Feline Severe Acute Respiratory Syndrome Coronavirus 2 Vaccine

20230355741 · 2023-11-09

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention provides new vaccines for felines and ferrets to aid in reducing shedding of severe acute respiratory syndrome coronavirus 2 by infected felines or ferrets. Methods of making and using the vaccines alone or in combinations with other protective agents are also provided.

Claims

1. An immunogenic composition comprising a Venezuelan Equine Encephalitis (VEE) alphavirus RNA replicon particle that encodes a first SARS-CoV-2 protein antigen.

2. The immunogenic composition of claim 1, wherein the first SARS-CoV-2 protein antigen is a spike protein or an immunogenic fragment thereof.

3. The immunogenic composition of claim 2, wherein the VEE alphavirus RNA replicon particle further encodes a second antigen selected from the group consisting of a second SARS-CoV-2 spike protein that originates from a different strain of SARS-CoV-2 than the first SARS-CoV-2 spike protein originates from, a feline calicivirus (FCV) capsid protein, a feline leukemia virus (FeLV) envelope protein, and a rabies virus glycoprotein (G).

4. The immunogenic composition of claim 2, that comprises one or more additional VEE alphavirus RNA replicon particles which encodes a second SARS-CoV-2 spike protein that originates from a different strain of SARS- CoV-2 than the first SARS-CoV-2 spike protein originates from.

5. The immunogenic composition of claim 1, wherein the first SARS-CoV-2 spike protein comprises an amino acid sequence comprising at least 98% identity with the amino acid sequence of SEQ ID NO: 2.

6. The immunogenic composition of claim 1, wherein the first SARS-CoV-2 spike protein is encoded by a nucleotide sequence comprising at least 98% identity with the nucleotide sequence of SEQ ID NO: 4.

7. A vaccine to aid in reducing shedding of SARS-CoV-2 in a feline or a ferret due to an infection of SARS-CoV-2 in the feline or the ferret comprising the immunogenic composition of claim 1, and a pharmaceutically acceptable carrier.

8. The vaccine of claim 7, that further comprises at least one non-SARS-CoV-2 antigen for eliciting protective immunity to a non-SARS-CoV-2 pathogen.

9. The vaccine of claim 8, wherein the non-SARS-CoV-2 pathogen is an inactivated or an attenuated non-SARS-CoV-2 pathogen.

10. The vaccine of claim 7, that further comprises a VEE alphavirus RNA replicon particle comprising a nucleotide sequence encoding at least one antigen or immunogenic fragment thereof that originates from the non-SARS-CoV-2 pathogen.

11. The vaccine of claim 8, wherein the non-SARS-CoV-2 pathogen is selected from the group consisting of feline calicivirus (FCV), feline leukemia virus (FeLV), feline panleukopenia virus (FPLV), feline rhinotracheitis virus (FVR), Chlamydophila felis, rabies virus, canine influenza virus (CIV), canine parvovirus (CPV), canine distemper (CDV), and any combination thereof.

12. The vaccine of claim 11, wherein the non-SARS-CoV-2 pathogen is selected from the group consisting of FCV, FeLV, FPLV, FVR, Chlamydophila felis, rabies virus, canine influenza virus (CIV), and any combination thereof.

13. The vaccine of claim 11, wherein the non-SARS-CoV-2 pathogen is selected from the group consisting of canine parvovirus (CPV), canine distemper (CDV), and the combination thereof.

14. The vaccine of claim 7, that comprises an adjuvant.

15. The vaccine of claim 7, that is a non-adjuvanted vaccine.

16. A method of immunizing a mammal against SARS-CoV-2 comprising administering to the mammal an immunologically effective amount of the vaccine of claim 7; wherein the mammal is selected from the group of a feline and a ferret.

17. The method of claim 16, wherein the mammal is a feline.

18. The method of claim 17, wherein the feline is a domestic cat.

19. The method of claim 16, wherein the mammal is a ferret.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0026] FIGS. 1A-1C show the immunogenicity of SARS-CoV-2 Spike antigen in guinea pigs. FIG. 1A depicts the SARS-CoV-2 Surrogate VN test assay results of 1,000-fold diluted serum taken at different days post vaccination (d.p.v.) from animals vaccinated with VEEV Replicon Particles (black circle) or Plasmid DNA (open circles) vaccines. FIG. 1B depicts the spike ectodomain ELISA using serum taken at different days post vaccination (d.p.v.) from animals vaccinated with VEEV Replicon Particles (black circle) or Plasmid DNA (open circles) vaccines. FIG. 1C depicts the lymphocyte stimulation test (LST) from blood collected on day 70/71. Purified SARS-CoV-2 S1 antigen was used to stimulate isolated lymphocytes and proliferation was measured 96 hours after stimulation.

DETAILED DESCRIPTION OF THE INVENTION

[0027] The present invention provides immunogenic compositions and vaccines that could aid in the prevention of, or even prevent, disease in cats and ferrets caused by SARS-CoV-2. These vaccines may not only be beneficial to the vaccinated cats and ferrets, but also may prevent them from becoming a reservoir for the virus, where further unknown and potentially deleterious mutations could arise. Moreover, such vaccines could lead to the reduction or even elimination of the viral shed of SARS-CoV-2 in cats and ferrets. Such viral shed could result in the transmission of SARS-CoV-2 to other animals, including humans.

[0028] Accordingly, the present invention provides immunogenic compositions and/or vaccines (including multivalent vaccines) that encode a protein antigen from SARS-CoV-2 (e.g., SARS-CoV-2 spike protein). In one aspect of the present invention, the vaccines comprise alphavirus RNA replicon particles (RPs) that comprise the capsid protein and glycoproteins of Venezuelan Equine Encephalitis Virus (VEE) and encode a protein antigen or immunogenic fragment thereof from SARS-CoV-2. In even more specific embodiments, the vaccines comprise alphavirus RNA replicon particles (RPs) that comprise the capsid protein and glycoproteins of the avirulent TC-83 strain of VEE and encode a protein antigen or immunogenic fragment thereof from SARS-CoV-2. Immunogenic compositions and/or vaccines (including multivalent vaccines) comprising the alphavirus RNA replicon particles encoding a protein antigen or immunogenic fragment thereof from SARS-CoV-2 can be administered in the presence or alternatively in the absence of an adjuvant. In particular embodiments, the antigen is the SARS-CoV-2 spike protein. In certain embodiments, the immunogenic compositions and/or vaccines are for felines. In other embodiments, the immunogenic compositions and/or vaccines are for ferrets. Methods of making and using the vaccines and/or immunogenic compositions alone or in combinations with other protective agents are also provided.

[0029] In order to more fully appreciate the invention, the following definitions are provided.

[0030] The use of singular terms for convenience in description is in no way intended to be so limiting. Thus, for example, reference to a composition comprising “a polypeptide” includes reference to one or more of such polypeptides. In addition, reference to an “alphavirus RNA replicon particle” includes reference to a plurality of such alphavirus RNA replicon particles, unless otherwise indicated.

[0031] As used herein the term “approximately” is used interchangeably with the term “about” and signifies that a value is within fifty percent of the indicated value i.e., a composition containing “approximately” 1×10.sup.8 alphavirus RNA replicon particles per milliliter contains from 5×10.sup.7 to 1.5×10.sup.8 alphavirus RNA replicon particles per milliliter.

[0032] As used herein, the term “canine” includes all domestic dogs, Canis lupus familiaris or Canis familiaris, unless otherwise indicated.

[0033] As used herein, the term “feline” refers to any member of the Felidae family. Members of this family include wild, zoo, and domestic members, such as any member of the subfamilies Felinae, e.g., cats, lions, tigers, pumas, jaguars, leopards, snow leopards, panthers, North American mountain lions, cheetahs, lynx, bobcats, caracals or any cross breeds thereof. Cats also include domestic cats (Felis catus) including pure-bred and/or mongrel companion cats, show cats, laboratory cats, cloned cats, and wild or feral cats.

[0034] As used herein, a “ferret” is a mammal that is one of the mammals that belong to the mustelid family.

[0035] As used herein, the term “replicon” refers to a modified RNA viral genome that lacks one or more elements (e.g., coding sequences for structural proteins) that if they were present, would enable the successful propagation of the parental virus in cell cultures or animal hosts. In suitable cellular contexts, the replicon will amplify itself and may produce one or more sub-genomic RNA species.

[0036] As used herein, the term “alphavirus RNA replicon particle”, abbreviated “RP”, is an alphavirus-derived RNA replicon packaged in structural proteins, e.g., the capsid and glycoproteins, which also are derived from an alphavirus, e.g., as described by Pushko et al., [Virology 239(2):389-401 (1997)]. An RP cannot propagate in cell cultures or animal hosts (without a helper plasmid or analogous component), because the replicon does not encode the alphavirus structural components (e.g., capsid and glycoproteins).

[0037] The terms “originate from”, “originates from” and “originating from” are used interchangeably with respect to a given protein antigen and the pathogen or strain of that pathogen that naturally encodes it, and as used herein signify that the unmodified and/or truncated amino acid sequence of that given protein antigen or immunogenic fragment thereof is encoded by that pathogen or strain of that pathogen. The coding sequence, within a nucleic acid construct of the present invention for a protein antigen originating from a pathogen may have been genetically manipulated so as to result in a modification and/or truncation of the amino acid sequence of the expressed protein antigen relative to the corresponding sequence of that protein antigen in the pathogen or strain of pathogen (including naturally attenuated strains) it originates from.

[0038] The spike protein of a Coronavirus is a large glycoprotein protruding from the surface of the virus that determines the tropism of the virus by binding to a specific extracellular domain of a host receptor. Human angiotensin-converting enzyme 2 (ACE2) serves as the host receptor for both the SARS-CoV-2 and the SARS-CoV spike proteins. The most variable part of the coronavirus genome is the receptor binding domain (RBD) of coronavirus spike proteins. Notably however, five of the six critical amino acid residues of the RBD differ between the SARS-CoV-2 spike protein and the SARS-CoV spike protein. The SARS-CoV-2 spike protein further differs from a SARS-CoV spike protein by the SARS-CoV-2 spike protein comprising a polybasic cleavage site (RRAR) at the junction of the spike protein's two subunits, Si and S2, whereas the SARS-CoV spike protein does not [see, Andersen et al., Nature Medicine 26:450-455 (2020)]. This polybasic cleavage site allows effective cleavage by proteases, which plays a role in the infectivity of SARS-CoV-2. Although the polybasic cleavage site is not unique to the SARS-CoV-2 spike protein, as the spike proteins of some of other human beta coronaviruses comprise such structures, like SARS-CoV, the spike protein of the most closely related bat coronaviruses also have not been found to comprise this polybasic cleavage site.

[0039] The term “non-SARS-CoV-2”, is used to modify terms such as pathogen, and/or antigen or immunogenic fragment thereof to signify that the respective pathogen, and/or antigen is neither a SARS-CoV-2 nor a SARS-CoV-2 protein antigen or immunogenic fragment thereof. A non-SARS-CoV-2 antigen does not originate from a SARS-CoV-2.

[0040] As used herein, the terms “modified live” and “attenuated” are used interchangeably with respect to a given live virus and/or a live micro-organism.

[0041] As used herein, the terms “protecting”, and/or “providing protection to”, and/or “eliciting protective immunity to”, and/or “aids in the prevention of a disease”, and/or “aids in the protection”, and/or “reduces viral load”, and/or “reduces viremia” do not require complete protection from any indication of infection. For example, “aids in the protection” can mean that the protection is sufficient such that, after challenge, symptoms of the underlying infection are at least reduced, and/or aid in the reduction of viral shedding, and/or that one or more of the underlying cellular, physiological, or biochemical causes or mechanisms causing the symptoms are reduced and/or eliminated. It is understood that “reduced,” as used in this context, means relative to the state of the infection, including the molecular state of the infection, not just the physiological state of the infection.

[0042] As used herein, a “vaccine” is a composition that is suitable for application to an animal, e.g., a feline (including, in certain embodiments, humans, while in other embodiments being specifically not for humans) comprising one or more antigens typically combined with a pharmaceutically acceptable carrier such as a liquid containing water, which upon administration to the animal induces an immune response strong enough to minimally aid in the protection from a disease arising from an infection with a wild-type virus and/or wild-type micro-organism, i.e., strong enough for aiding in the prevention of the disease, and/or preventing, ameliorating or curing the disease.

[0043] As used herein, a multivalent vaccine is a vaccine that comprises two or more different antigens. In a particular embodiment of this type, the multivalent vaccine stimulates the immune system of the recipient against two or more different pathogens.

[0044] The terms “adjuvant” and “immune stimulant” are used interchangeably herein and are defined as one or more substances that cause stimulation of the immune system. In this context, an adjuvant is used to enhance an immune response to one or more vaccine antigens/isolates. Accordingly, “adjuvants” are agents that nonspecifically increase an immune response to a particular antigen, thus reducing the quantity of antigen necessary in any given vaccine, and/or the frequency of injection necessary in order to generate an adequate immune response to the antigen of interest. In this context, an adjuvant is used to enhance an immune response to one or more vaccine antigens/isolates.

[0045] As used herein, a “nonadjuvanted vaccine” is a vaccine or a multivalent vaccine that does not contain an adjuvant.

[0046] As used herein, the term “pharmaceutically acceptable” is used adjectivally to mean that the modified noun is appropriate for use in a pharmaceutical product. When it is used, for example, to describe an excipient in a pharmaceutical vaccine, it characterizes the excipient as being compatible with the other ingredients of the composition and not disadvantageously deleterious to the intended recipient animal, e.g., a feline.

[0047] The term “carrier” refers to a diluent, adjuvant, excipient, or vehicle with which the alphavirus RNA replicon particles are administered. Pharmaceutical acceptable carriers can be sterile liquids, such as water and/or oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water or aqueous solution saline solutions and aqueous sugar, e.g., dextrose and/or glycerol solutions can be employed as carriers, particularly for injectable solutions. In the case of nonadjuvanted vaccines, the carrier cannot be an adjuvant.

[0048] “Parenteral administration” includes subcutaneous injections, submucosal injections, intravenous injections, intramuscular injections, intradermal injections, oral, intranasal, and infusion.

[0049] As used herein the term “immunogenic fragment” in regard to a particular protein (e.g., a protein antigen) is a fragment of that protein that is immunogenic, i.e., capable of specifically interacting with an antigen recognition molecule of the immune system, such as an immunoglobulin (antibody) or T cell antigen receptor. Preferably, an immunogenic fragment of the present invention is immunodominant for antibody and/or T cell receptor recognition. In particular embodiments, an immunogenic fragment with respect to a given protein antigen is a fragment of that protein that retains at least 25% of the antigenicity of the full-length protein SARS-CoV-2 spike protein. In preferred embodiments an immunogenic fragment retains at least 50% of the antigenicity of the full-length protein SARS-CoV-2 spike protein. In more preferred embodiments, an immunogenic fragment retains at least 75% of the antigenicity of the full-length protein SARS-CoV-2 spike protein. Immunogenic fragments can be 100 amino acids or more that comprise at least one conserved region of the full-length protein SARS-CoV-2 spike protein or at the other extreme, be large fragments that are missing as little as a single amino acid from the full-length protein. In particular embodiments, the immunogenic fragment comprises 125 to 1000 amino acid residues of the full-length protein SARS-CoV-2 spike protein. In other embodiments, the immunogenic fragment comprises 250 to 750 amino acid residues of the full-length protein SARS-CoV-2 spike protein.

[0050] As used herein one amino acid sequence is 100% “identical” or has 100% “identity” to a second amino acid sequence when the amino acid residues of both sequences are identical. Accordingly, an amino acid sequence is 50% “identical” to a second amino acid sequence when 50% of the amino acid residues of the two amino acid sequences are identical. The sequence comparison is performed over a contiguous block of amino acid residues comprised by a given protein, e.g., a protein, or a portion of the polypeptide being compared. In a particular embodiment, selected deletions or insertions that could otherwise alter the correspondence between the two amino acid sequences are taken into account.

[0051] As used herein, nucleotide and amino acid sequence percent identity can be determined using C, MacVector (MacVector, Inc. Cary, NC 27519), Vector NTI (Informax, Inc. MD), Oxford Molecular Group PLC (1996) and the Clustal W algorithm with the alignment default parameters, and default parameters for identity. These commercially available programs can also be used to determine sequence similarity using the same or analogous default parameters. Alternatively, an Advanced Blast search under the default filter conditions can be used, e.g., using the GCG (Genetics Computer Group, Program Manual for the GCG Package, Version 7, Madison, Wisconsin) pileup program using the default parameters.

[0052] For the purposes of this invention, an “inactivated” virus or microorganism is a virus or micro-organism which is capable of eliciting an immune response in an animal, but is not capable of infecting the animal. For example, an inactivated SARS-CoV-2 may be inactivated by an agent selected from the group consisting of binary ethyleneimine, formalin, beta-propiolactone, thimerosal, or heat.

[0053] The alphavirus RNA replicon particles of the present invention may be lyophilized and rehydrated with a sterile water diluent. On the other hand, when the alphavirus RNA replicon particles are stored separately, but intended to be mixed with other vaccine components prior to administration, the alphavirus RNA replicon particles can be stored in the stabilizing solution of those components, e.g., a high sucrose solution.

[0054] In one aspect of the present invention, the vaccines are non-adjuvanted, i.e., do not comprise an adjuvant. On the other hand, in certain embodiments the vaccines do contain an adjuvant. Examples of adjuvants that may be used in the vaccines of the present invention include CARBOPOL® [e.g., polymers of acrylic acid cross-linked with polyalkenyl ethers or divinyl glycol], Alhydrogel+QuilA, aluminium hydroxide, Alhydrogel, Emulsigen+EMA31+Neocryl XK62, Carbomer, Carbomer 974P, Adjuphos, and Alhydrogel+QS21 (saponin) Carbigen.

[0055] A vaccine of the present invention can be readily administered by any standard route including intravenous, intramuscular, subcutaneous, oral, intranasal, intradermal, and/or intraperitoneal vaccination. The artisan will appreciate that the vaccine composition is preferably formulated appropriately for each type of recipient animal and route of administration. Thus, the present invention also provides methods of immunizing a mammal against SARS-CoV-2 and/or other mammalian pathogens. One such method comprises injecting a mammal with an immunologically effective amount of a vaccine of the present invention, so that the mammal produces appropriate antibodies to the SARS-CoV-2 spike protein.

Multivalent Vaccines

[0056] The present invention also provides multivalent vaccines. Any antigen or combination of such antigens useful in a mammalian vaccine can be added to a propagation defective alphavirus RNA replicon particle (RP) that encodes an antigen of the SARS-CoV-2 [e.g., the SARS-CoV-2 spike protein] in the vaccine. Accordingly, such multivalent vaccines are included in the present invention. Examples of pathogens that one or more of such protein antigens can originate for the feline or ferret immunogenic compositions and vaccines include feline calicivirus, feline rhinotracheitis Virus (FVR), feline leukemia virus (FeLV), feline panleukopenia Virus (FPL), feline immunodeficiency (Hy), rabies virus, canine influenza virus, canine parvovirus, canine distemper virus, and feline chlamydia.

[0057] In addition, an alphavirus RNA replicon particle(RP) that encodes one or more antigens of the SARS-CoV-2 [e.g., the SARS-CoV-2 spike protein or immunogenic fragment thereof] can be added together with one or more other live, attenuated virus isolates, e.g., a live attenuated FCV virus and/or a live, attenuated feline leukemia virus, and/or a live, attenuated feline infectious peritonitis virus and/or a live, attenuated feline immunodeficiency virus, and/or a live, attenuated rabies virus, and/or a live, attenuated feline influenza virus and/or a live, attenuated canine influenza virus. In addition, a live, attenuated Chlamydophila felis, and/or a live, attenuated Bordetella bronchiseptica and/or a live, attenuated Bartonella spp. (e.g., B. henselae) can also be included in such multivalent vaccines.

[0058] Furthermore, an alphavirus RNA replicon particle (RP) that encodes one or more protein antigens of SARS-CoV-2 (e.g., the SARS-CoV-2 spike protein or an antigenic fragment thereof) can be added together with one or more other inactivated virus isolates such as an inactivated FCV strain, and/or an inactivated feline herpesvirus and/or an inactivated feline parvovirus and/or an inactivated feline leukemia virus, and/or an inactivated feline infectious peritonitis virus and/or an inactivated feline immunodeficiency virus, and/or an inactivated rabies virus, and/or an inactivated feline influenza virus, and/or an inactivated canine influenza virus. In addition, bacterins (or subfractions of the bacterins, e.g., the pilus subfraction) of Chlamydophila felis, and/or Bordetella bronchiseptica and/or Bartonella spp. (e.g., B. henselae) can also be included in such multivalent vaccines.

SEQUENCE TABLE

[0059]

TABLE-US-00001 SEQ ID NO: Description Type 1 Wild-type SARS-CoV-2 Spike Protein DNA 2 Wild-type SARS-CoV-2 Spike Protein Amino Acid 3 Wild-type SARS-CoV-2 Spike Protein DNA Codon-optimized 4 Wild-type SARS-CoV-2 Spike Protein RNA Codon-optimized

SEQUENCES

[0060] Severe acute respiratory syndrome coronavirus 2 isolate 2019-nCoV/U.S.A.-WI1/2020, complete genome; GenBank:

TABLE-US-00002 MT039887.1 MT039887_Wild-type_Spike_nucleotide: SEQ ID NO: 1 atgtttgtttttcttgttttattgccactagtctctagtcagtgtgttaatcttacaaccagaactcaat taccccctgcatacactaattctttcacacgtggtgtttattaccctgacaaagttttcagatcctcagt tttacattcaactcaggacttgttcttacctttcttttccaatgttacttggttccatgctatacatgtc tctgggaccaatggtactaagaggtttgataaccctgtcctaccatttaatgatggtgtttattttgctt ccactgagaagtctaacataataagaggctggatttttggtactactttagattcgaagacccagtccct acttattgttaataacgctactaatgttgttattaaagtctgtgaatttcaattttgtaatgatccattt ttgggtgtttattaccacaaaaacaacaaaagttggatggaaagtgagttcagagtttattctagtgcga ataattgcacttttgaatatgtctctcagccttttcttatggaccttgaaggaaaacagggtaatttcaa aaatcttagggaatttgtgtttaagaatattgatggttattttaaaatatattctaagcacacgcctatt aatttagtgcgtgatctccctcagggtttttcggctttagaaccattggtagatttgccaataggtatta acatcactaggtttcaaactttacttgctttacatagaagttatttgactcctggtgattcttcttcagg ttggacagctggtgctgcagcttattatgtgggttatcttcaacctaggacttttctattaaaatataat gaaaatggaaccattacagatgctgtagactgtgcacttgaccctctctcagaaacaaagtgtacgttga aatccttcactgtagaaaaaggaatctatcaaacttctaactttagagtccaaccaacagaatctattgt tagatttcctaatattacaaacttgtgcccttttggtgaagtttttaacgccaccagatttgcatctgtt tatgcttggaacaggaagagaatcagcaactgtgttgctgattattctgtcctatataattccgcatcat tttccacttttaagtgttatggagtgtctcctactaaattaaatgatctctgctttactaatgtctatgc agattcatttgtaattagaggtgatgaagtcagacaaatcgctccagggcaaactggaaagattgctgat tataattataaattaccagatgattttacaggctgcgttatagcttggaattctaacaatcttgattcta aggttggtggtaattataattacctgtatagattgtttaggaagtctaatctcaaaccttttgagagaga tatttcaactgaaatctatcaggccggtagcacaccttgtaatggtgttgaaggttttaattgttacttt cctttacaatcatatggtttccaacccactaatggtgttggttaccaaccatacagagtagtagtacttt cttttgaacttctacatgcaccagcaactgtttgtggacctaaaaagtctactaatttggttaaaaacaa atgtgtcaatttcaacttcaatggtttaacaggcacaggtgttcttactgagtctaacaaaaagtttctg cctttccaacaatttggcagagacattgctgacactactgatgctgtccgtgatccacagacacttgaga ttcttgacattacaccatgttcttttggtggtgtcagtgttataacaccaggaacaaatacttctaacca ggttgctgttctttatcaggatgttaactgcacagaagtccctgttgctattcatgcagatcaacttact cctacttggcgtgtttattctacaggttctaatgtttttcaaacacgtgcaggctgtttaataggggctg aacatgtcaacaactcatatgagtgtgacatacccattggtgcaggtatatgcgctagttatcagactca gactaattctcctcggcgggcacgtagtgtagctagtcaatccatcattgcctacactatgtcacttggt gcagaaaattcagttgcttactctaataactctattgccatacccacaaattttactattagtgttacca cagaaattctaccagtgtctatgaccaagacatcagtagattgtacaatgtacatttgtggtgattcaac tgaatgcagcaatcttttgttgcaatatggcagtttttgtacacaattaaaccgtgctttaactggaata gctgttgaacaagacaaaaacacccaagaagtttttgcacaagtcaaacaaatttacaaaacaccaccaa ttaaagattttggtggttttaatttttcacaaatattaccagatccatcaaaaccaagcaagaggtcatt tattgaagatctacttttcaacaaagtgacacttgcagatgctggcttcatcaaacaatatggtgattgc cttggtgatattgctgctagagacctcatttgtgcacaaaagtttaacggccttactgttttgccacctt tgctcacagatgaaatgattgctcaatacacttctgcactgttagcgggtacaatcacttctggttggac ctttggtgcaggtgctgcattacaaataccatttgctatgcaaatggcttataggtttaatggtattgga gttacacagaatgttctctatgagaaccaaaaattgattgccaaccaatttaatagtgctattggcaaaa ttcaagactcactttcttccacagcaagtgcacttggaaaacttcaagatgtggtcaaccaaaatgcaca agctttaaacacgcttgttaaacaacttagctccaattttggtgcaatttcaagtgttttaaatgatatc ctttcacgtcttgacaaagttgaggctgaagtgcaaattgataggttgatcacaggcagacttcaaagtt tgcagacatatgtgactcaacaattaattagagctgcagaaatcagagcttctgctaatcttgctgctac taaaatgtcagagtgtgtacttggacaatcaaaaagagttgatttttgtggaaagggctatcatcttatg tccttccctcagtcagcacctcatggtgtagtcttcttgcatgtgacttatgtccctgcacaagaaaaga acttcacaactgctcctgccatttgtcatgatggaaaagcacactttcctcgtgaaggtgtctttgtttc aaatggcacacactggtttgtaacacaaaggaatttttatgaaccacaaatcattactacagacaacaca tttgtgtctggtaactgtgatgttgtaataggaattgtcaacaacacagtttatgatcctttgcaacctg aattagactcattcaaggaggagttagataaatattttaagaatcatacatcaccagatgttgatttagg tgacatctctggcattaatgcttcagttgtaaacattcaaaaagaaattgaccgcctcaatgaggttgcc aagaatttaaatgaatctctcatcgatctccaagaacttggaaagtatgagcagtatataaaatggccat ggtacatttggctaggttttatagctggcttgattgccatagtaatggtgacaattatgctttgctgtat gaccagttgctgtagttgtctcaagggctgttgttcttgtggatcctgctgcaaatttgatgaagacgac tctgagccagtgctcaaaggagtcaaattacattacacataa MT039887_Wild-type_Spike_translated; SEQ ID NO: 2 MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFS NVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIV NNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLE LLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK CTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISN CVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIAD YNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPC NGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVN FNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITP GTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSY ECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTI SVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQE VFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDC LGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAM QMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALN TLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRA SANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPA ICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDP LQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDL QELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDD SEPVLKGVKLHYT SARS-CoV-2_Spike_codon-optimized; SEQ ID NO: 3: atgtttgtctttcttgtgcttcttcctttggtcagttcacagtgtgtcaatcttactaccaggacacaac ttccaccggcatacactaattctttcacacggggagtctattaccctgacaaagtgttcagaagttctgt gctgcattcaacacaagatcttttcctcccgttctttagtaatgtgacctggtttcatgcaattcatgtg tcaggaaccaatggtacaaagcggttcgataaccctgtgttgccgttcaatgacggagtctactttgctt caactgagaaaagtaacatcattcggggatggattttcggaactacactcgattctaagacccagagtct tttgattgtgaataacgcaacaaatgtcgtcatcaaagtctgtgagtttcaattttgtaatgatccattt cttggagtgtattaccacaaaaacaataagtcatggatggagtcggagtttcgggtctattcttccgcta ataattgcacttttgagtacgtctcacagccatttcttatggaccttgagggaaagcagggaaatttcaa aaatcttagggagtttgtgtttaagaacattgacggatacttcaaaatctattcaaagcacactccgatc aacctggtcagggatcttccgcaaggtttttcagcacttgaacctcttgtcgatctgcctattgggatca acatcacaagattccaaactttgcttgctttgcatcggtcctatctcactccgggagattctagttcagg gtggacagctggagcagctgcttactatgtgggttatcttcaacctaggacttttctgctgaaatacaat gagaatggaaccatcactgacgctgtcgattgtgcactcgaccctctgtcagaaaccaaatgtactctca aatctttcactgtggagaagggaatctaccaaacttcaaacttcagagtgcagcctacagagtctattgt gcggtttccgaatatcactaacctttgcccgtttggagaagtgttcaatgccactagatttgcttcagtc tatgcttggaaccggaaacggattagcaactgtgtcgctgactattcagtgctttacaattcagcatctt tctcaacctttaagtgctacggagtgtctccgacaaaactcaatgacctttgtttcactaatgtctatgc tgactcgttcgtcattcggggagatgaagtccggcagattgccccagggcaaacaggcaaaatcgctgac tataactacaaactgcctgacgactttaccggatgcgtcattgcatggaatagtaacaatctcgattcta aagtcggtggaaactacaattacctctatagactttttcggaagtcaaatctcaaaccttttgaacggga catctctactgagatctaccaagctggtagtacaccatgtaatggagtggagggattcaattgctacttc cctttgcagtcctacggtttccaacccacaaatggagtcggttaccagccttatagggtcgtcgtcttgt cgtttgagttgcttcatgcacctgctacagtctgtggtccaaagaaatctactaatcttgtcaaaaacaa atgtgtgaatttcaacttcaatggacttactggtactggtgtccttactgaatctaacaaaaagtttctg ccttttcaacaatttggtagagatattgctgatactactgatgctgtccgggacccacagactcttgaaa ttctcgacattactccatgttcgtttggaggtgtctcagtcattacacctggtactaatactagcaacca ggtcgctgtcttgtatcaggatgtgaactgcacagaagtgccagtggctatccatgcagatcaattgact ccaacttggcgggtctattcgactggatcaaatgtgtttcaaactagggccggatgtttgattggagctg agcatgtcaataactcttatgagtgtgacattccgattggagcaggaatctgcgcttcttatcaaactca aacaaattcaccaagaagagcacggagcgtcgcttcacaatctatcatcgcatacacaatgtcacttgga gctgagaatagtgtcgcttactctaacaattcaattgccattcctactaattttacaatctcagtcacca ccgaaatccttccagtgtcaatgaccaagacttcagtcgattgtacaatgtacatctgtggtgattctac cgagtgtagtaatcttctccttcaatatgggtcattttgtacacagctcaatagagctttgactggaatc gcagtggagcaagacaaaaacactcaagaggtctttgcacaagtcaagcaaatctacaaaacaccaccga tcaaagattttggaggattcaatttctcacaaattcttccggacccgtcaaaacctagcaagagatcttt catcgaagatttgcttttcaataaggtgacacttgctgatgctggtttcatcaaacaatatggcgattgt cttggtgatatcgcagctcgggacctgatctgtgcacaaaagtttaacggactgactgtcctccccccac ttctgactgatgagatgattgctcaatacacaagtgctctgcttgctggaactatcacatcgggatggac ctttggagctggagctgcacttcaaattccttttgctatgcaaatggcttatcggtttaacggtattggt gtcacacagaatgtcctttatgaaaatcaaaagcttatcgccaaccaattcaatagtgctattgggaaga ttcaagacagtctttcatctactgcttctgctctcggtaaacttcaagatgtcgtcaatcaaaatgctca agcattgaacactcttgtcaagcagcttagtagtaactttggagctatttcttctgtgcttaatgacatc ctttcacggcttgacaaggtcgaagcagaggtgcaaattgataggcttatcactgggagacttcaaagtc ttcagacctatgtcactcaacaacttattcgggctgctgaaatccgggcatcagccaatttggcagccac taagatgtcagagtgtgtcttgggacaatctaaaagagtcgatttctgtggtaaggggtatcatcttatg tcattcccgcagtcagctccgcatggagtcgtctttttgcatgtgacttatgtcccagcacaagaaaaga acttcactactgcaccagctatttgtcatgatggaaaagctcactttccacgggaaggagtgtttgtgtc taatggaactcattggttcgtcacacagaggaatttctatgaaccgcagattatcactacagacaacact tttgtcagtggtaactgcgatgtcgtcattgggattgtcaacaacaccgtgtacgatccgcttcaaccgg aactcgattctttcaaggaggaacttgacaaatatttcaagaatcatacatcacctgatgtggatcttgg agacatctcgggaatcaatgcatcggtcgtcaatatccaaaaggaaattgaccggttgaatgaggtggcc aagaatttgaatgagtcacttattgatctccaagagttgggaaagtatgaacagtatatcaaatggccat ggtacatttggcttggattcatcgctggcctgattgccatcgtcatggtgaccattatgctctgttgtat gacctcatgctgttcttgtctcaagggatgttgttcatgtgggtcgtgctgcaaatttgatgaggacgac tcagaaccagtgctcaaaggagtcaaactccattacacttga SARS-CoV-2_Spike_codon-optimized_RNA auguuugucuuucuugugcuucuuccuuuggucaguucacagugugucaaucuuacuaccaggacacaac uuccaccggcauacacuaauucuuucacacggggagucuauuacccugacaaaguguucagaaguucugu gcugcauucaacacaagaucuuuuccucccguucuuuaguaaugugaccugguuucaugcaauucaugug ucaggaaccaaugguacaaagcgguucgauaacccuguguugccguucaaugacggagucuacuuugcuu caacugagaaaaguaacaucauucggggauggauuuucggaacuacacucgauucuaagacccagagucu uuugauugugaauaacgcaacaaaugucgucaucaaagucugugaguuucaauuuuguaaugauccauuu cuuggaguguauuaccacaaaaacaauaagucauggauggagucggaguuucgggucuauucuuccgcua auaauugcacuuuugaguacgucucacagccauuucuuauggaccuugagggaaagcagggaaauuucaa aaaucuuagggaguuuguguuuaagaacauugacggauacuucaaaaucuauucaaagcacacuccgauc aaccuggucagggaucuuccgcaagguuuuucagcacuugaaccucuugucgaucugccuauugggauca acaucacaagauuccaaacuuugcuugcuuugcaucgguccuaucucacuccgggagauucuaguucagg guggacagcuggagcagcugcuuacuauguggguuaucuucaaccuaggacuuuucugcugaaauacaau gagaauggaaccaucacugacgcugucgauugugcacucgacccucugucagaaaccaaauguacucuca aaucuuucacuguggagaagggaaucuaccaaacuucaaacuucagagugcagccuacagagucuauugu gcgguuuccgaauaucacuaaccuuugcccguuuggagaaguguucaaugccacuagauuugcuucaguc uaugcuuggaaccggaaacggauuagcaacugugucgcugacuauucagugcuuuacaauucagcaucuu ucucaaccuuuaagugcuacggagugucuccgacaaaacucaaugaccuuuguuucacuaaugucuaugc ugacucguucgucauucggggagaugaaguccggcagauugccccagggcaaacaggcaaaaucgcugac uauaacuacaaacugccugacgacuuuaccggaugcgucauugcauggaauaguaacaaucucgauucua aagucgguggaaacuacaauuaccucuauagacuuuuucggaagucaaaucucaaaccuuuugaacggga caucucuacugagaucuaccaagcugguaguacaccauguaauggaguggagggauucaauugcuacuuc ccuuugcaguccuacgguuuccaacccacaaauggagucgguuaccagccuuauagggucgucgucuugu cguuugaguugcuucaugcaccugcuacagucugugguccaaagaaaucuacuaaucuugucaaaaacaa augugugaauuucaacuucaauggacuuacugguacugguguccuuacugaaucuaacaaaaaguuucug ccuuuucaacaauuugguagagauauugcugauacuacugaugcuguccgggacccacagacucuugaaa uucucgacauuacuccauguucguuuggaggugucucagucauuacaccugguacuaauacuagcaacca ggucgcugucuuguaucaggaugugaacugcacagaagugccaguggcuauccaugcagaucaauugacu ccaacuuggcgggucuauucgacuggaucaaauguguuucaaacuagggccggauguuugauuggagcug agcaugucaauaacucuuaugagugugacauuccgauuggagcaggaaucugcgcuucuuaucaaacuca aacaaauucaccaagaagagcacggagcgucgcuucacaaucuaucaucgcauacacaaugucacuugga gcugagaauagugucgcuuacucuaacaauucaauugccauuccuacuaauuuuacaaucucagucacca ccgaaauccuuccagugucaaugaccaagacuucagucgauuguacaauguacaucuguggugauucuac cgaguguaguaaucuucuccuucaauaugggucauuuuguacacagcucaauagagcuuugacuggaauc gcaguggagcaagacaaaaacacucaagaggucuuugcacaagucaagcaaaucuacaaaacaccaccga ucaaagauuuuggaggauucaauuucucacaaauucuuccggacccgucaaaaccuagcaagagaucuuu caucgaagauuugcuuuucaauaaggugacacuugcugaugcugguuucaucaaacaauauggcgauugu cuuggugauaucgcagcucgggaccugaucugugcacaaaaguuuaacggacugacuguccuccccccac uucugacugaugagaugauugcucaauacacaagugcucugcuugcuggaacuaucacaucgggauggac cuuuggagcuggagcugcacuucaaauuccuuuugcuaugcaaauggcuuaucgguuuaacgguauuggu gucacacagaauguccuuuaugaaaaucaaaagcuuaucgccaaccaauucaauagugcuauugggaaga uucaagacagucuuucaucuacugcuucugcucucgguaaacuucaagaugucgucaaucaaaaugcuca agcauugaacacucuugucaagcagcuuaguaguaacuuuggagcuauuucuucugugcuuaaugacauc cuuucacggcuugacaaggucgaagcagaggugcaaauugauaggcuuaucacugggagacuucaaaguc uucagaccuaugucacucaacaacuuauucgggcugcugaaauccgggcaucagccaauuuggcagccac uaagaugucagagugugucuugggacaaucuaaaagagucgauuucugugguaagggguaucaucuuaug ucauucccgcagucagcuccgcauggagucgucuuuuugcaugugacuuaugucccagcacaagaaaaga acuucacuacugcaccagcuauuugucaugauggaaaagcucacuuuccacgggaaggaguguuuguguc uaauggaacucauugguucgucacacagaggaauuucuaugaaccgcagauuaucacuacagacaacacu uuugucagugguaacugcgaugucgucauugggauugucaacaacaccguguacgauccgcuucaaccgg aacucgauucuuucaaggaggaacuugacaaauauuucaagaaucauacaucaccugauguggaucuugg agacaucucgggaaucaaugcaucggucgucaauauccaaaaggaaauugaccgguugaaugagguggcc aagaauuugaaugagucacuuauugaucuccaagaguugggaaaguaugaacaguauaucaaauggccau gguacauuuggcuuggauucaucgcuggccugauugccaucgucauggugaccauuaugcucuguuguau gaccucaugcuguucuugucucaagggauguuguucaugugggucgugcugcaaauuugaugaggacgac ucagaaccagugcucaaaggagucaaacuccauuacacuuga

EXAMPLES

Example 1

Incorporation of the Coding Sequences for SARS-CoV-2 Spike Protein into the VEE Alphavirus RNA Replicon Particles

Introduction

[0061] RNA viruses can be used as vector-vehicles for introducing vaccine antigens that have been genetically engineered into their genomes. However, their use to date has been limited primarily to incorporating viral antigens into the RNA virus and then introducing the virus into a recipient host. The result is the induction of protective antibodies against the incorporated viral antigens. Alphavirus RNA replicon particles have been used to encode pathogenic antigens. Such alphavirus replicon platforms have been developed from several different alphaviruses, including Venezuelan equine encephalitis virus (VEE) [Pushko et al., Virology 239:389-401 (1997)], Sindbis (SIN) [Bredenbeek et al., Journal of Virology 67:6439-6446 (1993) the contents of which are hereby incorporated herein in their entireties], and Semliki Forest virus (SFV) [Liljestrom and Garoff, Biotechnology (NY) 9:1356-1361 (1991), the contents of which are hereby incorporated herein in their entireties]. Moreover, alphavirus RNA replicon particles are the basis for several USDA-licensed vaccines for swine and poultry. These include: Porcine Epidemic Diarrhea Vaccine, RNA Particle (Product Code 19U5.P1), Swine Influenza Vaccine, RNA (Product Code 19A5.D0), Avian Influenza Vaccine, RNA (Product Code 1905.D0), and Prescription Product, RNA Particle (Product Code 9PP0.00).

Alphavirus RNA Replicon Construction

[0062] A vaccine is prepared comprising an alphavirus RNA replicon particle encoding codon optimized SARS-CoV-2 Spike Protein.

Generation of SARS-CoV-2 Spike Protein Gene Replicon Particles (RPs)

[0063] The VEE replicon vector for use to express the SARS-CoV-2 Spike gene is constructed as previously described [see, U.S. Pat. No. 9,441,247 B2; the contents of which are hereby incorporated herein by reference], with the following modifications. The TC-83-derived replicon vector “pVEK” [disclosed and described in U.S. Pat. No. 9,441,247 B2] is digested with restriction enzymes AscI and PacI to create the vector “pVHV”. The spike protein gene sequence from SARS-CoV-2, strain 2019-nCoV/U.S.A.-WI1/2020 (GenBank accession MT039887), was codon-optimized and is synthesized with flanking AscI and PacI sites. The synthetic gene and pVHV vector are each digested with AscI and PacI enzymes and ligated to create vector “pVHV-SARS-CoV-2-Spike”. Plasmid batches are sequenced to confirm the correct vector and insert identities.

[0064] Production of TC-83 RNA replicon particles (RP) is conducted according to methods previously described [U.S. Pat. No. 9,441,247 B2 and U.S. Pat. No. 8,460,913 B2; the contents of which are hereby incorporated herein by reference]. Briefly, pVHV-SARS-CoV-2-Spike replicon vector DNA and helper DNA plasmids are linearized with NotI restriction enzyme prior to in vitro transcription using MegaScript T7 RNA polymerase and cap analog. Importantly, the helper RNAs that are used in the production lack the VEE subgenomic promoter sequence, as previously described [Kamrud et al., J Gen Virol. 91(Pt 7):1723-1727 (2010)]. Purified RNA for the replicon and helper components are combined and mixed with a suspension of Vero cells, electroporated in 4 mm cuvettes, and returned to serum-free culture media. Following overnight incubation, alphavirus RNA replicon particles are purified from the cells and media by passing the suspension through a depth filter, washing with phosphate buffered saline containing 5% sucrose (w/v), and finally eluting the retained RP with 400 mM NaCl+5% sucrose (w/v) buffer. Eluted RP are passed through a 0.22 micron membrane filter, and dispensed into aliquots for storage. Titer of functional RP is determined by immunofluorescence assay on infected Vero cell monolayers. The resulting propagation-defective alphavirus RNA replicon particle encoding codon optimized SARS-CoV-2 spike protein can then be placed into a non-adjuvanted or adjuvanted vaccine formulation and administered to a feline or a ferret.

Example 2

Humoral and Cellular Immune Responses Induced by SARS-COV-2 Spike Antigens Using VEEV RP Vaccines in Guinea Pigs

Materials and Methods

Animals and husbandry

[0065] Female SPF guinea pigs (Dunkin Hartley) were obtained from Envigo at a minimum weight of 350 grams, randomly allocated to experimental groups, and individually marked using color coded tags. Baseline clinical observations were documented throughout the study period.

[0066] Baseline clinical observations including body temperatures were documented throughout the study period.

Generation of SARS-CoV-2 Spike Gene RP Vaccines

[0067] The Spike_wt gene sequence from SARS-CoV-2, strain 2019-nCoV/U.S.A.-WI1/2020 (GenBank accession MT039887) was codon-optimized and inserted in the pVHV vector.

[0068] Production of TC-83 RNA RPs was conducted by the methods described above.

Guinea Pig Study

[0069] SPF guinea pigs with a minimum weight of 350 grams were randomly divided over the non-vaccinated control group, and RP-Spike-wt vaccinated group (n=6 per group). One week after placement, animals remained either non-vaccinated or received a prime vaccination of 1×10E7 RP dose intramuscularly (0.1 ml in each leg muscle). Three weeks after prime vaccination the animals received a booster vaccination of 1×10E7 RP dose intramuscular (0.1 ml in each leg muscle). Six weeks after the booster the vaccination animals received a second booster vaccination and 7 days later animals were sacrificed. Terminal blood was taken for lymphocyte stimulation tests (LST). At the day of the booster vaccination, and at 2-week intervals until 6 weeks after boost vaccination, clotted blood was taken using cardiac-puncture and the serum was used to determine systemic antibody titers.

Surrogate Virus Neutralization Assay Guinea Pig SERA

[0070] The SARS-CoV-2 Surrogate Virus Neutralization Test Kit from GenScript was used according to the manufacturer's instructions. Briefly, sera were diluted in sample dilution buffer, mixed 1:1 with HRP-RBD, and incubated for 30 minutes at 37° C. Next, samples were put in a 96-well plate containing ACE2 receptor coated on the surface and incubated 15 minutes at 37° C. Unbound HRP-RBD was washed away and remaining horse radish peroxide (HRP) was visualized using 3,3′,5,5′-tetramethylbenzidine (TMB) substrate and measured at OD450.

ELISA for Estimating Spike Ectodomain Antibody Titers in Sera

[0071] Purified SARS-CoV-2 Spike ectodomain were diluted in Dulbecco's phosphate-buffered saline (DPBS) [without Ca and Mg, Lonza, 17-512F] and coated onto 96-well plates (MaxiSorp-ThermoFisher, or High binding-Greiner Bio-one) using 10 nM (10 pmols/mL), and incubated overnight at 4° C. The next morning the plates were washed three times with an ELISA plate washer (ImmunoWash 1575, BioRad) using 0.25 mL wash solution/well (DPBS, 0.05% Tween 20), then blocked with 250 μL blocking solution (5% milk-Protifar, Nutricia, 0.1% Tween 20 in DPBS) for 2 hours at RT (room temperature). Afterwards the blocking solution was discarded. Then four-fold serial dilutions of the sera (prepared in the blocking solution, in duplicates or triplicates) were added to the corresponding wells and incubated for 1 hour at Room Temperature (RT). Each plate contained positive control (guinea pig sera diluted to obtain an OD450 of ˜2) and negative control wells. The plates were washed again 3 times before being incubated with the HRP-containing antibody—Goat anti-Guinea pig (IgG-HRPO, Jackson Lab 106-035-003, 1:8000) for 1 hour at RT. The last wash steps were performed, followed by an incubation for 10 minutes at RT with 100 μL/well Super Sensitive TMB (Surmodics, TMBS-1000-01). Reactions were stopped by adding 100 μL/well of 12.5% H.sub.2SO.sub.4 (Millipore, 1.00716.1000). Absorbance at 450 nm was measured at 30 minutes with an ELx808 BioTek plate reader.

T-Cell Stimulation Test (LST)

[0072] Blood was collected and lymphocytes were isolated using Sepmate tube (Stemcell) containing Histopaque 1083 according to manufacturer's instructions. Briefly, K3-EDTA blood was diluted 1:2 in RPMI-1640 medium and pelleted for 10 minutes at 1200×g. The cells in the top layer of the tubes were collected, placed in a clean tube containing RPMI-1640 and pelleted for 7 minutes at 400×g. The cells were washed once with RPMI-1640 medium and pelleted for 7 minutes at 400×g. Cell concentrations were counted and 1×10E7 cells were stained with carboxyfluorescein succinimidyl ester (CFSE) for 20 minutes at 37° C. The cells were washed once with RPMI-1640 and 5×10E5 cells from each animal were stimulated with either medium, ConA (10 μg/ml), or purified SARS-CoV-2 S1 antigen (5, 2.5, 1.25, 0.62, 0.31, or 0.15 μg/ml) in duplicate. Three days after stimulation, cell proliferation was measured using the FACS-Verse.

Results

[0073] Immunogenicity of the Spike-wt antigen was assessed in a guinea pig model in which the VEEV RP vector vaccines were administered intramuscularly. After prime vaccination, all animals showed seroconversion as assessed by a commercially available SARS-CoV-2 surrogate VN test that measures antibody titers interfering with Spike-receptor binding. After boost vaccination of the guinea pigs with either the VEEV RP or plasmid DNA vector vaccines producing the SARS-CoV-2 Spike antigen, peak serum neutralizing antibody titers were detected using a SARS-CoV-2 surrogate VN assay at 34 days post vaccination (FIG. 1A). At 49 and 63 days post vaccination neutralizing serum antibody titers decreased slightly. In general, the VEEV RP vaccine induced superior serum antibody titers compared to the plasmid DNA vaccine. Similar results were observed when total antibody titers were determined using a SARS-CoV-2 Spike Ectodomain ELISA (FIG. 1B). In this assay, peak serum antibody titers were detected at 49 days post vaccination and again the VEEV RP vaccine induced superior serum antibody titers compared to the plasmid DNA vaccine.

[0074] The VEEV RP vector platform is known for its efficient induction of both humoral as well as cellular responses. To assess the level of cellular responses induced by the RP vaccine candidates, a third immunization was performed and seven days later lymphocytes were isolated for a lymphocyte stimulation test (LST). All isolated lymphocytes stimulated with ConA resulted in >80% proliferation titers. The VEEV Replicon Particle vaccine producing the SARS-CoV-2 Spike antigen was able to induce a strong cellular immune response in guinea pigs (FIG. 1C). The antibody responses induced by the VEEV RP vaccine induced superior titers compared to the plasmid DNA vaccine, while both vaccine platforms were able to induce comparable cellular immune responses.

[0075] The present invention is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description. Such modifications are intended to fall within the scope of the appended claims.

[0076] It is further to be understood that all base sizes or amino acid sizes, and all molecular weight or molecular mass values, given for nucleic acids or polypeptides are approximate, and are provided for description.