HUMANIZED ANTIBODY, CHIMERIC ANTIGEN RECEPTOR, NUCLEIC ACID, VECTOR, CELL AND USE
20230357427 · 2023-11-09
Inventors
Cpc classification
A61K39/4611
HUMAN NECESSITIES
C07K2319/33
CHEMISTRY; METALLURGY
C07K2317/73
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
G01N33/57492
PHYSICS
C07K14/535
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
A61K39/00
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
C07K14/535
CHEMISTRY; METALLURGY
C07K14/705
CHEMISTRY; METALLURGY
Abstract
Provided are a humanized antibody specifically binding to EpCAM, and a chimeric antigen receptor, a nucleic acid, a vector, a cell, and the use associated with the humanized antibody. The humanized antibody comprises a heavy chain variable region and a light chain variable region. The sequence of the heavy chain variable region comprises a sequence shown in SEQ ID.1, a sequence shown in SEQ ID.2 and a sequence shown in SEQ ID.3. The sequence of the light chain variable region comprises a sequence shown in SEQ ID.4, a sequence shown in SEQ ID.5, and a sequence shown in SEQ ID.6. After the humanized antibody is constructed as a chimeric antigen receptor-T Cell, EpCAM-positive tumor cells can be specifically identified and killed, and tumors can be cleared in an animal body.
Claims
1. A humanized antibody, which comprises a heavy chain variable region and a light chain variable region, wherein: a sequence of the heavy chain variable region comprises a sequence shown in SEQ ID NO: 1, a sequence shown in SEQ ID NO: 2 and a sequence shown in SEQ ID NO: 3, respectively as a sequence of a first heavy chain complementarity determining region, a sequence of a second heavy chain complementarity determining region and a sequence of a third heavy chain complementarity determining region; and a sequence of the light chain variable region comprises a sequence shown in SEQ ID NO: 4, a sequence shown in SEQ ID NO: 5 and a sequence shown in SEQ ID NO: 6, respectively as a sequence of a first light chain complementarity determining region, a sequence of a second light chain complementarity determining region and a sequence of a third light chain complementarity determining region.
2. The humanized antibody according to claim 1, wherein, the sequence of the heavy chain variable region is at least 90% identical to any one of SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 and SEQ ID NO: 11; and the sequence of the light chain variable region is at least 90% identical to any one of SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14 and SEQ ID NO: 15.
3. A chimeric antigen receptor, which comprises an extracellular antigen binding region, a hinge region, a transmembrane region and an intracellular signal region, the extracellular antigen binding region comprising the humanized antibody according to claim 1, or a fragment of the humanized antibody.
4. The chimeric antigen receptor according to claim 3, wherein a sequence of the hinge region is derived from at least one of CD8α, CD28, 4-1BB, ICOS, OX40, CD40, CD80 and IgG, a sequence of the transmembrane region is derived from at least one of CD2, CD27, LFA-1, CD8α, CD28, 4-1BB, ICOS, OX40, CD40, CD80, CD3ζ and CD3ε, and a sequence of the intracellular signal region is derived from a Toll-like receptor, and at least one of CD2, CD27, LFA-1, CD8a, CD28, 4-1BB, ICOS, OX40, CD40, CD80, DAP10, DAP12, CD3ζ and CD3ε.
5. The chimeric antigen receptor according to claim 3, wherein a sequence of the chimeric antigen receptor is selected from any one of sequences shown in SEQ ID NOs: 18-29.
6. A nucleic acid, which comprises a sequence encoding the humanized antibody according to claim 1, or a fragment of the sequence.
7. A nucleic acid, which comprises a nucleotide sequence encoding the chimeric antigen receptor according to claim 3, or a fragment of the sequence.
8. A vector comprising the nucleic acid according to claim 6.
9. A cell comprising the nucleic acid according to claim 6.
10. A method of detecting human tumors or treating human cancers using the humanized antibody according to claim 1.
11. A vector comprising the nucleic acid according to claim 7.
12. A cell comprising the nucleic acid according to claim 7.
13. A cell comprising the vector according to claim 8.
14. A method of detecting human tumors or treating human cancers using the chimeric antigen receptor according to claim 3.
15. A method of detecting human tumors or treating human cancers using the nucleic acid according to claim 6.
16. A method of detecting human tumors or treating human cancers using the nucleic acid according to claim 7.
17. A method of detecting human tumors or treating human cancers using the vector according to claim 8.
18. A method of detecting human tumors or treating human cancers using the vector according to claim 11.
19. A method of detecting human tumors or treating human cancers using the cell according to claim 9.
20. A method of detecting human tumors or treating human cancers using the cell according to claim 12.
21. A method of detecting human tumors or treating human cancers using the cell according to claim 13.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
DETAILED DESCRIPTION
[0037] In order to make the purposes, technical solutions and advantages of the embodiments of the present disclosure clearer, the technical solutions in the embodiments of the present disclosure will be described clearly and completely below. Obviously, the described embodiments are part of the embodiments of the present disclosure, but not all of them. Based on the embodiments of the present disclosure, all other embodiments obtained by those of ordinary skill in the art without creative efforts shall fall within the protection scope of the present disclosure. Unless otherwise defined, technical or scientific terms used herein should have the ordinary meaning as understood by one of ordinary skill in the art to which this disclosure belongs. As used herein, “comprising” and similar words mean that the elements or things appearing before the word encompass the elements or things recited after the word and their equivalents, but do not exclude other elements or things.
[0038] The technical and scientific terms used in the present disclosure have the same or similar meanings as commonly understood by those skilled in the art. To facilitate understanding of the present disclosure, some terms are defined as follows:
[0039] The “antibody” in the present disclosure refers to an antigen-binding protein of the immune system, including a complete full-length antibody with an antigen-binding region or any fragment of its “antigen-binding portion” or “antigen-binding region”, or a single chain thereof such as a single chain variable fragment (scFv). A natural antibody refers to a glycoprotein of at least two heavy (H) chains and two light (L) chains or antigen-binding fragments thereof interconnected by disulfide bonds. The “antibody” also includes all recombinant forms of antibodies, particularly those described herein, such as antibodies expressed in prokaryotic cells, unglycosylated antibodies, and antibody fragments and derivatives that bind to an antigen. Each heavy chain consists of a heavy chain variable region (abbreviated as VH) and a heavy chain constant region (abbreviated as CH). Each light chain consists of a light chain variable region (abbreviated as VL) and a light chain constant region (abbreviated as CL). VH and VL can be further subdivided into hypervariable regions called complementarity determining regions (CDRs) interspersed in more conserved regions called framework regions (FRs). Each VH and VL consists of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain binding domains that interact with the antigen. The constant region of the antibody can mediate the binding of the immunoglobulin to host tissues or factors including various cells of the immune system (e.g., effector cells) and the first component (C1q) of the classical complement system.
[0040] Antibody fragments include, but are not limited to:
[0041] (i) a Fab fragment composed of VL, VH, CL and CH1 domains, including Fab′ and Fab′-SH, (ii) an Fd fragment composed of VH and CH1 domains, (iii) an Fv fragment composed of VL and VH domains of a single antibody; (iv) a dAb fragment composed of a single variable region; (v) a F(ab′)2 fragment, a bivalent fragment comprising 2 linked Fab fragments; (vi) a single-chain Fv molecule antigen binding site; (vii) a bispecific single-chain Fv dimer; (viii) a “disome” or a “trisome”, a multivalent or multispecific fragment constructed by genetic fusion and (ix) an scFv genetically fused to the same or different antibodies.
[0042] The term “Fc” or “Fc region” in the present disclosure includes a polypeptide of the antibody constant region other than the immunoglobulin domain of the first constant region. Thus, Fc refers to the last two constant region immunoglobulin domains of IgA, IgD and IgG, and the last three constant region immunoglobulin domains of IgE and IgM, and the N-terminal flexible hinge of these domains. For IgA and IgM, Fc may include the J chain. For IgG, Fc includes the immunoglobulin domains Cγ2 and Cγ3 and a hinge between Cγ1 and Cγ2. Although the boundaries of the Fc region may vary, the Fc region of a human IgG heavy chain is generally defined as comprising residues C226 or P230 at its carboxy terminus, where the numbering is according to the Kabat EU index. For human IgG1, Fc is defined herein as comprising residue P232 to its carboxy terminus, where the numbering is according to the EU index in Kabat. Fc can refer to this region in isolation, or in the context of an Fc polypeptide, e.g., an antibody. The aforementioned “hinge” includes a flexible polypeptide comprising amino acids between the first and second constant domains of an antibody. Structurally, the CH1 domain of IgG ends at EU220 and the CH2 domain of IgG begins at residue EU237.
[0043] The term “mutated sequence obtained by substitution” in the present disclosure means replacing an amino acid at a specific position in the parent polypeptide sequence with another amino acid. The “deletion” in the “mutated sequence obtained by substitution or deletion” of the present disclosure means the removal of an amino acid at a specific position in the parent polypeptide sequence.
[0044] The “chimeric antigen receptor” or “CAR” of the present disclosure refers to those comprising an extracellular antigen binding region capable of binding an antigen, a hinge region, a transmembrane region and an intracellular signal region. The intracellular signal region refers to a protein that transmits information into a cell to regulate cell activity via an identified signal transduction pathway by producing a second messenger, or a protein that functions as an effector in response to such messengers, which comprises a primary signaling domain, and may also include a functional signaling domain (i.e., a costimulatory signaling domain) derived from a stimulatory molecule as defined below. Intracellular signaling domains generate signals that can promote the immunological effect subfunction of the cells of CAR (e.g., CAR-T cells), examples of the immunological effect subfunction, such as in CAR-T cells, include cytolytic activity and helper activity, including cellular factor secretion.
[0045] The term “costimulatory signaling domain” refers to a “costimulatory molecule”, which is a cognate binding partner on a T cell that specifically binds a costimulatory ligand, thereby mediating a costimulatory response of the T cell, such as, but not limited to, proliferation. Costimulatory molecules are cell surface molecules or ligands thereof of non-antigen receptors, which are required for an effective immune response. Costimulatory molecules include, but are not limited to, Toll-like receptors, CD2, CD27, LFA-1 (CD11a/CD18), CD8α, CD28, 4-1BB, ICOS, OX40, CD40, CD80, DAP10, DAP12, CD3ζ, CD3ε, etc.
[0046] In the present disclosure:
[0047] “CD3ζ” is defined as the protein provided as GenBan Accession No. BAG36664.1, or the equivalent residues from a non-human species such as mouse, rodent, monkey, ape, and the like. A “CD3ζ domain” is defined as the amino acid residues from the cytoplasmic domain of the ζ chain sufficient to functionally transmit the initial signals required for T cell activation. In one aspect, the cytoplasmic domain of ζ comprises residues 52 to 163 of GenBank Accession No. BAG36664.1, functionally directed to homologues-equivalent residues from a non-human species such as mouse, rodent, monkey, ape, and the like.
[0048] “CD28” is defined as the protein provided as GenBan Accession No. NP_006130.1, or the equivalent residues from a non-human species such as mouse, rodent, monkey, ape, and the like. A “CD28 signaling region” is defined as the amino acid residues from the cytoplasmic domain of CD28, which is capable of transmitting costimulatory signals required for T cell activation, and the sequence of which comprises residues 180 to 220 of GenBank Accession No. NP_006130.1, functionally directed to homologues-equivalent residues from a non-human species such as mouse, rodent, monkey, ape, and the like. A “CD28 hinge region” comprises residues 114 to 152 of GenBank Accession No. NP_006130.1, functionally directed to homologues-equivalent residues from a non-human species such as mouse, rodent, monkey, ape, and the like. A “CD28 hinge transmembrane region” comprises residues 153 to 179 of GenBank Accession No. NP_006130.1, functionally directed to homologues-equivalent residues from a non-human species such as mouse, rodent, monkey, ape, and the like.
[0049] “4-1BB” refers to a member of the TNFR superfamily having the amino acid sequence of GenBank Accession No. NP_001552.2, or equivalent residues from a non-human species such as mouse, rodent, monkey, ape, and the like. A “4-1 BB signaling region” is defined as the amino acid residues from the cytoplasmic domain of 4-1BB, which is capable of transmitting costimulatory signals required for T cell activation, and the sequence of which comprises residues 214 to 255 of GenBank Accession No. NP_006130.1 255, functionally directed to homologues-equivalent residues from a non-human species such as mouse, rodent, monkey, ape, and the like.
[0050] EpCAM described in the embodiments of the present disclosure is an epithelial cell adhesion molecule. The humanized antibody specifically binds to EpCAM expressed in relevant tumors. The relevant tumors include epithelial tumors, specifically esophageal cancer, gastric cancer, colorectal cancer, prostate cancer, lung cancer, ovarian cancer, breast cancer, kidney cancer, hepatocellular carcinoma and pancreatic cancer.
[0051] In an embodiment of the present disclosure, the humanized antibody is a humanized full-length antibody, which has a subtype of hIgG1.
[0052] In some embodiments, the humanized antibody is a single-chain antibody, which has a subtype of any one of hIgG1, hIgG2, hIgG3 and hIgG4.
[0053] In some embodiments, the heavy chain variable region sequence includes a sequence shown in SEQ ID NO: 1, a sequence shown in SEQ ID NO: 2, and a sequence shown in SEQ ID NO: 3, respectively denoted as a sequence of CDR-H1, a sequence of CDR-H2 and a sequence of CDR-H3, CDR-H1, CDR-H2 and CDR-H3 are a first heavy chain complementarity determining region, a second heavy chain complementarity determining region and a third heavy chain complementarity determining region, respectively.
[0054] In some embodiments, a sequence of a first heavy chain framework region between CDR-H1 and CDR-H2 is QVQLVQSGAEVKKPG X6SVKVSCKASGX7TFX8, where X6 is any one of A and S, X7 is any one of Y and G, and X8 is any one of T and S.
[0055] In some embodiments, a sequence of a second heavy chain framework region between CDR-H2 and CDR-H3 is any one of WVRQAPGQGLEWMG and WVRQAPGQGLEWIG.
[0056] In some embodiments, a sequence of a third heavy chain framework region connecting CDR-H3 is X9VTX10TX11DX12STSTX13YMELSSLRSEDTAVYYCAR, X9 is any one of R and K, X10 is any one of M, L and I, X11 is any one of R, T, A and V, X12 is any one of T and E, and X13 is any one of V and A.
[0057] In some embodiments, the light chain variable region sequence includes a sequence shown in SEQ ID NO: 4, a sequence shown in SEQ ID NO: 5 and a sequence shown in SEQ ID NO: 6, respectively denoted as a sequence of CDR-L1, a sequence of CDR-L2 and a sequence of CDR-L3. CDR-L1, CDR-L2 and CDR-L3 are a first light chain complementarity determining region, a second light chain complementarity determining region and a third light chain complementarity determining region, respectively.
[0058] An embodiment of the present disclosure also provides a chimeric antigen receptor specifically targeting EpCAM, the antigen binding region of the chimeric antigen receptor comprises the humanized antibody, or a fragment of the humanized antibody.
[0059] Preferably, in some embodiments, the EpCAM-targeting antibody fragment is a single-chain variable region (scFv); the single-chain variable region has a structure of VH-Linker-VL or VL-Linker-VH; the amino acid sequence of the Linker is shown in SEQ ID NO.30, which is GGGGSGGGGSGGGGS;
[0060] In some embodiments, the chimeric antigen receptor further comprises a hinge region, the sequence of which is derived from at least one of CD8α, CD28, 4-1BB, ICOS, OX40, CD40, CD80 and IgG.
[0061] In some embodiments, the chimeric antigen receptor further comprises a transmembrane region, the sequence of which is derived from at least one of CD8α, CD28, 4-1BB, ICOS, OX40, CD40, CD80 and CD3.
[0062] In some embodiments, the chimeric antigen receptor further comprises an intracellular signal region, the sequence of which is derived from at least one of CD8α, CD28, 4-1BB, ICOS, OX40, CD40, CD80, DAP10, DAP12, CD3ζ, and CD3ε.
[0063] Preferably, the CAR molecular sequence is shown in the following table:
TABLE-US-00001 TABLE 1 Sequences of CAR Molecules Specifically Targeting EpCAM SEQ ID scFv CAR sequences 18 H1L1 MLLLVTSLLLCELPHPAFLLIPQVQLVQSGAEVKKPGASVKLSCKASGYTFT NYWINWVKQAPGQGLEWIGNIYPSYIYTNYNQEFKDKVTLTVDESTSTAYMEL SSLRSEDTAVYYCTRSPYGYDEYGLDYWGQGTTVTVSSGGGGSGGGGSGG GGSDIQLTQSPSSLSASVGDRVTMTCKSSQSLLNSRNQKNYLTWYQQKPGKA PKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSVQPEDFATYYCQNDYVYPL TFGQGTKLEIKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVL VVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPY APPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRG RDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLY QGLSTATKDTYDALHMQALPPR 19 H2L1 MLLLVTSLLLCELPHPAFLLIPQVQLVQSGAEVKKPGASVKVSCKASGYTFT NYWINWVRQAPGQGLEWIGNIYPSYIYTNYNQEFKDKVTLTVDESTSTAYMEL SSLRSEDTAVYYCTRSPYGYDEYGLDYWGQGTTVTVSSGGGGSGGGGSGGGGS DIQLTQSPSSLSASVGDRVTMTCKSSQSLLNSRNQKNYLTWYQQKPGKAPKLLI YWASTRESGVPSRFSGSGSGTDFTLTISSVQPEDFATYYCQNDYVYPLTFGQ GTKLEIKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVG GVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPR DFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPE MGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLST ATKDTYDALHMQALPPR 20 H3L1 MLLLVTSLLLCELPHPAFLLIPQVQLVQSGAEVKKPGASVKVSCKASGYTFT NYWINWVRQAPGQGLEWIGNIYPSYIYTNYNQEFKDRVTLTRDTSISTAYMEL SRLRSDDTAVYYCTRSPYGYDEYGLDYWGQGTTVTVSSGGGGSGGGGSGG GGSDIQLTQSPSSLSASVGDRVTMTCKSSQSLLNSRNQKNYLTWYQQKPGKA PKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSVQPEDFATYYCQNDYVYPL TFGQGTKLEIKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVL VVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPY APPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRG RDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLY QGLSTATKDTYDALHMQALPPR 21 H3L2 MLLLVTSLLLCELPHPAFLLIPQVQLVQSGAEVKKPGASVKVSCKASGYTFT NYWINWVRQAPGQGLEWIGNIYPSYIYTNYNQEFKDRVTLTRDTSISTAYMEL SRLRSDDTAVYYCTRSPYGYDEYGLDYWGQGTTVTVSSGGGGSGGGGSGG GGSDIQLTQSPSSLSASVGDRVTMTCKSSQSLLNTRNQKNYLTWYQQKPGKA PKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQNDYVYPLT FGQGTKLEIKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLV VVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYA PPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGR DPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQ GLSTATKDTYDALHMQALPPR 22 H4L1 MLLLVTSLLLCELPHPAFLLIPQVQLVQSGAEVKKPGASVKVSCKASGYTFT NYWINWVRQAPGQGLEWIGNIYPSYIYTNYAQKFQGRVTLTRDTSTSTVYMEL SSLRSEDTAVYYCTRSPYGYDEYGLDYWGQGTTVTVSSGGGGSGGGGSGG GGSDIQLTQSPSSLSASVGDRVTMTCKSSQSLLNSRNQKNYLTWYQQKPGKA PKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSVQPEDFATYYCQNDYVYPL TFGQGTKLEIKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVL VVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPY APPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRG RDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLY QGLSTATKDTYDALHMQALPPR 23 H5L1 MLLLVTSLLLCELPHPAFLLIPQVQLVQSGAEVKKPGASVKVSCKASGYTFT NYWINWVRQAPGQGLEWIGNIYPSYIYTNYNQEFKDRVTMTRDTSISTAYMEL SRLRSDDTAVYYCTRSPYGYDEYGLDYWGQGTTVTVSSGGGGSGGGGSGG GGSDIQLTQSPSSLSASVGDRVTMTCKSSQSLLNSRNQKNYLTWYQQKPGKA PKLLIYWASTRESGVPSRFSGSGSGTDFTLTISSVQPEDFATYYCQNDYVYPL TFGQGTKLEIKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVL VVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPY APPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRG RDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLY QGLSTATKDTYDALHMQALPPR 24 H2L2 MLLLVTSLLLCELPHPAFLLIPQVQLVQSGAEVKKPGASVKVSCKASGYTFTNY WINWVRQAPGQGLEWIGNIYPSYIYTNYNQEFKDKVTLTVDESTSTAYMELSS LRSEDTAVYYCTRSPYGYDEYGLDYWGQGTTVTVSSGGGGSGGGGSGGGG SDIQLTQSPSSLSASVGDRVTMTCKSSQSLLNTRNQKNYLTWYQQKPGKAPK LLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQNDYVYPLTF GQGTKLEIKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVV VGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAP PRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEM GGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATK DTYDALHMQALPPR 25 H2L3 MLLLVTSLLLCELPHPAFLLIPQVQLVQSGAEVKKPGASVKVSCKASGYTFT NYWINWVRQAPGQGLEWIGNIYPSYIYTNYNQEFKDKVTLTVDESTSTAYMEL SSLRSEDTAVYYCTRSPYGYDEYGLDYWGQGTTVTVSSGGGGSGGGGSGG GGSDIVLTQSPDSLAVSLGERATMNCKSSQSLLNSRNQKNYLTWYQQKPGQP PKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQNDYVYPL TFGQGTKLEIKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVL VVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPY APPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRG RDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLY QGLSTATKDTYDALHMQALPPR 26 H2L4 MLLLVTSLLLCELPHPAFLLIPQVQLVQSGAEVKKPGASVKVSCKASGYTFT NYWINWVRQAPGQGLEWIGNIYPSYIYTNYNQEFKDKVTLTVDESTSTAYMEL SSLRSEDTAVYYCTRSPYGYDEYGLDYWGQGTTVTVSSGGGGSGGGGSGG GGSEIVLTQSPATLSLSPGERATMSCKSSQSLLNSRNQKNYLTWYQQKPGQA PRLLIYWASTRESGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQNDYVYPLT FGQGTKLEIKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLV VVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYA PPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGR DPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQ GLSTATKDTYDALHMQALPPR 27 H3L3 MLLLVTSLLLCELPHPAFLLIPQVQLVQSGAEVKKPGASVKVSCKASGYTFT NYWINWVRQAPGQGLEWIGNIYPSYIYTNYNQEFKDRVTLTRDTSISTAYMEL SRLRSDDTAVYYCTRSPYGYDEYGLDYWGQGTTVTVSSGGGGSGGGGSGG GGSDIVLTQSPDSLAVSLGERATMNCKSSQSLLNSRNQKNYLTWYQQKPGQP PKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQNDYVY PLTFGQGTKLEIKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP FWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRK HYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLD KRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHD GLYQGLSTATKDTYDALHMQALPPR 28 H1L4 MLLLVTSLLLCELPHPAFLLIPQVQLVQSGAEVKKPGASVKLSCKASGYTFT NYWINWVKQAPGQGLEWIGNIYPSYIYTNYNQEFKDKVTLTVDESTSTAYMEL SSLRSEDTAVYYCTRSPYGYDEYGLDYWGQGTTVTVSSGGGGSGGGGSGG GGSEIVLTQSPATLSLSPGERATMSCKSSQSLLNSRNQKNYLTWYQQKPGQA PRLLIYWASTRESGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQNDYVYPLT FGQGTKLEIKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLV VVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYA PPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGR DPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQ GLSTATKDTYDALHMQALPPR 29 H1L3 MLLLVTSLLLCELPHPAFLLIPQVQLVQSGAEVKKPGASVKLSCKASGYTFT NYWINWVKQAPGQGLEWIGNIYPSYIYTNYNQEFKDKVTLTVDESTSTAYMEL SSLRSEDTAVYYCTRSPYGYDEYGLDYWGQGTTVTVSSGGGGSGGGGSGG GGSDIVLTQSPDSLAVSLGERATMNCKSSQSLLNSRNQKNYLTWYQQKPGQP PKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQNDYVYPL TFGQGTKLEIKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVL VVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPY APPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRG RDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLY QGLSTATKDTYDALHMQALPPR
[0064] An embodiment of the present disclosure also provide a use of the chimeric antigen receptor, including specifically targeting the EpCAM antigen that is highly expressed in relevant tumors.
[0065] An embodiment of the present disclosure also provides a nucleic acid comprising a nucleotide sequence encoding the chimeric antigen receptor.
[0066] An embodiment of the present disclosure also provides a vector comprising the nucleic acid.
[0067] An embodiment of the present disclosure also provides a cell comprising the vector.
Example 1. Design of Humanized Antibody
[0068] The example provides a method for designing the humanized antibody, including the following steps: [0069] S1: a murine antibody VH sequence shown in SEQ ID NO.16 and a murine antibody VL sequence shown in SEQ ID NO.17 were obtained; [0070] S2: the murine antibody sequences were compared with human antibody database to find a human antibody germline with the highest homology; [0071] S3: computer modeling was performed by simulating the sites in the antibody structure that may affect the binding with antigens, key back-mutation sites and combinations, and then screening out the optimal structural solution.
[0072] Where, IGHV1 with the highest homology was selected as the humanized design template for the design of VH, and IGKV1, IGKV3 and IGKV4 were preferentially selected as the humanized design templates for the design of VL. A common pairing method was used for IGHV1-KV1 and IGHV1-KV3.
[0073] Where, 5-10 optimal structural solutions were selected by Discovery Studio and Schrödinger Antibody Modeling in a homology modeling method.
[0074] Specifically, the Loop region was generally modeled by the homology modeling method. If the CDR amino acid sequence alignment result showed that the homology was lower than 50%, a de novo modeling method was used to build the CDR3 structure model. PDB BLAST was used to retrieve 10 antibody crystal structure models with a structural resolution higher than 2.5 angstroms that are closest to the sequence, and the optimal structural model was selected by comparing with the automatic modeling models.
[0075] The sequences of the above-mentioned humanized antibodies were aligned with the human Germline sequences, and the obtained percentage of humanization degree and the number of back-mutation sites are shown in Table 2.
TABLE-US-00002 TABLE 2 Humanization Degree Score of Each Humanized Antibody Humanized Number of Antibody Humanization Back-mutation Name Degree % Sites H1L1 98.5% 10 H2L1 98.8% 8 H3L1 99.1% 6 H3L2 99.3% 5 H4L1 99.15 6 H5L1 99.3% 5 H2L2 99.0% 7 H2L3 99.0% 7 H2L4 99.1% 6 H3L3 99.3% 5 H1L4 98.8% 8 H1L3 98.7% 9
Example 2. Expression and Purification of Humanized Antibody and Detection of EpCAM Specific Binding Ability
[0076] In the example of the present disclosure, the use of the humanized antibody includes using pCDNA3.4 vector and ExpiCHO-s expression system to express the humanized antibody.
[0077] Further, each sequence of SEQ ID NO: 7-11 was cloned into pCDNA3.4 vector to obtain several heavy chain gene expression vectors, and each sequence of SEQ ID NO: 12-15 was cloned into pCDNA3.4 vector to obtain several light chain gene expression vectors, and then the heavy chain gene expression vectors and the light chain gene expression vectors were paired and respectively transfected into the ExpiCHO-s expression system to obtain several recombinant antibodies, which were denoted as H1L1, H2L1, H3L1, H3L2, H4L1, H5L1, H2L2, H2L3, H2L4, H3L3, H1L4, and H1L3. mHmL is the sequence of the EpCAM antibody. The specific cloning and transfection processes are conventional technical means of those skilled in the art and will not be repeated here.
[0078] Further, the present disclosure determines the binding and dissociation curves of empty probe, mHmL, H1L1, H2L1, H3L1, H3L2, H4L1, H5L1, H2L2, H2L3, H2L4, H3L3, H1L4 and H1L3 with Human-EpCAM-Protein-His, respectively. The specific determination method was: a PBST buffer with a concentration of 0.025% formed by dissolving Tween 20 in PBS buffer was used to dilute each recombinant antibody to a concentration of 50 nM, and Human-EpCAM-Protein-His to a concentration gradient from 500 nM to 31.3 nM. Protein A was coupled to a biosensor and activated using the above PBST buffer for 10 min; the loading time was 120 s, the binding time was 300 s, and the dissociation time was 300 s. The results are shown in Table 3 as the affinity constant KD value. As can be seen from Table 3, the affinity constant of the recombinant antibody to the EpCAM antigen was 1.0×10.sup.−8 mol-10.sup.−10 mol.
TABLE-US-00003 TABLE 3 Affinity of Each antibody to EpCAM Recombinant Antibody Name KD (mole) mHmL 1.67E−08 H1L1 1.87E−08 H2L1 1.88E−08 H3L1 2.19E−08 H3L2 6.47E−09 H4L1 8.19E−09 H5L1 1.77E−08 H2L2 4.66E−09 H2L3 1.14E−08 H2L4 1.34E−08 H3L3 1.41E−08 H1L4 1.18E−08 H1L3 9.74E−09
[0079] In the examples of the present disclosure, the binding activities of the recombinant antibodies to human colon cancer cells SW480, human colorectal cancer cells HCT116 and colon cancer RKO cells were also investigated by flow cytometry fluorescence sorting. The results showed that each recombinant antibody did not bind well to RKO cells, but had good binding activity to human colon cancer cell SW460 and human colorectal cancer cell HCT116.
[0080] Specifically, the number of cells in each flow tube was 1×10.sup.5, and the cells were centrifuged and washed with FACS buffer; after resuspension, 100 μL of FACS diluent was added to each flow tube, and the cells were incubated at 4° C. for 60 minutes; the cells were centrifuged and washed with FACS buffer 5 times, then 100 μL of fluorescein FITC and Fcγ receptor fragments were added to each flow tube and the mixture was incubated at 4° C. for 30 minutes; and finally, after being centrifugated and washed with FACS diluent, the cells were resuspended with FACS diluent for testing, and the performance curves of the binding of mHmL, H1L1, H2L1, H3L1, H3L2, H4L1, H5L1, H2L2, H2L3, H2L4, and H3L3 with SW480 as shown in
TABLE-US-00004 TABLE 4 Detection of the Ability of Each Antibody to Bind to Target Cells by Flow Cytometry Recombinant EC50 on EC50 on Antibody SW480 HCT116 Name (μg/ml) (μg/ml) mHmL 0.5809 0.4677 H1L1 0.5667 0.5032 H2L1 0.5989 0.583 H3L1 0.5642 0.4778 H3L2 0.5685 0.4725 H4L1 0.5675 0.4743 H5L1 0.4491 0.4259 H2L2 0.5951 0.537 H2L3 0.6526 0.5837 H2L4 0.6546 0.5839 H3L3 0.5419 0.4924 H1L4 0.6754 0.6021 H1L3 0.6311 0.5634
Example 3. Molecular Design and Lentiviral Packaging of EpCAM-Targeting CAR
[0081] The example of the present disclosure provides a EpCAM-targeting chimeric antigen receptor (abbreviated as EpCAM-CAR), the structure of which is shown in
[0082] Specifically, the sequence of EpCAM-CAR is shown in SEQ ID NO: 19, see SEQ ID NO:19:
[0083] The sequence of GM-CSF signal peptide is MLLLVTSLLLCELPHPAFLLIP;
[0084] The VH sequence of the humanized antibody is:
TABLE-US-00005 QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYWINWVRQAPGQGLEWIGNI YPSYIYTNYNQEFKDKVTLTVDESTSTAYMELSSLRSEDTAVYYCTRSPYG YDEYGLDYWGQGTTVTVSS;
[0085] The sequence of the G4S x3 linker region is:
TABLE-US-00006 GGGGSGGGGSGGGGS;
[0086] The VL sequence of the humanized antibody is:
TABLE-US-00007 DIQLTQSPSSLSASVGDRVTMTCKSSQSLLNTRNQKNYLTWYQQKPGKAP KLLIYWASTRESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQNDYVY PLTFGQGTKLEIK;
[0087] The sequence of CD28 hinge region is:
TABLE-US-00008 IEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP;
[0088] The sequence of CD28 transmembrane region is:
TABLE-US-00009 FWVLVVVGGVLACYSLLVTVAFIIFW;
[0089] The sequence of CD28 costimulatory signaling region is:
TABLE-US-00010 RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS;
[0090] The sequence of CD3ζ costimulatory signaling region is:
TABLE-US-00011 RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR.
[0091] In the example of the present disclosure, the lentiviral vector plasmid encoding EpCAM-CAR was packaged into lentivirus, and the CAR plasmid composed of EpCAM-CAR and the backbone part of the third-generation lentiviral vector comes from Heyuan Biotechnology Co., Ltd.
[0092] The specific packaging method was as follows: [0093] 293T cells were inoculated in a T75 culture flask and cultured until the confluency was about 70%-80%, then the medium was replaced with an equal volume of medium to obtain a sample to be transfected, where the number of the cells in the culture flask was 5×10.sup.6, and the culture volume was 20 ml; [0094] Tube A solution was prepared using 2 ml Opti-MEM and 55 μL Lipo3000; and Tube B solution was prepared using 2 ml Opti-MEM, 46 μL P3000, 18 μg auxiliary plasmid and 6 μg EpCAM-CAR main plasmid; [0095] The Tube A and Tube B solutions were mixed, incubated at room temperature for 15 minutes, and then added to the sample to be transfected, and the mixture was incubated for 48 hours; [0096] After 48 hours of transfection, the supernatant was collected and centrifuged at 500 g for 10 min. The supernatant was filtered and sealed in a centrifuge tube, centrifuged at 10,000 g at 4° C. overnight to obtain a white virus precipitate; and the white virus precipitate was extracted and dissolved in 200 μl AIM-V medium, and then 2 μl was taken to measure the titer according to the subsequent steps, and the rest was stored at −80° C.
[0097] 2 μl of the resuspended virus supernatant was added to 198 ul of 1640 medium to dilute the virus, and then 2 μl, 10 μl and 50 μl of the diluted virus were each added to one of 3 wells in a 24-well plate, and Polybrene helper virus was added at a final concentration of 5 μl/ml for infection for 48 hours to obtain the Lentivirus. After the virus infection, the virus titer was detected with EpCAM-FITC labeled antigens, and the titer was between 2.5E+07-1.2E+08.
Example 4. Construction of EpCAM-Targeting CAR-T Cells
[0098] In the example of the present disclosure, the above lentivirus was used to infect human peripheral blood mononuclear cells (PBMC) to construct CAR-T cells (abbreviated as CAR-T). The specific construction process was as follows:
[0099] Human peripheral blood mononuclear cells (PBMC) were cultured in a medium consisting of AIM-V medium, 5% fetal bovine serum, 100 U/mL penicillin, 0.1 mg/mL streptomycin and 300 IU/mL IL-2; the CD2/CD3/CD28 T cell activation and expansion kit from Miltenyi Company was used to activate T cells, that is, coated magnetic beads were mixed with cells in a ratio of 1:2, and the final cell density was 5×10.sup.6 cells/mL/cm.sup.2. After mixing, the mixture was placed in a 37° C., 5% CO.sub.2 incubator for stimulation for 48 hours; RetroNectin from Takara was diluted to 20 μg/ml and then coated on a culture plate (non-tissue culture treated), with a coating solution of 4 μg/cm.sup.2, placed in a 4° C. refrigerator overnight. After 48h of T cell activation, the cells were centrifuged at 300 g for 5 min to remove the supernatant, the T cells were resuspended in fresh medium, transferred to the plate coated with RetroNectin from Takara, the above lentivirus was added at an MOI=5, the plate was placed in a 37° C., 5% CO.sub.2 incubator for culture; at the same time, T cells without lentivirus transfection were prepared as a reference sample, abbreviated as unT; and 24 hours after the lentivirus was added, the cells were centrifuged at 300 g for 5 min to remove the supernatant, and T cells were suspended with culture medium to obtain CAR-T.
[0100] Further, 48 hours after adding the lentivirus, the samples were taken and the transduction rate was detected by flow cytometry, in which EpCAM protein was used as the primary antibody, and anti-EpCAM-FITC from Biolegend Company was used as the secondary antibody. The comparison chart of the flow analysis results of untransduced T cells (unT) and CAR-T shows that CAR was successfully expressed on CAR-T.
Example 5. Verification of the Ability of EpCAM-Targeting CAR-T Cells to Kill Target Cells In Vitro
[0101] In the example of the present disclosure, tumor cell lines with different EpCAM expression conditions were selected to investigate the in vitro killing performance of CAR-T.
[0102] The example of the present disclosure examined the in vitro killing effect of CAR-T on HCT116-Luc, SW480, KATO-Ill, A549 and MIAPaCA-2.
[0103] Specifically, in a 96-well plate, the prepared CAR-T or reference T cells (unT) were mixed with 1×10.sup.4 tumor cells according to different effector/target ratios, with 3 replicate wells set for each group, and placed in a 37° C., 5% CO.sub.2 incubator for co-cultivation; 24 hours later, for HCT116-luc, SW480, KATO-Ill, A549, and MIAPaCA-2, the release of LDH from the target cells was detected using the LDH kit from Sigma, thereby obtaining the killing efficiency; and the supernatant of the co-culture well corresponding to the highest effector/target ratio was taken, and the amount of IFN-γ was detected by the HTRF kit from cisbio company.
[0104]
[0105]
Example 6. EpCAM-Targeting CAR-T Cells Eliminate Tumor Cells in Mice
[0106] The example of the present disclosure examined the therapeutic effect and safety of CAR-T on subcutaneous tumor formation of HCT116 in M-NSG mice.
[0107] Specifically, M-NSG mice were subcutaneously inoculated with HCT116 to establish the HCT116 tumor model. On day 10 after inoculation, the average tumor volume in mice was approximately 170 mm.sup.3. The mice were randomly divided into 5 groups: G1-G5. Each group was administered by tail vein injection with PBS for G1, unT for G2, and 20E6, 2E6, 0.2E6 CAR-T cells for G3, G4, and G5 groups, respectively. Blood samples were collected from the intraocular canthus of the mice in each group on day 1, 8, 15, 22, 28, 36 and 42 after administration, and the persistence of human CD45+ and human CD3+ cells as well as the proportion of CAR+ cells in the peripheral blood of mice were detected by flow cytometry (FACS). The tumor diameter and the body weight of the animals were measured twice a week, the living conditions of the animals were observed, and the abnormal conditions were recorded. During the whole experiment, the mice were euthanized according to the experimental requirements, and the mice were dissected and collected for slice analysis. The number of mice in each group for statistical analysis was 6.
[0108]
[0109]
[0110] Further, the mice in groups G1, G2 and G3 were taken for histological anatomical detection, and the representative samples of the formed tissue sections are shown in
[0111] Referring to
[0112] Although the embodiments of the present disclosure have been described in detail above, it will be apparent to those skilled in the art that various modifications and changes can be made to these embodiments. However, it should be understood that such modifications and changes are within the scope and spirit of the disclosure as set forth in the appended claims. Furthermore, the disclosure described herein is capable of other embodiments and of being practiced or carried out in various ways.