IMMUNOGLOBULIN-BINDING PROTEIN VARIANTS WITH INCREASED ALKALI-TOLERANCE AND USE THEREOF
20230356187 · 2023-11-09
Inventors
- Su Lim CHOI (Yongin-si, KR)
- So Young PARK (Seongnam-si, KR)
- Sol A PARK (Seongnam-si, KR)
- Yeo Won SIM (Suwon-si, KR)
Cpc classification
B01D15/3809
PERFORMING OPERATIONS; TRANSPORTING
C07K1/22
CHEMISTRY; METALLURGY
C07K17/02
CHEMISTRY; METALLURGY
B01J20/3274
PERFORMING OPERATIONS; TRANSPORTING
International classification
B01J20/32
PERFORMING OPERATIONS; TRANSPORTING
Abstract
Provided are immunoglobulin-binding protein variants with increased alkali tolerance, and uses thereof, and more particularly to immunoglobulin-binding protein variants with increased alkali tolerance relative to the wild type due to mutations in amino acids at specific positions in the B3 domain of the immunoglobulin-binding proteins
Claims
1. A polypeptide comprising an amino acid mutation of SEQ ID NO:4, wherein the amino acid mutation is substitution of at least one amino acid selected from the group consisting of: beginning from a proline (Pro, P) which is the second amino acid in the amino acid sequence of SEQ ID NO: 4, the 28.sup.th amino acid (glutamic acid (Glu, E)), the 43.sup.rd amino acid (lysine (Lys, K)), the 13.sup.th amino acid (tyrosine (Tyr, Y)), the 51.sup.st amino acid (aspartic acid (Asp, D)), and the 60.sup.th amino acid (asparagine (Asn, N) of the amino acid sequence of SEQ ID NO: 4, with an amino acid different from the original amino acid.
2. The polypeptide of claim 1, wherein the polypeptide comprises at least one substitution selected from the group consisting of the following: the 28.sup.th amino acid (E) is replaced with glycine (Gly, G), alanine (Ala, A), leucine (Leu, L), proline (Pro, P), or tryptophan (Trp, W); the 43.sup.rd amino acid (K) is replaced with proline (Pro, P) or glutamic acid (Glu, E); the 13.sup.th amino acid (Y) is replaced with phenylalanine (Phe, F); the 51.sup.st amino acid (D) is replaced with valine (Val, V) or threonine (Thr, T); and the 60.sup.th amino acid (N) is replaced with phenylalanine (Phe, F).
3. The polypeptide of claim 1, wherein the 28.sup.th amino acid (E) is replaced with glycine (Gly, G), alanine (Ala, A), leucine (Leu, L), proline (Pro, P), or tryptophan (Trp, W).
4. The polypeptide of claim 3, further comprising at least one substitution selected from the group consisting of the following: the 43.sup.rd amino acid (K) is replaced with proline (Pro, P) or glutamic acid (Glu, E); the 13.sup.th amino acid (Y) is replaced with phenylalanine (Phe, F); the 51.sup.st amino acid (D) is replaced with valine (Val, V) or threonine (Thr, T); and the 60.sup.th amino acid (N) is replaced with phenylalanine (Phe, F).
5. The polypeptide of claim 1, comprising the following amino acid mutation in the amino acid sequence of SEQ ID NO: 4: E28A, E28G, E28L, E28P, E28W, E28G+Y13F, E28G+K43P, E28G+D51V, E28G+N60E, E28L, E28P, E28W, E28G+K43E, E28G+D51T, E28G+N60F, or Y13F+E28G+K43P.
6. The polypeptide of claim 1, represented by the amino acid sequence of SEQ ID NO: 7, 8, 9, 10, 11, 12, 23, 24, 25, 26, 27, 28, or 47.
7. The polypeptide of claim 1, further comprising at least one selected from the group consisting of the A, B1, B2, B4, C, W, and M domain of protein L.
8. The polypeptide of claim 1, wherein the polypeptide has increased alkali tolerance relative to the polypeptide of SEQ ID NO: 4.
9. A multimer, comprising at least two repeating units of the polypeptide of claim 1.
10. The multimer of claim 9, represented by the amino acid sequence of SEQ ID NO: 49.
11. The multimer of claim 9, further comprising at least one selected from the group consisting of the A, B 1, B2, B4, C, W, and M domain of protein L.
12. A protein L variant, comprising the polypeptide of claim 1, or a multimer comprising at least two repeating units of the polypeptide, as a B3 domain
13. A nucleic acid molecule encoding the polypeptide of claim 1, a multimer comprising at least two repeating units of the polypeptide, or a protein L variant comprising the polypeptide or the multimer as a B3 domain.
14. A recombinant vector comprising the nucleic acid molecule of claim 13.
15. A recombinant cell comprising the nucleic acid molecule of claim 13 or a recombinant vector comprising the nucleic acid molecule.
16. A matrix for chromatography, wherein the polypeptide of claim 1, a multimer comprising at least two repeating units of the polypeptide, or a protein L variant comprising the polypeptide or the multimer as a B3 domain, is coupled to a solid support.
17. A composition for binding an immunoglobulin, comprising at least one selected from the group consisting of (1) the polypeptide of claim 1, (2) a multimer comprising two or more repeating units of the polypeptide, (3) a protein L variant comprising the polypeptide or the multimer as a B3 domain, (4) a nucleic acid molecule encoding the polypeptides, the multimer, or the protein L variant, (5) a recombinant vector comprising the nucleic acid molecule, (6) a recombinant cell comprising the nucleic acid molecule or a recombinant vector; and (7) a matrix for chromatography, wherein the polypeptide, the multimer, or the protein L variant is coupled to a solid support.
18. A composition for immunoglobulin isolation or purification, comprising (a) the polypeptide of claim 1, (b) a multimer comprising two or more repeating units of the polypeptide, (c) a protein L variant comprising the polypeptide or the multimer as a B3 domain; or (d) a matrix for chromatography, wherein a plurality of ligands comprising the polypeptides, multimer, or protein L variant are coupled to a solid support.
19. A method of isolating or purifying an immunoglobulin, comprising, adsorbing an immunoglobulin by contacting a sample comprising the immunoglobulin with at least one selected from the group consisting of the following: (a) the polypeptide of claim 1, (b) a multimer comprising two or more repeating units of the polypeptide, (c) a protein L variant comprising the polypeptide or the multimer as a B3 domain; and (d) a matrix for chromatography, wherein a plurality of ligands comprising the polypeptides, the multimer, or the protein L variant are coupled to a solid support.
20. A method of isolating or purifying at least one target compound from a liquid comprising adsorbing the target compound by contacting a sample comprising the target compound with at least one selected from the group consisting of the following: (a) the polypeptide of claim 1, (B) a multimer comprising two or more repeating units of the polypeptide, (c) a protein L variant comprising the polypeptide or the multimer as a B3 domain; and (d) a matrix for chromatography, wherein a plurality of ligands comprising the polypeptides, the multimer, or the protein L variant are coupled to a solid support.
Description
BRIEF DESCRIPTION OF THE DRAWING
[0154]
[0155]
[0156]
[0157]
[0158]
[0159]
EXAMPLES
[0160] In the following, the invention is further described by way of example, which is by way of illustration only and is not intended to limit the scope of the invention. It will be apparent to those skilled in the art that the embodiments described below may be modified without departing from the essential spirit of the invention.
Example 1
Preparation of Recombinant Immunoglobulin G Fragment (IgG(f)) Protein for Improvement
<1-1> Synthesis of the IgG(f) Gene of Immunoglobulin G
[0161] The nucleic acid sequence encoding a polypeptide (IgG(f); Herceptin scFv; SEQ ID NO: 2) of the human IgG1-based scFv region (IgG(f) gene; SEQ ID NO: 1) was found by Blast at the NCBI site (GenBank Accession No. AWW43726) and synthesized by CosmoGeneTech (Daejeon, Korea).
<1-2> Preparation of the pET-IgG(f) Plasmid
[0162] The pET-IgG(f) plasmid was prepared by inserting the IgG(f) gene obtained in Example <1-1> into the Ndel and Xhol restriction enzyme recognition sites of the pET29a(+) vector (Stratagene, USA). The details are as follows:
[0163] The IgG(f) gene DNA product (SEQ ID NO: 1) obtained through synthesis in Example <1-1> was cleaved with restriction enzymes Ndel and Xhol, purified with a purification kit (QIAEX Gel Extraction Kit; Qiagen, Germany), and used as insert DNA. In addition, the pET29a(+) vector DNA was cut with restriction enzymes Ndel and Xhol and dephosphorylated with antartic phosphatase (Genomics, Korea), and the resulting DNA fragment was used as a vector DNA. The insert DNA and vector DNA were ligated using T4 DNA ligase (Genomics, Korea) for 16 hours at 16° C., and the ligation solution was used to transform E. coli BL21(DE3) strain (Genomics) by electroporation. Transformants were selected by plating the above strain on LB agar medium containing kanamycin antibiotic at a concentration of 50 μg/mL and incubating it at 37° C. for 16-18 hours. By isolating the plasmid from these transformants and determining the sequence of the insert DNA, a pET-IgG(f) plasmid containing the IgG(f) gene with the nucleotide sequence of SEQ ID NO: 1 was prepared. The pET-IgG(f) plasmid expresses a wild-type IgG(f) protein (Herceptin scFv) represented by SEQ ID NO: 2.
<1-3> Purification of IgG(f) Protein Using Nickel-Affinity Resin
[0164] To seed the E. coli BL21(DE3) transformants containing the IgG(f) gene, 5 mL of LB liquid medium (BD (Becton, Dickinson and Company)) containing kanamycin antibiotic was dispensed into a 50 mL conical tube, inoculated with the selected transformants, and shaken for 16 hours at 37° C. and 200 rpm. A 500-mL triangular flask containing 200 mL of LB liquid medium was inoculated with 1% (v/v) of the above seed culture and agitated at 37° C., 200 rpm. After shaking to approximately OD600=0.6, IPTG (isopropyl-β-D-thio-galactopyranoside) was added to a final concentration of 1 mM and further agitated at 37° C., 200 rpm for 18 hours. The flask culture was centrifuged (4° C., 8,000 rpm, 20 min) to recover the bacteria, which were then suspended in 10 mL of PBS buffer (pH 7.4) (Intron Biotechnology, Korea). This suspension was disrupted with an ultrasonic grinder at 4° C. for 15 minutes and centrifuged (4° C., 20,000 rpm, 20 minutes) to obtain only the supernatant. 1 mL of WorkBeads™ 40 Ni-NTA (bioworks, Sweden), a nickel-affinity resin, was loaded onto the column, followed by 5 mL of binding buffer (20 mM NaH2PO4, 300 mM NaCl, 10 mM Imidazole pH 8.0), and 2.5 mL of the above supernatant was mixed with 2.5 mL of binding buffer and loaded onto the column. 5 mL of wash buffer (20 mM NaH2PO4, 300 mM NaCl, 30 mM Imidazole pH 8.0) was added, followed by 2.5 mL of elution buffer (20 mM NaH.sub.2PO.sub.4, 300 mM NaCl, 300 mM
[0165] Imidazole pH 8.0), and the passage was collected in a 15 mL conical tube. The recovered purified protein was desalted using a HiPrep 26/10 desalting column (cytiva, Sweden).
Example 2
Create a Template
<2-1> B3 Domain Gene Synthesis
[0166] The B3 domain gene (SEQ ID NO: 3) of Peptostreptococcus magnus-derived protein L was synthesized by including a 6xHis tag by CosmoGeneTech (Daejeon, Korea).
<2-2> Preparation of the pBC-wB3 Plasmid
[0167] The wild-type B3 domain (wB3) gene (SEQ ID NO: 3) of protein L obtained in Example 2-1 above was inserted into the Ndel and Notl restriction enzyme recognition sites of the pBC KS(+) vector (Stratagene, USA) to prepare the pBC-wB3 plasmid. In detail, the procedure was as follows:
[0168] The wB3 gene DNA product (SEQ ID NO: 3) obtained by synthesis in Example <2-1> was cleaved with restriction enzymes Ndel and Notl, purified with a purification kit (QIAEX Gel Extraction Kit; Qiagen, Germany), and used as insert DNA. In addition, the pBC KS(+) vector DNA was cleaved with restriction enzymes Ndel and Notl, and the DNA fragment dephosphorylated with antisense phosphatase (Genomics, Korea) was used as a vector DNA. The insert DNA and vector DNA were ligated using T4 DNA ligase (Genomics, Korea) for 16 hours at 16° C., and the ligation solution was used to transform E. coli DH5α strain (Genomics) by electroporation. The above strains were plated on LB agar medium (BD (Becton, Dickinson and Company)) containing chloramphenicol antibiotic at a concentration of 20 μg/mL, and transformants were screened by subculturing at 37° C. for 16-18 hours. The plasmid was isolated from the selected transformants and the sequence of the insertion DNA was determined, resulting in the preparation of a pBC-wB3 plasmid containing the wild-type B3 domain gene with the nucleotide sequence of SEQ ID NO: 3. The pBC-wB3 plasmid expresses the wild-type protein L B3 domain protein represented by SEQ ID NO: 4.
Example 3
Improvement of wB3 Using Error Prone Polymerase Chain Reaction (PCR)
<3-1> Preparation of wB3 Variant Library by Error Prone Polymerase Chain Reaction (PCR)
[0169] To artificially induce random mutations in the nucleic acid sequence of the wB3 gene (SEQ ID NO: 3) synthesized in Example 2, an error prone polymerase chain reaction (PCR) was carried out to construct a mutant library.
[0170] Specific mutant libraries were prepared as follows: Error-induced polymerase chain reaction was carried out using the Diversity®PCR Random
[0171] Mutagenesis kit (Clontec, USA) to generate 1-2 mutations per 1000 bp. The composition of the PCR reaction mixture was 1 ng of pBC-wB3 plasmid (Examples 2-2) as a template DNA, 10 pmol each of EP-F primer (SEQ ID NO: 5) and T7 primer (SEQ ID NO: 6), 40 μM dGTP, Diversity dNTP mix and TITANIUM™ Taq DNA polymerase, adjusted to a final volume of 100 μL. PCR was performed under the following conditions using a C1000 Touch thermal cycler (BIO-RAD, USA): The reaction mixture was pre-denatured at 94° C. for 30 s, followed by denaturation at 94° C. for 30 s, annealing at 55° C. for 30 s, and polymerization at 68° C. for 3 mins, and the reaction was repeated 16 times, followed by post-polymerization at 68° C. for 1 min.
[0172] Each wB3 mutant gene PCR product obtained by the error-induced polymerase chain reaction performed under the above conditions was digested with restriction enzymes Ndel and Notl, purified by QIAEX Gel Extraction Kit (Qiagen, Germany), and used as insert DNA. In addition, the pBC-KS(+) plasmid was digested with restriction enzymes Ndel and Notl, and a 3.4-kb DNA fragment dephosphorylated with antartic phosphatase (Genomics, Korea) was used as a vector DNA. The insert DNA and vector
[0173] DNA were ligated using T4 DNA ligase (Genomics, Korea) at 16° C. for 16 hours, and the ligation solution was used to transform E. coli DH5α strain by electroporation. Random mutant libraries were prepared by plating the above strains on LB agar medium containing chloramphenicol antibiotic at a concentration of 20 μg/mL and culturing them at 37° C. for 16-18 hours.
<3-2>Selecting Variants with Increased Alkali Tolerance
[0174] To culture the E. coli DH5α transformants including the wB3 mutant gene induced by the above method, 500 μL of LB liquid medium containing chloramphenicol antibiotic was dispensed into 96-deep well plates (Bionia, Korea), the transformants were inoculated, and the plates were shaken for 18 hours at 37° C. and 280 rpm.
[0175] The specific protein purification procedure was as follows:
[0176] Protein purification was performed by using a Promega HisLink™ 96 Protein Purification System (Promega, USA). 10X FastBreak™ Cell Lysis Reagent and DNase I solution were mixed proportionally to prepare FastBreak™ Reagent/DNase I solution. 600 μL of culture medium and 60 μL of FastBreak™ Reagent/DNase I solution was added to each well, followed by adding 65 μL of HisLink™ Resin. The mixture was mixed for 30 minutes at 100 rpm on a shaker to allow the culture and resin to react. The reaction solution and resin were transferred to a filtration plate and filtered by applying vacuum for 10 s using a Vac-Man® 96 Vacuum Manifold (Promega, USA). Next, 250 μL of binding/wash buffer (100 mM HEPES, 10 mM imidazole, pH 7.5) was added to each well and washed under vacuum for 10 s. The same method was repeated three times. 200 μL of elution buffer (100 mM HEPES, 500 mM imidazole, pH 7.5) was added to the plate and reacted for 10 minutes, followed by 1 minute of vacuum to recover the purified protein in a new 96-well plate. The purified wB3 variants were coupled to N-hydroxysuccinimide (NHS)-Activated sepharose 4 Fast flow (Cytiva, Sweden) on the 96-well plate and transferred to a filteration plate. 150 μL (71.5 μg/mL) of the IgG(f) protein purified in Examples <1-3> was added to the filteration plate and reacted for 1 hr at 100 rpm at room temperature using a shaker. The unbound IgG(f) protein was removed by vacuum, and then 150 μL of PBS buffer (pH 7.4) was added to each well, washed by vacuum, and washed three times in the same manner. 150 μL of elution buffer (0.1 M Glycine-HCl, pH 2.5) was added and reacted for 30 seconds at room temperature, followed by 1 minute of vacuum to recover the protein in a new 96-well plate. The filtration plate that had been treated with elution buffer was washed by dispensing 150 μL of PBS buffer into each well and applying vacuum, and was washed three times in the same manner.
[0177] New 96-well plates with recovered proteins were transferred and the amount of IgG(f) protein was measured at OD280 using a Synergy HTX multi-mode reader (BioTek, USA). After the initial binding assay, to confirm the alkaline tolerance of the wB3 variants, 200 μL of 0.3M NaOH (pH 13.48) was added to the wB3 variant resin in the filtration plate and reacted at 100 rpm for 1 h at room temperature. The plate was then washed three times with 200 μL of PBS buffer, and the IgG(f) protein was bound and recovered in the same manner as the initial binding assay to measure the amount of antibody. The residual IgG(f) binding activity of the wB3 variants was analyzed by repeating the same method as above and comparing the amount of IgG(f) protein remaining.
[0178] By comparing the absorbance of the above wB3 variants before and after 0.3 M NaOH treatment, two wB3 variants with increased alkali tolerance were selected.
[0179] The two selected variants were confirmed by nucleic acid sequencing of their genes, which revealed that wild-type wB3 (SEQ ID NO: 4) was mutated into variant EP1 (SEQ ID NO: 7) with E28A mutation (refers to a variant in which the 28th (i.e., 29th in SEQ ID NO: 4) amino acid residue, E, is substituted with A, starting from the amino acid residue following the methionine (M) encoded by the initiation codon (i.e., P, the second amino acid residue in SEQ ID NO: 4) upon recombinant synthesis; in the present specification, amino acid variant designations are interpreted in the same manner) and variant EP2 (SEQ ID NO: 8) with E28G mutation. The absorbance of the two selected variants EP1 (E28A) and EP2 (E28G) compared to the absorbance of the wild type (wB3) is shown in
<3-3>Construction of EP2 Variant Library by Error Prone Polymerase Chain Reaction (PCR)
[0180] Among the wB3 variants selected in Example <3-2>, the gene coding for EP2 (E28G) (SEQ ID NO: 8), a variant with higher alkali tolerance, was further improved. An error prone polymerase chain reaction (PCR) was performed once more by inserting EP2 into the pBC KS(+) vector as a new template.
[0181] Proteins with increased alkali tolerance than EP2 were selected by error-induced polymerase chain reaction using the same method as in Examples <3-1>and <3-2>. As a result, four additional variants were selected, and nucleic acid sequencing of their genes confirmed that variant EP2 mutated into variant BEP1 (SEQ ID NO: 9) with an E28G/Y13F mutation, variant BEP2 (SEQ ID NO: 10) with an E28G/K43P mutation, variant BEP3 (SEQ ID NO: 11) with an E28G/D51V mutation, and variant BEP4 (SEQ ID NO: 12) with an E28G/N60E mutation. The absorbance of the four identified variants BEP1(E28G/Y13F), BEP2(E28G/K43P), BEP3(E28G/D51V), and BEP4(E28G/N60E) compared to the absorbance of variant EP2(E28G) is shown in
Example 4
Improvement of wB3 using Site-Saturation Mutagenesis
<4-1>Construction of wB3 Variant Library by Site-Directed Mutagenesis
[0182] To confer additional alkali tolerance to the EP2 (E28G) gene modified from the wB3 gene, a site-saturation mutagenesis library was constructed for the five amino acid residues (Y13, E28, K43, D51, N60) mutated in the selected variants in Example 3. The specific methods were as follows:
[0183] To prepare the library with the modified 28th amino acid (corresponding to the 29th amino acid of SEQ ID NO: 4 comprising a methionine (M) by initiation codon at the N-terminus; in the present specification, amino acid position indications are interpreted in the same manner), the wB3 gene (SEQ ID NO: 3) inserted into the pBC KS(+) vector was used as a template, and the reaction mixture was prepared with 28-F primer (SEQ ID NO: 13), 28-R primer (SEQ ID NO: 14), Pfu-X DNA polymerase, 10X Pfu-X Reaction buffer, and 10 mM dNTPs, adjusting the final volume to 50 μL. The reaction mixture was reacted under the following reaction conditions: pre-denaturation at 95° C. for 2 min, followed by denaturation at 95° C. for 20 s, annealing at 56° C. for 40 s and polymerization at 72° C. for 1 min, the reaction was repeated 25 times followed by post-polymerization at 72° C. for 5 min. The PCR products obtained under the above conditions were treated with the restriction enzyme Dpnl for 18 hours, purified with a PCR purification kit (Cosmozintec, Korea), and immediately transformed into E. coli DH5α strain by electroporation. The transformed strain was plated on LB agar medium containing chloramphenicol antibiotic at a concentration of 20 μg/mL and subcultured at 37° C. for 16-18 hours to prepare a positional saturation mutant library.
[0184] Then, using the same method as described above, using the BEP1 (SEQ ID NO: 9) coding gene, the BEP2 (SEQ ID NO: 10) coding gene, the BEP3 (SEQ ID NO: 11) coding gene, or the BEP4 (SEQ ID NO: 12) coding gene inserted in the pBC KS(+) vector as a template, library were constructed using 13-F primer (SEQ ID NO: 15) and 13-R primer (SEQ ID NO: 16), 43-F primer (SEQ ID NO: 17) and 43-R primer (SEQ ID NO: 18), 51-F primer (SEQ ID NO: 19) and 51-R primer (SEQ ID NO: 20), 60-F primer (SEQ ID NO: 21) and 60-R primer (SEQ ID NO: 22), respectively.
<4-2>Selecting Variants with Increased Alkali Tolerance
[0185] Using the same method as described in Example <3-2>, the library produced in Example <4-1>was studied. Six additional variants EPS1(E28L) (SEQ ID NO: 23), EPS2(E28P) (SEQ ID NO: 24), EPS3(E28W) (SEQ ID NO: 25), EPS4(E28G/K43E) (SEQ ID NO: 26), EPS5(E28G/D51T) (SEQ ID NO: 27), and EPS6(E28G/N60F) (SEQ ID NO: 28) were further selected as variants with equal or increased alkali tolerance compared to variant EP2(E28G). The absorbance of these six additional selected variants was compared to the absorbance of variant EP2 (E28G), and the results are shown in
Example 5
Improvement of wB3 Using DNA Shuffling
[0186] Additional alkali tolerance to the variants with increased alkali tolerance identified in Examples 3 and 4 were conferred through DNA shuffling. For this purpose, DNA shuffling library was constructed for the five selected amino acid variants (Y13F, E28G/W, K43E/P, D51T/V, and N60E/F). The specific procedure was as follows (see
[0187] First, to prepare a library in which the 13th amino acid was mutated, the EP2 (E28G) (SEQ ID NO: 8) coding gene was used as a template, and PCR was performed using the EP-F primer (SEQ ID NO: 5), SH13-R1 primer (SEQ ID NO: 31), and SH13-R2 primer (SEQ ID NO: 32) to recover a PCR product of approximately 0.1 kb in size. To prepare a library in which the 28th amino acid was mutated, the gene encoding wB3 (SEQ ID NO: 4), the gene encoding EP2 (E28G) (SEQ ID NO: 8), and the gene encoding EPS3 (SEQ ID NO: 25) were used as template, and PCR was performed using SH13-F1 primer (SEQ ID NO: 29), SH13-F2 primer (SEQ ID NO: 30), SH43-R1 primer (SEQ ID NO: 35), and SH43-R2 primer (SEQ ID NO: 36) to recover a PCR product of approximately 0.14 kb in size. To prepare a library in which the 43rd amino acid was mutated, the EP2 (E28G) (SEQ ID NO: 8) coding gene was used as a template and PCR was performed using the SH43-F1 primer (SEQ ID NO: 33), SH43-F2 primer (SEQ ID NO: 34), SH51-R1 primer (SEQ ID NO: 39), and SH51-R2 primer (SEQ ID NO: 40) to recover a PCR product of approximately 0.07 kb in size. To prepare a library in which the 51st amino acid was mutated, the EP2 (E28G) (SEQ ID NO: 8) coding gene was used as a template and PCR was performed using the SH51-F1 primer (SEQ ID NO: 37), SH51-F2 primer (SEQ ID NO: 38), SH60-R1 primer (SEQ ID NO: 44), SH60-R2 primer (SEQ ID NO: 45), and SH60-R3 primer (SEQ ID NO: 46) to recover a PCR product of approximately 0.08 kb in size. To prepare a library in which the 60th amino acid was mutated, the EP2 (E28G) (SEQ ID NO: 8) coding gene was used as a template, and PCR was performed using the SH60-F1 primer (SEQ ID NO: 41), SH60-F2 primer (SEQ ID NO: 42), SH60-F3 primer (SEQ ID NO: 43), and T7 primer (SEQ ID NO: 6) to recover a PCR product of approximately 0.32 kb in size. The composition of the PCR reaction solution was prepared by adjusting the final volume to 100 μL with the respective template DNA, primers, Pfu-X DNA polymerase, 10X Pfu-X Reaction buffer, and 10 mM dNTPs. The above reaction mixture was reacted under the following conditions: pre-denaturation at 95° C. for 2 min, followed by denaturation at 95° C. for 50 secs, annealing at 58° C. for 40 secs and polymerization at 72° C. for 1 min, the reaction was repeated 25 times and post-polymerization at 72° C. for 5 min.
[0188] A PCR product of 102 bp, a PCR product of 141 bp, a PCR product of 67 bp, a PCR product of 78 bp, and a PCR product of 320 bp obtained under the above conditions were mixed and PCR was performed without adding primers to recover a PCR product of about 0.7 kb in size consisting of five PCR products ligated together. Using the above PCR product of about 0.7 kb as a template, PCR was performed using EP-F primer (SEQ ID NO: 5) and T7 primer (SEQ ID NO: 6) to amplify a multi-variant DNA fragment of about 0.7 kb in size. The PCR product of about 0.7 kb was inserted into the pBC KS(+) vector DNA in the same manner as in Example <2-2>, and transformation of the E. coli DH5α strain was performed to prepare a DNA shuffling library.
Example 6
Development of mBF Variants with Increased Alkaline Tolerance: Comparison of Alkaline Tolerance of Variant Protein mBF Monomers
[0189] The library prepared in Example 5 was purified by the same manner as in Examples <1-3>, and the absorbance over time was measured by the same method as in Example 3 to compare the alkali tolerance. The absorbance over time obtained is shown in
[0190] As shown in
[0191] The amino acid sequences of the protein L B3 domain variants selected in Examples 1 to 6 above are summarized in Table 2 below:
TABLE-US-00002 TABLE 2 SEQ ID NO: Description Sequence(N.fwdarw.C) 4 Wild-type Protein L B3 MPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYR domain YADLLAKENGKYTVDVADKGYTLNIKFAGKEKTPEE 7 Protein L B3 domain variant MPKEEVTIKANLIYADGKTQTAEFKGTFAEATAEAYR EP1(E28A) YADLLAKENGKYTVDVADKGYTLNIKFAGKEKTPEE 8 Protein L B3 domain variant MPKEEVTIKANLIYADGKTQTAEFKGTFGEATAEAYR EP2(E28G) YADLLAKENGKYTVDVADKGYTLNIKFAGKEKTPEE 9 Protein L B3 domain variant MPKEEVTIKANLIFADGKTQTAEFKGTFGEATAEAYR BEP1(E28G/Y13F) YADLLAKENGKYTVDVADKGYTLNIKFAGKEKTPEE 10 Protein L B3 domain variant MPKEEVTIKANLIYADGKTQTAEFKGTFGEATAEAYR (E28G/K43P) YADLLAPENGKYTVDVADKGYTLNIKFAGKEKTPEE 11 Protein L B3 domain variant MPKEEVTIKANLIYADGKTQTAEFKGTFGEATAEAYR BEP3(E28G/D51V) YADLLAKENGKYTVVVADKGYTLNIKFAGKEKTPEE 12 Protein L B3 domain variant MPKEEVTIKANLIYADGKTQTAEFKGTFGEATAEAYR BEP4(E28G/N60E) YADLLAKENGKYTVDVADKGYTLEIKFAGKEKTPEE 23 Protein L B3 domain variant MPKEEVTIKANLIYADGKTQTAEFKGTFLEATAEAYR EPS1(E28L) YADLLAKENGKYTVDVADKGYTLNIKFAGKEKTPEE 24 Protein L B3 domain variant MPKEEVTIKANLIYADGKTQTAEFKGTFPEATAEAYR EPS2(E28P) YADLLAKENGKYTVDVADKGYTLNIKFAGKEKTPEE 25 Protein L B3 domain variant MPKEEVTIKANLIYADGKTQTAEFKGTFWEATAEAYR EPS3(E28W) YADLLAKENGKYTVDVADKGYTLNIKFAGKEKTPEE 26 Protein L B3 domain variant MPKEEVTIKANLIYADGKTQTAEFKGTFGEATAEAYR EPS4(E28G/K43E) YADLLAEENGKYTVDVADKGYTLNIKFAGKEKTPEE 27 Protein L B3 domain variant MPKEEVTIKANLIYADGKTQTAEFKGTFGEATAEAYR EPS5(E28G/D51T) YADLLAKENGKYTVTVADKGYTLNIKFAGKEKTPEE 28 Protein L B3 domain variant MPKEEVTIKANLIYADGKTQTAEFKGTFGEATAEAYR EPS6(E28G/N60F) YADLLAKENGKYTVDVADKGYTLFIKFAGKEKTPEE 47 Protein L B3 domain variant MPKEEVTIKANLIFADGKTQTAEFKGTFGEATAEAYR mBF (Y13F/E28G/K43P) YADLLAPENGKYTVDVADKGYTLNIKFAGKEKTPEE
Example 7
Alkali Ttolerance of mBF Tetramers
<7-1>Synthesizing the 4mBF Gene
[0192] To further confirm the alkali tolerance of the mBF4 protein identified in Example 6-1, the gene encoding the mBF4 variant was synthesized as a tetramer and named 4mBF. The gene sequence was synthesized by CosmoGeneTech (Daejeon, Korea) after codon optimization (SEQ ID NO: 48).
<7-2>Preparation of pET-4mBF Plasmid
[0193] The 4mBF gene (SEQ ID NO: 48) obtained in the above Example <7-1> was cloned into the pET29a(+) vector (Stratagene, USA) as described in Example <1-2> to prepare a pET-4mBF plasmid. The pET-4mBF plasmid expressed a variant protein 4mBF represented by SEQ ID NO: 49.
<7-3>Purification of Variant Protein mBF Tetramers Using Nickel-Affinity Resin
[0194] To seed the E. coli DH5α transformants transformed with the pET-4mBF plasmid and containing the 4mBF gene, 5 mL of LB liquid medium containing kanamycin antibiotic was dispensed into a 50 mL conical tube, the selected transformants were inoculated, and the culture was shaken for 16 hours at 37° C. and 200 rpm. 500 mL of TB liquid medium containing kanamycin antibiotic was dispensed into a 2000 mL triangular flask, inoculated with 1% (v/v) of the selected transformants, and shaken at 37° C., 200 rpm. After shaking to approximately OD600=0.6, isopropyl-β-D-thio-galactopyranoside (IPTG) was added to a final concentration of 1 mM and further shaken at 37° C., 200 rpm for 18 hours. The flask culture was centrifuged (4° C., 8,000 rpm, 20 min) to recover the bacteria and suspended in 30 mL of PBS buffer (pH 7.4) (Intron Biotechnology, Korea). This suspension was disrupted with an ultrasonic grinder at 4° C. for 30 minutes and centrifuged (4° C., 20,000 rpm, 20 min) to obtain only the supernatant. The column was loaded with 7 mL of WorkBeads™ 40 Ni-NTA (bioworks, Sweden), followed by 35 mL of binding buffer (20 mM NaH2PO.sub.4, 300 mM NaCl, 10 mM Imidazole pH 8.0), mixed with 30 mL of the above supernatant and 30 mL of binding buffer, and loaded onto the column. 35 mL of wash buffer (20 mM NaH.sub.2PO.sub.4, 300 mM NaCl, 30 mM Imidazole pH 8.0) was run, followed by 40 mL of elution buffer (20 mM NaH.sub.2PO.sub.4, 300 mM NaCl, 300 mM Imidazole pH 8.0), and the passage was collected in a 50 mL conical tube. The purified protein was desalted using a HiPrep 26/10 desalting column (cytiva, USA).
<7-4> Comparison of Alkali Tolerance of Variant Protein mBF Tetramers
[0195] The 4mBF purified in Example <7-3> was coupled to N-hydroxysuccinimide (NHS)-Activated sepharose 4 Fast flow (Cytiva, Sweden). The prepared 4 mBF resin (4mBF-agarose bead) was compared for alkali tolerance to a commercially available protein L-based resin (Cytiva 17-5478-01, Capto L), which is known to be highly alkali-tolerant. A Tricorn 5/50 column (cytiva, USA) was loaded with 1 ml of each resin followed by 5 ml of PBS buffer (pH 7.4) (Intron Biotechnology, Korea) at 1 ml/min. 25 ml of approximately 1 mg/ml of purified antibody (KBIO, Korea) was diluted with 25 ml of PBS buffer and flowed at 1 ml/min. After removing unbound antibody protein by flowing 5 ml of PBS buffer at 1 ml/min, 5 ml of elution buffer (0.1 M Glycine-HCl, pH 2.5) was flowed at 0.5 ml/min and the passage liquid was collected to separate the bound antibody. The isolated antibody was then collected in a tube containing 0.5 ml of neutralization buffer (1 M Tris-HCl, pH 8.5) so that it could be neutralized, and the amount of recovered antibody was measured. After the initial binding assay, 5 ml of PBS buffer was flowed at 1 ml/min for alkaline treatment, followed by 7.5 ml of 0.3 M NaOH at 0.5 ml/min to allow the NaOH to contact the resin for 15 minutes. Then, 5 ml of PBS buffer was added at 1 ml/min to remove the remaining NaOH, which was set as one alkali treatment, and the alkali treatment was repeated in the same manner (1-15 cycles). After alkali treatment, the purified antibody was bound by the same method as the initial binding assay, and the amount of antibody was recovered and measured. The alkali tolerance of each resin was analyzed by repeating the above method and comparing the amount of antibody recovered.
[0196] The results obtained above are shown in
[0197] All references, including publications, patent applications, and patents, cited herein are hereby incorporated by reference to the same extent as if each reference were individually and specifically indicated to be incorporated by reference and were set forth in its entirety herein.
[0198] The use of the terms “a” and “an” and “the” and “at least one” and similar referents in the context of describing the invention (especially in the context of the following claims) are to be construed to cover both the singular and the plural, unless otherwise indicated herein or clearly contradicted by context. The use of the term “at least one” followed by a list of one or more items (for example, “at least one of A and B”) is to be construed to mean one item selected from the listed items (A or B) or any combination of two or more of the listed items (A and B), unless otherwise indicated herein or clearly contradicted by context. The terms “comprising,” “having,” “including,” and “containing” are to be construed as open-ended terms (i.e., meaning “including, but not limited to,”) unless otherwise noted. Recitation of ranges of values herein are merely intended to serve as a shorthand method of referring individually to each separate value falling within the range, unless otherwise indicated herein, and each separate value is incorporated into the specification as if it were individually recited herein. All methods described herein can be performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by context. The use of any and all examples, or exemplary language (e.g., “such as”) provided herein, is intended merely to better illuminate the invention and does not pose a limitation on the scope of the invention unless otherwise claimed. No language in the specification should be construed as indicating any non-claimed element as essential to the practice of the invention.
[0199] Preferred embodiments of this invention are described herein, including the best mode known to the inventors for carrying out the invention. Variations of those preferred embodiments may become apparent to those of ordinary skill in the art upon reading the foregoing description. The inventors expect skilled artisans to employ such variations as appropriate, and the inventors intend for the invention to be practiced otherwise than as specifically described herein. Accordingly, this invention includes all modifications and equivalents of the subject matter recited in the claims appended hereto as permitted by applicable law. Moreover, any combination of the above-described elements in all possible variations thereof is encompassed by the invention unless otherwise indicated herein or otherwise clearly contradicted by context.