasmas from SADC-HP or control SADC-CTR injected animals (SADC-CTR is a negative control carrying the irrelevant peptide bio-FLG-E006 [VKKIHIPSEKGGSGDYKDDDDKGK (SEQ ID NO: 39)(BiotinAca)GC] that is not recognized by any anti V5 antibody). This demonstrates the absence of detectable amounts of SADC-HP/IgG complexes in the plasma 24 hrs after i.v. SADC application.

    [0379] SADC-HP is therefore subject to accelerated clearance in anti V5 pre-injected mice when compared to SADC-ALB or SADC-TF.

    Example 7: In Vitro Analysis of SADC-Immunoglobulin Complex Formation

    [0380] SADC-antibody complex formation was analyzed by pre-incubating 1 μg/ml of human anti V5 antibody (anti V5 epitope tag [SV5-P-K], human IgG3, Absolute Antibody) with increasing concentrations of SADC-ALB, -IG, -HP, -TF and -CTR (displayed on the x-axis) in PBS+0.1% w/v BSA+0.1% v/v Tween20 for 2 hours at room temperature in order to allow for immunocomplex formation in vitro. After complex formation, samples were incubated on ELISA plates that had previously been coated with 10 μg/ml of human C1q (CompTech) for 1 h at room temperature, in order to allow capturing of in vitro formed immunocomplexes. Complexes were subsequently detected by ELISA using anti human IgG (Fab specific)-Peroxidase (Sigma, diluted 1:1,000). Measured signals at OD450 nm (y-axis) reflect Antibody-SADC complex formation in vitro.

    [0381] As shown in FIG. 7, SADC-TF and -ALB showed pronounced immunocomplex formation and binding to C1q as reflected by the strong signals and by sharp signal lowering in case 1000 ng/ml SADC-TF due to the transition from antigen-antibody equilibrium to antigen excess. In contrast, in vitro immunocomplex formation with SADC-HP or SADC-IG were much less efficient when measured in the present assay.

    [0382] Together with the in vivo data (previous examples), these findings corroborate the finding that haptoglobin scaffolds are advantageous over other SADC biopolymer scaffolds because of the reduced propensity to activate the complement system. In contrast, SADC-TF or SADC-ALB show higher complexation, and thereby carry a certain risk of activating the Cl complex with initiation of the classical complement pathway (a risk which may be tolerable in some settings, however).

    Example 8: Determination of IgG Capturing by SADCs In Vitro

    [0383] Immunocomplexes were allowed to form in vitro, similar to the previous example, using 1 μg/ml mouse anti V5 antibody (Thermo Scientific) in combination with increasing amounts of SADCs (displayed on the x-axis). SADC-antibody complexes were captured on a streptavidin coated ELISA plate via the biotinylated SADC-peptides (see previous examples), followed by detection of bound anti-V5 using anti mouse IgG-HRP (Jackson Immuno Research, diluted 1:2,000).

    [0384] Under these assay conditions, SADC-HP showed markedly less antibody binding capacity in vitro when compared to SADC-TF or SADC-ALB (see FIG. 8, A). The calculated EC50 values for IgG detection on SADCs were 7.0 ng/ml, 27.9 ng/ml and 55.5 ng/ml for SADC-TF, -ALB and -HP, respectively (see FIG. 8, B).

    [0385] This in vitro finding is consistent with the observation (see previous examples) that SADC-HP has a lower immunocomplex formation capacity when compared to SADC-TF or SADC-ALB which is regarded as a safety advantage with respect to its therapeutic use for the depletion of unwanted antibodies.

    Example 9: In-Vivo Function of Anti-CD163-Antibody-Based SADC Biopolymer Scaffold

    [0386] Rapid in vivo blood clearance of anti-mouse-CD163 mAB E10B10 (as disclosed in WO 2011/039510 A2). mAB E10B10 was resynthesized with a mouse IgG2a backbone. 50 μg mAb E10B10 and Mac2-158 (human-specific anti-CD163 mAb as disclosed in WO 2011/039510 A2, used as negative control in this example since it does not bind to mouse CD163) were injected i.v. into mice and measured after 12, 24, 36, 48, 72, 96 hours in an ELISA to determine the blood clearance.

    [0387] mAb E10B10 was much more rapidly cleared from circulation than control mAb Mac2-158 was, as shown in FIG. 9, since E10B10 binds to the mouse CD163 whereas Mac2-158 is human-specific, although both were expressed as mouse IgG2a isotypes for direct comparison.

    [0388] In conclusion, anti-CD163 antibodies are highly suitable as SADC scaffold because of their clearance profile. SADCs with such scaffolds will rapidly clear undesirable antibodies from circulation.

    [0389] Detailed methods: 50 ug of biotinylated monoclonal antibodies E10B10 and biotinylated Mac2-158 were injected i.v. into mice and measured after 12, 24, 36, 48, 72, 96 hours to determine the clearance by ELISA: Streptavidin plates were incubated with plasma samples diluted in PBS+0.1% BSA+0.1% Tween20 for 1 h at room temperature (50 μl/well). After washing (3× with PBS+0.1% Tween20), bound biotinylated antibodies were detected with anti-mouse IgG+IgM-HRP antibody at a 1:1000 dilution. After washing, TMB substrate was added and development of the substrate was stopped with TMB Stop Solution. The signal at OD450 nm was read. The EC50 values were calculated by non-linear regression using 4 parametric curve fitting with constrained curves and least squares regression. EC50 values at time-point T12 (this was the first measured time-point after antibody injection) was set at 100%, all other EC50 values were compared to the levels at T12.

    Example 10: Epitope Mapping of Anti-CD163 mAbs

    [0390] mAB E10B10 provides CD163-mediated, accelerated in vivo clearance from blood in mice (see example 11). The epitope of this antibody was fine mapped using circular peptide arrays, whereby the peptides were derived from mouse CD163. As a result, a peptide cluster that is recognized by mAB E10B10 was identified (see example 13).

    [0391] The same epitope mapping procedure using circularized peptides was performed with mAB Mac2-158 (as disclosed in WO 2011/039510 A2). Epitope mapping results for mAB Mac2-158 yielded two peptide clusters (see example 13) which allowed further demarcation of CD163 epitope regions that are especially relevant to internalization of ligands and antibodies that bind to the receptor.

    [0392] These newly characterized epitopes for Mac2-158 and E10B10 thus revealed three preferred binding regions for antibodies against CD163. Based on the fine epitope mapping work, linear or preferentially circular peptides are synthesized and used for the induction, production and selection of polyclonal or monoclonal antibodies or other CD163-binding SADC scaffolds that target CD163.

    Example 11: Epitope Mapping of Anti-CD163 mAbs

    [0393] Peptides aligned to SRCR domain 1 of human CD163 were selected from the top 20 peptide hits of mAB Mac2-158 circular epitope mapping peptides and the most preferred sequences were selected from two peptide alignment clusters at the N-terminus and at the C-terminus of SRCR-1 of human CD163. As a result, the following sequences (as well as motifs derived therefrom) are highly suitable epitopes anti-CD163 antibodies and fragments thereof used as SADC biopolymer scaffold:

    TABLE-US-00005 Peptide cluster 1: 04 ----------------EWGTVCNNGWSME------- (SEQ ID NO: 7) 07 -----CSGRVEVKVQEEW------------------ (SEQ ID NO: 40) 09 --------------QEEWGTVCNNGWS--------- (SEQ ID NO: 8) 12 -----------------WGTVCNNGWSMEA------ (SEQ ID NO: 9) 14 ---------------EEWGTVCNNGWSM-------- (SEQ ID NO: 10) 18 -------------VQEEWGTVCNNGW---------- (SEQ ID NO: 11) 19 ----------------EWGTVCNNGW---------- (SEQ ID NO: 12) 20 -----------------WGTVCNNGWS--------- (SEQ ID NO: 5) huCD163- DGENKCSGRVEVKVQEEWGTVCNNGWSMEAVSVICN (SEQ ID NO: 41) domain 1-3 Peptide cluster 2: 01 ------------ESALWDC-------------- (SEQ ID NO: 15) 02 ---------RGNESALWDC-------------- (SEQ ID NO: 16) 03 -------SCRGNESALW---------------- (SEQ ID NO: 17) 05 ------VSCRGNESALWDC-------------- (SEQ ID NO: 18) 06 --------------ALWDCKHDGW--------- (SEQ ID NO. 19) 08 ----DHVSCRGNESALW---------------- (SEQ ID NO. 20) 11 --------CRGNESALWD--------------- (SEQ ID NO. 21) 13 -----------NESALWDCKHDGW--------- (SEQ ID NO. 22) 17 ------------ESALWDCKHDGWG-------- (SEQ ID NO. 23) huCD163- RIWMDHVSCRGNESALWDCKHDGWGKHSNCTHQ (SEQ ID NO: 42) domain1-3

    [0394] Fine epitope mapping of mAb E10B10 was performed as for Mac2-158. 1068 circular peptides (sized 7, 10 and 13 amino acids) and derived from SRCR-1 to -3 of the mouse CD163 sequence (UniProKB Q2VLH6.2) were screened with mAB E10B10 and the following top binding peptides were obtained (ranked by relative signal strength). The human CD163 sequence was aligned to this cluster, revealing another highly suitable epitope:

    TABLE-US-00006 Peptide cluster 3: 01 ---------------------VTNAPGEMKKELR--------- (SEQ ID NO: 43) 02 ------------------ASAVTNAPGEMKK------------ (SEQ ID NO: 44) 03 ---------------------VTNAPGEMKK------------ (SEQ ID NO: 45) 04 ---------------------VTNAPGE--------------- (SEQ ID NO: 46) 05 ----------------GSASAVTNAPGEM-------------- (SEQ ID NO: 47) 06 --------------------AVTNAPGEMKKEL---------- (SEQ ID NO: 48) 07 -----------------SASAVTNAPGEMK------------- (SEQ ID NO: 49) 08 ---------------SGSASAVTNAPGE--------------- (SEQ ID NO: 50) 09 --------------------AVTNAPGEMK------------- (SEQ ID NO: 51) 10 -------------------SAVTNAPGEM-------------- (SEQ ID NO: 52) 11 ------------------ASAVTNAPGE--------------- (SEQ ID NO: 53) 12 -------------------SAVTNAPGEMKKE----------- (SEQ ID NO: 54) 13 ----------------------TNAPGEMKKE----------- (SEQ ID NO: 55) mCD163 (SRCR-1,                      VTNAPGEMKKELRLAGGENNCS (SEQ ID NO: 56) N-terminus) hCD163 (SRCR-1,                        SSLGGTDKELRLVDGENKCS (SEQ ID NO: 24) N-terminus)
    The human homologues of mouse peptides 01-13 from cluster 3 have the following sequences of the N-terminal portion of the mature human CD163 protein (UniProtKB: Q86VB7):

    TABLE-US-00007 Cluster 3 peptides (mouse): human homologues: 01 SSLGGTDKELR (SEQ ID NO: 25) 06 SSLGGTDKEL (SEQ ID NO: 28) 12, 13 SSLGGTDKE (SEQ ID NO: 29) 02, 03 SSLGGTDK (SEQ ID NO: 30) 07, 09 SSLGGTD (SEQ ID NO: 31) 05, 10 SSLGGT (SEQ ID NO: 32) 04, 08, 11 SSLGG (SEQ ID NO: 26) hCD163 (SRCR-1) SSLGGTDKELRLVDGENKCS (SEQ ID NO: 24)
    These homologue peptides represent further highly suitable epitopes for the anti-CD163 antibody scaffold.

    Example 12: Production and Quality Analysis of a Compound of the Present Invention

    [0395] Conjugation of human apo-transferrin (i.e. the biopolymer scaffold) to PEG: 9 nmol human apo-transferrin (Sigma Aldrich) were incubated with 567 nmol PEG in 50 mM HEPES buffer pH 8 for 4 hours at room temperature while shaking. 4 PEG sizes were used for the conjugation: Methoxy-PEG-NHS 10 kDa (RAPP Polymere), Methoxy-PEG-NHS 5 kDa (RAPP Polymere), Methoxy-PEG-NHS 2 kDa (RAPP Polymere) and Methoxy-PEG-NHS 750 Da (RAPP Polymere). After incubation, buffer was exchanged to lx PBS using Amicon® Ultra-4 Centrifugal Filter Units—50 kDa cut off (Sigma Aldrich) and the protein concentration was measured using a Qubit 4 Fluorometer (Thermo Scientific).

    [0396] Quality control of coupled human apo-transferrin: The coupled protein conjugates were quality checked by SDS page analysis. 2.5 μg protein was loaded onto a 4-15% gradient TGX gel under reducing conditions following SDS page analysis (250 V, approximately 20 min). Proteins were visualized with PageBlue™ Protein Staining Solution (Thermo Scientific).

    [0397] FIG. 10 shows 2.5 μg protein coupled to PEG (10 kDa, 5 kDa, 2 kDa, 750 Da) analysed by SDS page. All conjugates showed a complete shift according to the size of their conjugated PEG molecule (lanes 3-6), when compared to the unconjugated Apo-transferrin (lane 2) which delineates the migration of the unconjugated scaffold protein. The original human Apo-transferrin band (lane 2) completely disappeared upon conjugation of PEG (different sizes indicated in lanes 3-6) thereby providing a quality proof and consistency check for functional animal experiments with PEG-SADCs.

    [0398] In conclusion, PEG was efficiently coupled to human apo-transferrin to produce a compound of the present invention.

    Example 13: Selective Anti-PEG Antibody Depletion by a Compound of the Present Invention In Vivo

    [0399] 4 female Balb/c mice per group, typically aged 9-11 weeks, were injected with 10 μg rabbit anti-PEG antibody (abcam, ab190652) followed by injection of 50 μg PEG-SADC (see example 12 for production method) in a volume of 100 μl at timepoint (T) 24 hrs. It was previously determined for this experiment that the half-life of rabbit IgG was in the range of 5 days. Blood was taken at different time points and anti-PEG antibody detected by ELISA.

    [0400] Unexpectedly, it was found that 2 kDa, 5 kDa and 750 Da PEG-SADC provided effective and rapid anti-PEG antibody signal lowering. The 2 kDa PEG-SADC formulation was most effective and long lasting anti PEG antibody lowering until the end of the experiment at timepoint (T) 120 hours (T120). In contrast, the 10 kDa PEG-SADC formulation was less effective. Importantly, the previously suggested free PEG 10 kDa formulation (cf. WO 2019/046185 A1 and McSweeney et al.) did not show any lowering of the antibody signal at the comparable dose. As a reference, relative anti PEG antibody levels were set to 100% just before SADC application and deduced from a reference antibody concentration (2-fold titration of antibody starting at 200 ng/ml) on each plate of the ELISA. Bars indicate the geometric mean, and error bars correspond to geometric standard deviation. FIG. 11 shows efficient antibody lowering with 750 Da PEG-SADC, 2 kDa PEG-SADC and 5 kDa PEG-SADCs, while the 10 kDa PEG-SADC formulation was less efficient. The PEG-only formulation (PEG 10 kDa) did not show any lowering of the antibody at the comparable dose used (human Apo-transferrin was used as negative control and demarcate the natural decay of rabbit IgG in mice at approximately 5 days).

    [0401] Detailed methods: PEG-SADC preparations were resuspended in PBS and injected intravenously, typically 24 hours after initial application of anti-PEG antibody (abcam, ab190652). The applied antibody dose was bug in 100 ul PBS (unless otherwise indicated). Blood takes were performed by submandibular vein puncture, before (indicated by negative hr numbers) or after (indicated by positive hr numbers) SADC injections. The effectivity of selective antibody lowering was measured by standard ELISA using biotinylated PEG (20 kDa PEG-Biotin, Creative PEGWorks) on streptavidin plates (Pierce™ Streptavidin Coated High Capacity Plates, Clear, 96-Well, Thermo Scientific). Upon incubation of the serum on the plates (diluted in PBS+0.1% BSA+0.01% Tween20), plates were washed with PBS+0.01% Tween 20. Bound antibodies were detected with anti-rabbit IgG-HRP (Peroxidase AffiniPure Goat Anti-Rabbit IgG, Fc fragment specific, Jackson Immuno Research). After washing, TMB was used as a substrate and the development reaction was stopped with TMB Stop solution. Signals were read at 450 nm.

    Example 14: Compounds of the Present Invention are Non-Immunogenic

    [0402] The aim was to determine whether the intravenous injection of PEG-SADCs would lead to an increase of anti-PEG antibodies in the body. Three female Balb/c mice (aged 9-11 weeks) were injected with PEG-SADCs with different PEG chain lengths. The immunization protocol for PEG-SADCs was a weekly i.v. injection of 50 μg PEG-SADC. In total, 4 injections were performed for each PEG-SADC. Blood was collected before the first injection, as well as one week after each injection.

    [0403] The analysis of anti-PEG IgG and IgM was performed by ELISA against 20 kDa PEG-Biotin (Creative PEGWorks). 2 μg/ml 20 kDa PEG-Biotin were bound to streptavidin-plates (Pierce™ Streptavidin Coated High Capacity Plates, Clear, 96-Well, Thermo Scientific) for 1 h. As a positive control, 2 μg/ml biotinylated mouse IgM was immobilized on the Streptavidin plate (Sigma). Biotinylation of the mouse IgM antibody was performed by using the EZ-Link™ NHS-PEG4 Biotinylation Kit (Thermo Scientific). After washing the plates 3 times with PBS+0.01% Tween20, mouse sera were incubated on the plate at a dilution of 1:100 (in PBS+0.1% BSA+0.01% Tween20) in triplicates. Bound mouse antibodies were detected with goat anti mouse IgG+IgM-HRP antibody (Jackson Immuno Research) at a dilution of 1:1000. After washing, TMB was used as a substrate and the development reaction was stopped with TMB Stop solution. Signals were read at 450 nm.

    [0404] In FIG. 12, mean values (OD 450 nm values) for individual mice are shown as a scatter dot blot, including 4 signals of a positive control in order to highlight the saturation range of this ELISA as a technical control.

    [0405] PEG-SADCs did not induce any detectable anti-PEG antibody increase after repeated injections of PEG-SADCs (cf. FIG. 12). This underscores the suitability of the inventive PEG-SADCs to reduce undesirable anti-PEG antibodies in vivo, even when administrated repeatedly.

    Example 15: Increased PEG-Coupling Density by Using a Peptide-Based Linker

    [0406] It was tested whether a peptide-based linker might provide improve PEG conjugation to the biopolymer scaffold.

    [0407] A biopolymer scaffold (human apo-transferrin) was incubated with a 75-molar excess of Sulfo-GMBS (N-γ-maleimidobutyryl-oxysulfosuccinimide ester) for 1 hour at room temperature, excess Sulfo-GMBS was removed by gel filtration. Subsequently, a 40-molar excess of peptide CGK (Biotin-Aca)GGGGNPGY-NH2 (SEQ ID NO: 58) was added and the mixture incubated for 1 hour at room temperature (Aca is epsilon-aminocaproic acid). Excess spacer peptide was removed by ultrafiltration using a 50-kDa-cut-off membrane. Subsequently, an 80-molar excess of 2 kDa NHS-PEG was added and the mixture incubated for 1 hour at room temperature to yield the final compound S3, analyzed in duplicate (sample 3, 4; see table 3).

    [0408] For comparison, the biopolymer scaffold (human apo-transferrin) was incubated with an 80-molar excess of 2 kDa NHS-PEG (1 hour, room temperature) to yield compound S5 (analyzed in duplicate).

    [0409] Further comparison constructs S1, S2 and S4 were created (see Table 3 below).

    [0410] To determine the amount of covalently bound PEG molecules, size exclusion chromatography with inline multi-angle light scattering (SEC-MALS) was performed as follows: Prior to injection, samples were spun at 10,000 g for 10 min. Using a Malvern Panalytical OMNISEC system, samples were injected onto a Superdex 200 increase 10/300 GL size exclusion column at 0.5 ml/min. PBS was used as a running buffer. BSA was used to calibrate and confirm the detection system which consisted of refractive index, UV/Vis and light scattering detectors. Data were analyzed with OMNISEC version 5.12 software using the protein conjugate analysis method.

    [0411] Surprisingly, it turned out that a peptide-based linker was suitable to increase PEG-coupling density while maintaining the antibody-depleting functionality of the compound. Table 3 (see below) shows that by using such a linker based on a short peptide, the amount of PEG conjugated to the biopolymer scaffold was significantly increased, by approx. 68% (see comparison between compounds S3 and S5).

    TABLE-US-00008 TABLE 3 total protein peptide PEG average construct sample peptide PEG GMBS mass [Da] mass [Da] mass [Da] #peptides mass [Da] #PEG #PEGs S1 1 no peptide − + 83590 S2 2 peptide − + 108300 108300 24710 18.18 S3 3 peptide + + 131675 107841.83 23833.18 11.92 12.27 S3 4 peptide + + 129449 104206.45 25242.56 12.62 S4 5 no peptide − 82770 S5 6 no peptide + − 96643 81276.76 15366.24 7.68 7.33 S5 7 no peptide + − 96269 82310 13959.01 6.98

    Example 16: Comparison Between 2 kDa PEG-SADC and 10 kDa PEG-SADC

    [0412] 50 μg 2 kDa- and 10 kDa-methoxy-PEG-hu apo-transferrin and hu apo-transferrin control were injected at time point 24 h into 4 female mice (BALB/c) per group that had received 10 μg of Rabbit anti-methoxyPEG antibody (abcam, ab190652; conc. 0.1 mg/mL) at time point 0 h by intravenous injection via the retro-orbital route (r.o.). Blood was collection every 24 hrs as indicated on the X-axis.

    [0413] Results are shown in FIG. 13. Free rabbit anti-PEG from serum was detected by standard ELISA using Methoxy-PEG-Biotin-coated streptavidin ELISA plates (CreativePEGworks); the Y-axis indicates relative anti-PEG decrease (in %) calculated from EC50 using GraphPad Prism, as in the other experiments.

    [0414] This independent experiment corroborated the surprising results of Example 13, over a longer observation period. The 2 kDa PEG-SADC formulation was most effective and caused long lasting anti-PEG antibody lowering. In contrast, the 10 kDa PEG-SADC formulation still achieved anti-PEG antibody lowering but was less effective.

    NON-PATENT REFERENCES

    [0415] Akbarzadehlaleh, Parvin, et al. “PEGylated human serum albumin: review of PEGylation, purification and characterization methods.” Advanced pharmaceutical bulletin 6.3 (2016): 309. [0416] Aldosari, Basmah N., Iman M. Alfagih, and Alanood S. Almurshedi. “Lipid nanoparticles as delivery systems for RNA-based vaccines.” Pharmaceutics 13.2 (2021): 206. [0417] Armstrong, Jonathan K. “The occurrence, induction, specificity and potential effect of antibodies against poly (ethylene glycol).” Pegylated protein drugs: Basic science and clinical applications. Birkhäuser Basel, 2009. 147-168. [0418] Balakrishnan, Balaji, and Ernest David. “Biopolymers augment viral vectors based gene delivery.” Journal of biosciences 44.4 (2019): 84. [0419] Barry, Michael A., Jeffrey D. Rubin, and Shao-Chia Lu. “Retargeting adenoviruses for therapeutic applications and vaccines.” FEBS letters (2020). [0420] Binder, Uli, and Arne Skerra. “PASylation: a versatile technology to extend drug delivery.” Current Opinion in Colloid & Interface Science 31 (2017): 10-17. [0421] Booth, Claire, and H. Bobby Gaspar. “Pegademase bovine (PEG-ADA) for the treatment of infants and children with severe combined immunodeficiency (SCID).” Biologics: targets & therapy 3 (2009): 349. [0422] Bozovičar, Krištof, and Tomaž Bratkovič. “Small and Simple, yet Sturdy: Conformationally Constrained Peptides with Remarkable Properties.” International Journal of Molecular Sciences 22.4 (2021): 1611. [0423] Carter, John Mark, and Larry Loomis-Price. “B cell epitope mapping using synthetic peptides.” Current protocols in immunology 60.1 (2004): 9-4. [0424] Dong, Yetian, et al. “A systematic review of SARS-CoV-2 vaccine candidates.” Signal transduction and targeted therapy 5.1 (2020): 1-14. [0425] Dijkstra, C. D., et al. “The heterogeneity of mononuclear phagocytes in lymphoid organs: distinct macrophage subpopulations in rat recognized by monoclonal antibodies ED1, ED2 and ED3.” Microenvironments in the Lymphoid System. Springer, Boston, M A, 1985. 409-419. [0426] Chapman, Andrew P. “PEGylated antibodies and antibody fragments for improved therapy: a review.” Advanced drug delivery reviews 54.4 (2002): 531-545. [0427] Elia, Natalie. “Using unnatural amino acids to selectively label proteins for cellular imaging: a cell biologist viewpoint.” The FEBS Journal 288.4 (2021): 1107-1117. Epub 2020 Jul. 22. [0428] Elliott, Serra E., et al. “A pre-eclampsia-associated Epstein-Barr virus antibody cross-reacts with placental GPR50.” Clinical Immunology 168 (2016): 64-71. [0429] Erlandsson, Ann, et al. “In vivo clearing of idiotypic antibodies with antiidiotypic antibodies and their derivatives.” Molecular immunology 43.6 (2006): 599-606. [0430] Etzerodt, Anders, et al. “Efficient intracellular drug-targeting of macrophages using stealth liposomes directed to the hemoglobin scavenger receptor CD163.” Journal of controlled release 160.1 (2012): 72-80. [0431] Fabriek, Babs O., et al. “The macrophage scavenger receptor CD163 functions as an innate immune sensor for bacteria.” Blood 113.4 (2009): 887-892. [0432] Galanis, Kosmas A., et al. “Linear B-cell epitope prediction for in silico vaccine design: a performance review of methods available via command-line interface.” International journal of molecular sciences 22.6 (2021): 3210. [0433] Garay, Ricardo P., et al. “Antibodies against polyethylene glycol in healthy subjects and in patients treated with PEG-conjugated agents.” (2012): 1319-1323. [0434] Garces, Jorge Carlos, et al. “Antibody-mediated rejection: a review.” The Ochsner Journal 17.1 (2017): 46. [0435] Gaspar, Maria Manuela, et al. “Targeted delivery of transferrin-conjugated liposomes to an orthotopic model of lung cancer in nude rats.” Journal of aerosol medicine and pulmonary drug delivery 25.6 (2012): 310-318. [0436] Gazarian, Karlen, et al. “Mimotope peptides selected from phage display combinatorial library by serum antibodies of pigs experimentally infected with Taenia solium as leads to developing diagnostic antigens for human neurocysticercosis.” Peptides 38.2 (2012): 381-388. [0437] Gfeller, David, et al. “Current tools for predicting cancer-specific T cell immunity.” Oncoimmunology 5.7 (2016): e1177691. [0438] Granfeldt, Asger, et al. “Targeting dexamethasone to macrophages in a porcine endotoxemic model.” Critical Care Medicine 41.11 (2013): e309-e318. [0439] Graversen, Jonas H., et al. “Targeting the hemoglobin scavenger receptor CD163 in macrophages highly increases the anti-inflammatory potency of dexamethasone.” Molecular Therapy 20.8 (2012): 1550-1558. [0440] Gurda, Brittney L., et al. “Mapping a neutralizing epitope onto the capsid of adeno-associated virus serotype 8.” Journal of virology 86.15 (2012): 7739-7751. [0441] Hansen, Lajla Bruntse, Soren Buus, and Claus Schafer-Nielsen. “Identification and mapping of linear antibody epitopes in human serum albumin using high-density peptide arrays.” PLoS One 8.7 (2013): e68902. [0442] Hoang Thi, Thai Thanh, et al. “The Importance of Poly (ethylene glycol) Alternatives for Overcoming PEG Immunogenicity in Drug Delivery and Bioconjugation.” Polymers 12.2 (2020): 298. [0443] Homma, Masayuki, et al. “A Novel Fusion Protein, AChR-Fc, Ameliorates Myasthenia Gravis by Neutralizing Antiacetylcholine Receptor Antibodies and Suppressing Acetylcholine Receptor-Reactive B Cells.” Neurotherapeutics 14.1 (2017): 191-198. [0444] Howard Jr, James F. “Myasthenia gravis: the role of complement at the neuromuscular junction.” Annals of the New York Academy of Sciences 1412.1 (2018): 113-128. [0445] Howarth, M., & Brune, K. D. (2018). New routes and opportunities for modular construction of particulate vaccines: stick, click and glue. Frontiers in immunology, 9, 1432. [0446] Inglut, Collin T., et al. “Immunological and toxicological considerations for the design of liposomes.” Nanomaterials 10.2 (2020): 190. [0447] Ishida, Tatsuhiro, et al. “Accelerated blood clearance of PEGylated liposomes upon repeated injections: effect of doxorubicin-encapsulation and high-dose first injection.” Journal of controlled release 115.3 (2006): 251-258. [0448] Jain, Swati, et al. “Nucleic acid therapeutics: a focus on the development of aptamers.” Expert Opinion on Drug Discovery 16.3 (2021): 255-274. [0449] Jansson, Liselotte, et al. “Immunotherapy With Apitopes Blocks the Immune Response to TSH Receptor in HLA-DR Transgenic Mice.” Endocrinology 159.9 (2018): 3446-3457. [0450] Jensen, Kamilla Kjærgaard, et al. “Improved methods for predicting peptide binding affinity to MHC class II molecules.” Immunology 154.3 (2018): 394-406. [0451] Jurtz, Vanessa, et al. “NetMHCpan-4.0: improved peptide-MHC class I interaction predictions integrating eluted ligand and peptide binding affinity data.” The Journal of Immunology 199.9 (2017): 3360-3368. [0452] Kang, Tse Siang, and Raymond C. Stevens. “Structural aspects of therapeutic enzymes to treat metabolic disorders.” Human mutation 30.12 (2009): 1591-1610. [0453] Kant, Sam, and Mohamed G. Atta. “Therapeutic advances in Fabry disease: The future awaits.” Biomedicine & Pharmacotherapy 131 (2020): 110779. [0454] Kaur, Simran Preet, and Vandana Gupta. “COVID-19 Vaccine: A comprehensive status report.” Virus research (2020): 198114. [0455] Kim, Jaesung, et al. “Enhancing the therapeutic efficacy of adenovirus in combination with biomaterials.” Biomaterials 33.6 (2012): 1838-1850. [0456] Kim, Tae Hyung, et al. “PEG-transferrin conjugated TRAIL (TNF-related apoptosis-inducing ligand) for therapeutic tumor targeting.” Journal of controlled release 162.2 (2012): 422-428. [0457] Koşalo{hacek over (g)}lu-Yalçin, Zeynep, et al. “Predicting T cell recognition of MHC class I restricted neoepitopes.” Oncoimmunology 7.11 (2018): e1492508. [0458] Koniev, Oleksandr, and Alain Wagner. “Developments and recent advancements in the field of endogenous amino acid selective bond forming reactions for bioconjugation.” Chemical Society Reviews 44.15 (2015): 5495-5551. [0459] Krutzke, Lea, et al. “Substitution of blood coagulation factor X-binding to Ad5 by position-specific PEGylation: preventing vector clearance and preserving infectivity.” Journal of Controlled Release 235 (2016): 379-392. [0460] Lazaridis, Konstantinos, et al. “Specific removal of autoantibodies by extracorporeal immunoadsorption ameliorates experimental autoimmune myasthenia gravis.” Journal of neuroimmunology 312 (2017): 24-30. [0461] Lee, Gary K., et al. “PEG conjugation moderately protects adeno-associated viral vectors against antibody neutralization.” Biotechnology and bioengineering 92.1 (2005): 24-34. [0462] Leung, Nicki Y H, et al. “Screening and identification of mimotopes of the major shrimp allergen tropomyosin using one-bead-one-compound peptide libraries.” Cellular & molecular immunology 14.3 (2017): 308-318. [0463] Lim, Sung In, and Inchan Kwon. “Bioconjugation of therapeutic proteins and enzymes using the expanded set of genetically encoded amino acids.” Critical reviews in biotechnology 36.5 (2016): 803-815. [0464] Lin, Chia-Hao, et al. “Identification of a major epitope by anti-interferon-γ autoantibodies in patients with mycobacterial disease.” Nature medicine 22.9 (2016): 994. [0465] Lorentz, Kristen M., et al. “Engineered binding to erythrocytes induces immunological tolerance to E. coli asparaginase.” Science advances 1.6 (2015): e1500112. [0466] Lu, Xueguang, and Ke Zhang. “PEGylation of therapeutic oligonucletides: From linear to highly branched PEG architectures.” Nano research 11.10 (2018): 5519-5534. [0467] Lubich, Christian, et al. “The mystery of antibodies against polyethylene glycol (PEG)-what do we know?.” Pharmaceutical research 33.9 (2016): 2239-2249. [0468] Luo, Jie, et al. “Main immunogenic region structure promotes binding of conformation-dependent myasthenia gravis autoantibodies, nicotinic acetylcholine receptor conformation maturation, and agonist sensitivity.” Journal of Neuroscience 29.44 (2009): 13898-13908. [0469] Luo, Jie, and Jon Lindstrom. “AChR-specific immunosuppressive therapy of myasthenia gravis.” Biochemical pharmacology 97.4 (2015): 609-619. [0470] Luo, Ying-Li, et al. “Macrophage-specific in vivo gene editing using cationic lipid-assisted polymeric nanoparticles.” ACS nano 12.2 (2018): 994-1005. [0471] Lutz, Gordon J., Shashank R. Sirsi, and Jason H. Williams. “PEG-PEI copolymers for oligonucleotide delivery to cells and tissues.” Gene Therapy Protocols. Humana Press, 2008. 141-150. [0472] Majowicz, Anna, et al. “Seroprevalence of pre-existing NABs against AAV1, 2, 5, 6 and 8 in the South African Hemophilia B patient population.” (2019): 3353-3353. [0473] Mazor, Ronit, et al. “Tolerogenic nanoparticles restore the antitumor activity of recombinant immunotoxins by mitigating immunogenicity.” Proceedings of the National Academy of Sciences 115.4 (2018): E733-E742. [0474] McSweeney, Morgan D., et al. “Overcoming anti-PEG antibody mediated accelerated blood clearance of PEGylated liposomes by pre-infusion with high molecular weight free PEG.” Journal of Controlled Release 311 (2019): 138-146. [0475] Meister, Daniel, S. Maryamdokht Taimoory, and John F. Trant. “Unnatural amino acids improve affinity and modulate immunogenicity: Developing peptides to treat MHC type II autoimmune disorders.” Peptide Science 111.1 (2019): e24058. [0476] Meneguetti, Giovanna Pastore, et al. “Novel site-specific PEGylated L-asparaginase.” PloS one 14.2 (2019): e0211951. [0477] Mingozzi, Federico, et al. “Overcoming preexisting humoral immunity to AAV using capsid decoys.” Science translational medicine 5.194 (2013): 194ra92-194ra92. [0478] Mingozzi, Federico, and Katherine A. High. “Overcoming the host immune response to adeno-associated virus gene delivery vectors: the race between clearance, tolerance, neutralization, and escape.” Annual review of virology 4 (2017): 511-534. [0479] Morimoto et. al., Bioconjugate Chemistry 25 (8) (2014): 1479-1491 [0480] Moussa, Ehab M., et al. “Immunogenicity of therapeutic protein aggregates.” Journal of pharmaceutical sciences 105.2 (2016): 417-430. [0481] Müller, Manuel M. “Post-translational modifications of protein backbones: unique functions, mechanisms, and challenges.” Biochemistry 57.2 (2017): 177-185. [0482] O'Riordan, Catherine R., et al. “PEGylation of adenovirus with retention of infectivity and protection from neutralizing antibody in vitro and in vivo.” Human gene therapy 10.8 (1999): 1349-1358. [0483] Park, Eun Ji, et al. “Emerging PEGylated non-biologic drugs.” Expert opinion on emerging drugs 24.2 (2019): 107-119. [0484] Peters, Bjoern, et al. “A community resource benchmarking predictions of peptide binding to MHC-I molecules.” PLoS computational biology 2.6 (2006): e65. [0485] Pishesha, Novalia, et al. “Engineered erythrocytes covalently linked to antigenic peptides can protect against autoimmune disease.” Proceedings of the National Academy of Sciences (2017): 201701746. [0486] Podust, Vladimir N., et al. “Extension of in vivo half-life of biologically active peptides via chemical conjugation to XTEN protein polymer.” Protein Engineering, Design & Selection 26.11 (2013): 743-753. [0487] Qiu, Yingshan, et al. “Effective mRNA pulmonary delivery by dry powder formulation of PEGylated synthetic KL4 peptide.” Journal of Controlled Release 314 (2019): 102-115. [0488] Ramana, Jayashree, and Kusum Mehla. “Immunoinformatics and Epitope Prediction.” Immunoinformatics. Humana, New York, NY, 2020. 155-171. [0489] Rey et al., Clinical Immunology 96 (3) (2000): 269-279 [0490] Ruff, Robert L., and Robert P. Lisak. “Nature and action of antibodies in myasthenia gravis.” Neurologic clinics 36.2 (2018): 275-291. [0491] Rummler, Silke, et al. “Current techniques for AB0-incompatible living donor liver transplantation.” World journal of transplantation 6.3 (2016): 548. [0492] Runcie, Karie, et al. “Bi-specific and tri-specific antibodies—the next big thing in solid tumor therapeutics.” Molecular Medicine 24.1 (2018): 50. [0493] Ryan, Brent J., Ahuva Nissim, and Paul G. Winyard. “Oxidative post-translational modifications and their involvement in the pathogenesis of autoimmune diseases.” Redox biology 2 (2014): 715-724. [0494] Saifer, Mark G P, et al. “Selectivity of binding of PEGs and PEG-like oligomers to anti-PEG antibodies induced by methoxyPEG-proteins.” Molecular immunology 57.2 (2014): 236-246. [0495] Sekiya, Toshiki, et al. “PEGylation of a TLR2-agonist-based vaccine delivery system improves antigen trafficking and the magnitude of ensuing antibody and CD8+ T cell responses.” Biomaterials 137 (2017): 61-72. [0496] Shanmugam, Arulkumaran, et al. “Identification of PSA peptide mimotopes using phage display peptide library.” Peptides 32.6 (2011): 1097-1102. [0497] Sharp, Kim A., et al. “Synthesis and application of a poly (ethylene glycol)-antibody affinity ligand for cell separations in aqueous polymer two-phase systems.” Analytical biochemistry 154.1 (1986): 110-117. [0498] Sherman, Merry R., et al. “Role of the methoxy group in immune responses to mPEG-protein conjugates.” Bioconjugate chemistry 23.3 (2012): 485-499. [0499] Shiraishi, Kouichi, and Masayuki Yokoyama. “Toxicity and immunogenicity concerns related to PEGylated-micelle carrier systems: a review.” Science and technology of advanced materials 20.1 (2019): 324-336. [0500] Siang Ong, Yong, et al. “Recent advances in synthesis and identification of cyclic peptides for bioapplications.” Current topics in medicinal chemistry 17.20 (2017): 2302-2318. [0501] Siekmann, Jürgen, and Peter L. Turecek. “PEGylation of human coagulation factor VIII and other plasma proteins.” Polymer-Protein Conjugates. Elsevier, 2020. 155-174. [0502] Skytthe, Maria K., Jonas Heilskov Graversen, and Søren K. Moestrup. “Targeting of CD163+Macrophages in Inflammatory and Malignant Diseases.” International Journal of Molecular Sciences 21.15 (2020): 5497. [0503] Solomon, Melani, and Silvia Muro. “Lysosomal enzyme replacement therapies: Historical development, clinical outcomes, and future perspectives.” Advanced drug delivery reviews 118 (2017): 109-134. [0504] Sørensen, Karen Kristine, et al. “Liver sinusoidal endothelial cells.” Comprehensive Physiology 5.4 (2011): 1751-1774. [0505] Spiess, Christoph, Qianting Zhai, and Paul J. Carter. “Alternative molecular formats and therapeutic applications for bispecific antibodies.” Molecular immunology 67.2 (2015): 95-106. [0506] Suk, Jung Soo, et al. “PEGylation as a strategy for improving nanoparticle-based drug and gene delivery.” Advanced drug delivery reviews 99 (2016): 28-51. [0507] Sun, Pingping, et al. “Advances in in-silico B-cell epitope prediction.” Current topics in medicinal chemistry 19.2 (2019): 105-115. [0508] Swierczewska, Magdalena, Kang Choon Lee, and Seulki Lee. “What is the future of PEGylated therapies?.” Expert opinion on emerging drugs 20.4 (2015): 531-536. [0509] Sun, Yanping, et al. “Exploring the functions of polymers in adenovirus-mediated gene delivery: Evading immune response and redirecting tropism.” Acta biomaterialia 97 (2019): 93-104. [0510] Taddeo, Adriano, et al. “Selection and depletion of plasma cells based on the specificity of the secreted antibody.” European journal of immunology 45.1 (2015): 317-319. [0511] Teschner, Sven, et al. “ABC-incompatible kidney transplantation using regenerative selective immunoglobulin adsorption.” Journal of clinical apheresis 27.2 (2012): 51-60. [0512] Tetala, Kishore K R, et al. “Selective depletion of neuropathy-related antibodies from human serum by monolithic affinity columns containing ganglioside mimics.” Journal of medicinal chemistry 54.10 (2011): 3500-3505. [0513] Torres-Obreque, Karin, et al. “Production of a novel N-terminal PEGylated crisantaspase.” Biotechnology and applied biochemistry 66.3 (2019): 281-289. [0514] Turk, Viktorija Erdeljic. “Anaphylaxis associated with the mRNA COVID-19 vaccines: Approach to allergy investigation.” Clinical Immunology 227 (2021): 108748. [0515] Vincent, Angela, et al. “Serological and experimental studies in different forms of myasthenia gravis.” Annals of the New York Academy of Sciences 1413.1 (2018): 143-153. [0516] Wallukat, Gerd, et al. “Patients with preeclampsia develop agonistic autoantibodies against the angiotensin AT 1 receptor.” The Journal of clinical investigation 103.7 (1999): 945-952. [0517] Weaver, Eric A., and Michael A. Barry. “Effects of shielding adenoviral vectors with polyethylene glycol on vector-specific and vaccine-mediated immune responses.” Human gene therapy 19.12 (2008): 1369-1382. [0518] Wegmann, Frank, et al. “Polyethyleneimine is a potent mucosal adjuvant for viral glycoprotein antigens.” Nature biotechnology 30.9 (2012): 883-888. [0519] Worm, Margitta, et al. “Practical recommendations for the allergological risk assessment of the COVID-19 vaccination-a harmonized statement of allergy centers in Germany.” Allergologie select 5 (2021): 72. [0520] Yang, Qi, and Samuel K. Lai. “Anti-PEG immunity: emergence, characteristics, and unaddressed questions.” Wiley Interdisciplinary Reviews: Nanomedicine and Nanobiotechnology 7.5 (2015): 655-677. [0521] Yang, Qi, et al. “Analysis of pre-existing IgG and IgM antibodies against polyethylene glycol (PEG) in the general population.” Analytical chemistry 88.23 (2016): 11804-11812. [0522] Yoshimoto, Noriko, et al. “PEG chain length impacts yield of solid-phase protein PEGylation and efficiency of PEGylated protein separation by ion-exchange chromatography: Insights of mechanistic models.” Biotechnology journal 8.7 (2013): 801-810. [0523] Zhang, Tingting, et al. “Moderate PEGylation of the carrier protein improves the polysaccharide-specific immunogenicity of meningococcal group A polysaccharide conjugate vaccine.” Vaccine 33.28 (2015): 3208-3214. [0524] Zhou, Cissy C., et al. “Angiotensin receptor agonistic autoantibodies induce pre-eclampsia in pregnant mice.” Nature medicine 14.8 (2008): 855. [0525] Zinsli, Léa V., et al. “Deimmunization of protein therapeutics-Recent advances in experimental and computational epitope prediction and deletion.” Computational and Structural Biotechnology Journal (2020).