Platform for developing stable mammalian cell lines
20230340542 · 2023-10-26
Inventors
- Kadri Õunap (Õssu, EE)
- Eva-Maria Tombak (Õssu, EE)
- Mart Toots (Õssu, EE)
- Madis Jakobson (Õssu, EE)
- Mart Ustav, Jr. (Õssu, EE)
- Kerttu Murumets (Õssu, EE)
- Urve Toots (Õssu, EE)
- Andres Männik (Õssu, EE)
- Mart Ustav, Sr. (Õssu, EE)
Cpc classification
C12N2310/20
CHEMISTRY; METALLURGY
C12N15/1024
CHEMISTRY; METALLURGY
International classification
C12N15/90
CHEMISTRY; METALLURGY
Abstract
This disclosure provides methods and landing pad constructs for generation of parental cell lines suitable for targeted integration. A method is provided by the parental cell line development; this is, the introduction of binding sites of BPV1 E2 protein to landing pad vectors so that expressed BPV1 E2 protein could locate the vector to transcriptionally active region in the genome. Cells with high expression level of reporter genes are selected for the next stage and will be used in the development of cell lines expressing another recombinant protein by recombination mediated cassette exchange (RMCE). Landing pad constructs include recombination target sites for site-specific recombinases, and therefore, it could be replaced with gene-of-interest expression construct containing the same set of recombination target sites. This yields the generation of producer cell lines with less effort compared to traditional cell line development by random integration.
Claims
1. A method to develop parental cell lines, said method comprising the steps of: a) providing a landing pad construct comprising recognition sites of site-specific recombinases at 5′ and 3′ ends of the landing pad construct, and at least one reporter gene encoding a detectable reporter protein, coding sequences for at least one selection marker, and binding sites of a bovine papillomavirus (BPV) E2 protein; b) providing an expression plasmid comprising a nucleotide sequence encoding a BPV E2 protein; c) co-transfecting a cell with the landing pad construct and the expression plasmid; d) tethering the landing pad to a transcriptionally active chromatin locus by allowing expression from the landing pad construct and the expression plasmid; and e) screening expression levels of the at least one reporter gene in cell pools obtained from step d) and selecting cells that have highest expression levels as the parental lines.
2. The method of claim 1, wherein the cell is a mammalian cell.
3. The method of claim 2, wherein the mammalian cell is a CHO cell.
4. A method for high and stable expression of a gene of interest, said method comprising the steps of: a) developing a parental cell line according to the method of claim 1; b) providing a gene of interest construct comprising the same recognition sites of site-specific recombinases as the landing pad construct; c) replacing the landing pad construct with the gene of interest construct by co-transfecting the parental cell line with the gene of interest construct and an expression construct or mRNA for site-specific recombinases recognized by the recognition sites; and d) cultivating the cell line in an environment suitable for expression of the gene of interest.
5. The method of claim 4, wherein the cell line is a mammalian cell line.
6. The method of claim 4, wherein the cell line is a CHO cell line.
7. The method of claim 4, wherein the gene of interest encodes a recombinant protein.
8. The method of claim 7, wherein the recombinant protein is an antibody.
9. A kit for developing cell lines for production of at least one protein of interest, the kit comprising: a landing pad construct comprising recognition sites of site-specific recombinases at the 5′ and 3′ ends of the landing pad construct, and at least one reporter gene encoding a detectable reporter protein, coding sequences for at least one selection marker, and binding sites of a bovine papillomavirus (BPV) E2 protein; an expression plasmid comprising a nucleotide sequence encoding a BPV E2 protein; a gene of interest construct comprising coding sequences for the at least one protein of interest and the same recognition sites of site-specific recombinases as the landing pad construct; and a suitable cell line for co-transfection.
10. A landing pad construct comprising recognition sites of site-specific recombinases, wherein the recognition sites are at the 5′ and 3′ ends of the landing pad construct, and between the recognition sites the landing pad construct further comprises at least one reporter gene encoding a detectable reporter protein, coding sequences for at least one selection marker, and binding sites of a bovine papillomavirus (BPV) E2 protein.
11. The landing pad construct of claim 10, wherein the recognition sites of site-specific recombinases are wild-type recombination sites of Cre recombinase according to SEQ ID NO:5.
12. The landing pad construct of claim 10, wherein the recognition sites of site-specific recombinases are incompatible Cre recombinase sites, preferably LoxP site and Lox 2272 site.
13. The landing pad construct of claim 10, wherein the construct comprises coding sequences for multiple reporter genes expressed as one polypeptide and wherein each reporter protein is capable of being detected separately.
14. The landing pad construct of claim 13, wherein the coding sequence for the multiple reporter genes is according to SEQ ID NO:12, and the reporter proteins are Gaussia luciferase protein, EGFP and firefly luciferase.
15. The landing pad construct of claim 10, wherein the coding sequence for at least one reporter gene coding for a detectable reporter protein comprises coding sequence for secreted protein alkaline phosphatase.
16. The landing pad construct of claim 10, wherein at least one nucleotide sequence encoding a selection marker and at least one reporter gene are linked with a nucleotide sequence encoding a Foot and Mouth Disease Virus (FMDV) 2A peptide.
17. The landing pad construct of claim 10, wherein the landing pad construct comprises the nucleotide sequence of SEQ ID NO:1 or 2.
18. An isolated cell line comprising the landing pad construct of claim 10.
19. The isolated cell line of claim 18 further comprising an expression plasmid comprising a nucleotide sequence encoding a BPV E2 protein.
20. The isolated cell line of claim 18, wherein the cell line is a mammalian cell line.
Description
SHORT DESCRIPTION OF THE FIGURES
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
DETAILED DESCRIPTION OF THE INVENTION
Definitions
[0042] In this disclosure the following terms are used as defined below:
[0043] “A gene of interest” refers to a cDNA encoding a gene product of interest such as a protein of interest or recombinant protein of interest.
TABLE-US-00001 “attB” refers to nucleotide sequence (SEQ ID NO: 9) GGTTTGTCTGGTCAACCACCGCGGTCTCAGTGGTGTACG GTACAAACC. “attP” refers to sequence (SEQ ID NO: 10 GGCTTGTCGACGACGGCGGTCTCCGTCGTCAGGATCAT.
[0044] “BPV1” refers to bovine papillomavirus type I.
[0045] “E2” refers to a protein encoded by nucleotides 2594-3837 of BPV subtype 1.
[0046] “E2BS” refers to bovine papillomavirus E2 protein binding sites.
[0047] “EGFP” refers to Enhanced Green Fluorescent Protein.
[0048] “FLuc” refers to Firefly Luciferase.
[0049] “FR” refers to Family of Repeats, Epstein Barr virus EBNA1 protein binding site.
TABLE-US-00002 “FRT1” refers to recombinase recognition sequence of Flp (SEQ ID NO: 7) GAAGTTCCTATTCCGAAGTTCCTATT CTCTAGAAAGTATAGGAACTTC “FRT6” refers to modified recombinase recognition sequence of Flp (SEQ ID NO: 8) GAAGTTCCTATTCCGAAGTTCCTAT TCTTCAAAAAGTATAGGAACTTC.
[0050] “GLuc” refers to Gaussia luciferase.
[0051] “landing pad cell line” refers to a mammalian cell line, that contains the integrated landing pad cassette.
[0052] “landing pad” refers to plasmids that contain recognition sequences for site-specific recombinases (suitable recombinases are e.g., BxB1 integrase, Flp or Cre recombinase, but it is to be noted that other recombinases may also be used), expression cassettes of reporter genes (suitable reporter genes are secreted alkaline phosphatase (SEAP), Gaussia luciferase, Firefly luciferase, enhanced green fluorescent protein (EGFP) and/or in-house developed single chain antibody 4F3, but it is to be noted that other reported genes may also be used), and expression cassettes for proteins giving resistance to selection antibiotics. Some but not all “landing pad” vectors contain binding sites for BPV1 E2 protein and/or binding sites for EBV EBNA 1 binding sites.
[0053] “Lox2272” refers to 34 nucleotide sequence ATAACTTCGTATAAaGTATcCTATACGAAGTTAT (SEQ ID NO:6) which contains 2 altered residues compared to LoxP sequence.
[0054] “LoxP” refers to 34 nucleotide sequence ATAACTTCGTATAATGTATGCTATACGAAGTTAT (SEQ ID NO: 5) found on bacteriophage P1. This is a recombination target site of Cre recombinase of bacteriophage P1;
[0055] “pyORI” refers to polyomavirus replication origin.
[0056] “RMCE” refers to Recombination Mediated Cassette Exchange, facilitated by site-specific recombinase enzymes such as but not limited to Cre, Flp or BxB1.
[0057] “SEAP” refers to Secreted Alkaline Phosphatase
[0058] The present disclosure provides a method and constructs for development of stable mammalian cell lines for protein production. The mammalian cells may be CHO cells, but other cell lines such as HEK 293, NS0, Sp2/0 are also possible. The methods and constructs of this disclosure can be used to generate host cells for targeted integration. These host cells or landing pad cells contain expression cassettes of reporter genes, selection markers and recognition sites for site-specific recombinases. Based on the expression of the reporter genes and their stability in time, the best parental cell lines can be selected and thoroughly characterized. After this, cell lines expressing protein-of-interest are generated from suitable parental cell line. For this, site-specific recombinases are used in recombination mediated cassette exchange (RMCE) through recombinase target sites flanking the landing pad cassette and recombination vectors.
[0059] It was surprisingly found that E2 protein enables generating stable cell pools with high expression level of reporter genes when landing pad constructs containing BPV1 E2 binding sites are used. Therefore, the present invention provides constructs and methods for co-transfecting BPV1 E2 protein together with the landing pad construct, so that landing pad cell pools with higher expression level of reporter genes can be generated.
[0060] According to one aspect of the invention methods and constructs for generation of host cells for targeted integration by using landing pad constructs that contain binding sites for BPV1 E2 protein are provided.
[0061] According to one aspect recombination plasmids and mechanisms for targeted integration of the gene-of-interest (GOI) expression vectors to the parental mammalian cell lines are provided.
[0062] An advantage of the present invention is reduction of the length of cell line development process compared to classical random integration approach and decrease the cost of the process as less cells/plates need to be screened.
[0063] According to one aspect of the invention the bovine papillomavirus type I protein E2, the main transcriptional regulator of BPV1 helps to activate the transcription of promoters in the proximity of E2 binding sites in mammalian cells, including but not limited to CHO-S cells. By regulating transcription through E2 binding sites, BPV1 E2 supports the increase of recombinant protein expression level in E2 positive cell line.
[0064] Landing Pad Cell Line Development
[0065] Landing pad constructs of this disclosure with all necessary elements are shown in
[0066] Designing of Landing Pad Vectors
[0067] To overcome the limitations of random integration, we have engineered landing-pad (LP) expression cassettes that can be integrated to the genome of mammalian cell lines, e.g. but not limited to CHO cells for developing parental cell lines, so called landing pad cell lines. For quantifiable, quick and cost-effective screening, the landing pad constructs encode for one or more detectable fluorescent proteins (e.g. EGFP among others) or secretable proteins (such as antibodies). Once integrated into the cells, landing pad cassette can be replaced with gene-of interest expression cassette by recombination-mediated cassette exchange (RMCE) to generate cell lines producing biologics.
[0068] Several versions of the landing pad expression cassettes containing the following elements were engineered:
[0069] 1. Reporter genes for easy and cost-effective screening of high-producing clones. For protein production in industrial scale, a cell line should have high transcription and translation levels and for evaluation of these processes, both intracellular reporter genes (e.g. but not limited to Firefly luciferase, Fluc; EGFP, Green fluorescent protein) and extracellular reporter genes (e.g. but not limited Gaussia luciferase, Gluc; Secretative alkaline phosphatase, SEAP; monoclonal antibody) can be used. After the synthesis and post-translational modification, recombinant protein has to be secreted to the growth media, so that the purification of the protein would be easier. Therefore, besides transcription and translation, the ability to efficiently secrete large amount of protein(s) is crucial. Thus, secretative reporter genes such as SEAP (although other secretative reporter genes may also be used) describe the secretion machinery of the CHO clone.
[0070] 2. Promoters for driving gene expression. Most promoters used in the landing pad cassettes are relatively weak viral or eukaryotic promoters, the purpose of which is to avoid downregulation of gene expression caused by high level of intracellular proteins. Relatively high levels of reporter gene expression driven by weak promoter usually means that the construct has integrated into transcriptionally active chromatin region.
[0071] 3. Binding sites for chromatin anchoring proteins. Many different DNA-viruses replicate as extrachromosomal episomes. For efficient gene expression and replication, the episomal viral genomes situate near transcriptionally active regions of cell genome. The viral genomes are often transferred to these regions by viral protein(s) that bind to their respective binding-sites (BS). Therefore, by inserting virus BS-s into LP (landing pad) DNA, in the presence of viral proteins, the LP should be directed to transcriptionally active region of the chromatin prior to integration. For that, a binding region of BPV1 E2 protein and FR—binding region for Epstein Barr virus EBNA1 protein were inserted into the landing pad constructs. In addition, there is also included Polyomavirus replication origin (PY ori) that facilitates amplification of the integrated cassette in the presence of PY LT protein.
[0072] 4. Recombination target sites (LoxP, FRT and attB) of site-specific recombinases are flanking the expression cassettes of reporter genes and selection marker. These sites are used for generation of cell lines for production of protein of interest. By inserting compatible recombinase target sites for site-specific recombinases to the gene-of-interest expression construct, it can be specifically inserted into genome of a parental cell line to the same position as landing pad. The targeted integration occurs between two LoxP sites facilitated by Cre recombinase, between FRT sites facilitated by Flp recombinase or between attB and attP sites facilitated by BxB1 recombinase.
[0073] 5. Resistance gene for antibiotic, e.g., for Hygromycin B is required for selection of cells that contain integrated copy or copies of the landing pad cassette.
[0074] Plasmids. Detailed Description Vectors Used in Landing Pad Cell Line Development
[0075] Landing pad vectors were constructed according to principles described above and the integrity of the elements was assessed by sequencing. Linearized constructs are schematically shown in
[0076] LP2str #132 (
TABLE-US-00003 i) Secreted alkaline phosphatase (SEAP) from human placenta: (SEQ ID NO: 16) (MLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAA EALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAA RILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDK HVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCN TTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPA GTYAHTVNRNWYSDADVPASARQEGCQDIATQLIS NMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTR LDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSV THLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALR LLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETI MFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGY PLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLK DGARPDVTESESGSPEYRQQSAVPLDEETHAGEDV AVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPYT ACDLAPPAGTTDAAHPGYSRVGAAGRFEQT) followed by ii) 2A peptide from foot-and-mouth disease virus (SEQ ID NO: 17) (APVKQTLNFDLLKLAGDVESNPGP) followed by iii) hygromycin B phosphotransferase (SEQ ID NO: 18) (KKPELTATSVEKFLIEKFDSVSDLMQLSEGEESR AFSFDVGGRGYVLRVNSCADGFYKDRYVYRHFASA ALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLPE TELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQG IGQYTTWRDFICAIADPHVYHWQTVMDDTVSASVA QALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGR ITAVIDWSEAMFGDSQYEVANIFFWRPWLACMEQQ TRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVD GNFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAA VWTDGCVEVLADSGNRRPSTRPDREMGEAN).
[0077] This polypeptide is processed co-translationally, yielding two final products—detectable SEAP and hygromycin B phosphotransferase that gives resistance to hygromycin B.
[0078] The second expression cassette contains the SV40 enhancer and early promoter (pSV40e), in-house developed synthetic intron, expression cassette of a second polypeptide, GLuc-2A-EGFP-2A-Fluc, and herpes simplex virus 1 thymidine kinase polyA signal. GLuc-2A-EGFP-2A-Fluc polypeptide, encoded by SEQ ID NO:12, consisting of 1024 amino acids has the following parts:
TABLE-US-00004 i) Gaussia luciferase (SEQ ID NO: 19) (MGVKVLFALICIAVAEAKPTENNEDFNIVAVASNF ATTDLDADRGKLPGKKLPLEVLKEMEANARKAGCT RGCLICLSHIKCTPKMKKFIPGRCHTYEGDKESAQ GGIGEAIVDIPEIPGFKDLEPMEQFIAQVDLCVDC TTGCLKGLANVQCSDLLKKWLPQRCATFASKIQGQ VDKIKGAGGD) followed by ii) 2A peptide from foot-and-mouth disease virus (SEQ ID NO: 17) (APVKQTLNFDLLKLAGDVESNPGP) followed by iii) Enhanced green fluorescent protein (SEQ ID NO: 20) (SEQ ID NO: 15) (FEMVSKGEELFTGVVPILVELDGDVNGHKFSVSGE GEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYG VQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKD DGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNIL GHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIE DGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSAL SKDPNEKRDHMVLLEFVTAAGITLGMDELYK) followed by iv) 2A peptide from foot-and-mouth disease virus (SEQ ID NO: 16) (APVKQTLNFDLLKLAGDVESNPGP) followed by v) Firefly luciferase (SEQ ID NO: 21) MEDAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYAL VPGTIAFTDAHIEVDITYAEYFEMSVRLAEAMKRY GLNTNHRIVVCSENSLQFFMPVLGALFIGVAVAPA NDIYNERELLNSMGISQPTVVFVSKKGLQKILNVQ KKLPIIQKIIIMDSKTDYQGFQSMYTFVTSHLPPG FNEYDFVPESFDRDKTIALIMNSSGSTGLPKGVAL PHRTACVRFSHARDPIFGNQIIPDTAILSVVPFHH GFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDY KIQSALLVPTLFGFFAKSTLIDKYDLSNLHEIASG GAPLSKEVGEAVAKRFHLPGIRQGYGLTETTSAIL ITPEGDDKPGAVGKVVPFFEAKVVDLDTGKTLGVN QRGELCVRGPMIMSGYVNNPEATNALIDKDGWLHS GDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELE SILLQHPNIFDAGVAGLPDDDAGELPAAVVVLEHG KTMTEKEIVDYVASQVTTAKKLRGGVVFVDEVPKG LTGKLDARKIREILIKAKKGGKIAV).
[0079] This polypeptide is also processed co-translationally, yielding three final products—Gaussia luciferase, EGFP and Firefly luciferase, all of which are reporter proteins that can be used for evaluating the productivity of the cell clones.
[0080] Between two expression cassettes are located: [0081] i) The binding sites of BPV1 E2 protein (BPV E2BSs; SEQ ID NO: 22) [0082] ii) polyomavirus core origin (PyVOri SEQ ID NO:23) [0083] iii) The binding sites for EBNA-1 protein from Epstein-Barr virus known as Family of repeats (FR; SEQ ID NO:24)
[0084] LP2str #132 contains two types of recombinase target sites—LoxP and attB, recognized by Cre recombinase from bacteriophage P1 and BxB1 integrase from bacteriophage. When cells containing the LP2str #132 are used for generation of cell lines producing protein-of-interest, the exchange vectors should contain either two LoxP sites or two attP sites.
[0085] In LP2str_CAR_4F3 #182 and LP2str_4F3_wo BS #3, the expression cassette of Gluc-2A-EGFP-2A-Fluc is replaced with cassette encoding for an in-house developed antibody (4F3 scFv) that recognizes the Ebolavirus Zaire glycoprotein. The expression of this reporter gene is driven by Rous sarcoma virus long terminal repeat promoter (RSV LTR). A small intron (SEQ ID NO:25), located upstream of the ORF, and SV40 polyA signal are also included in the cassette.
[0086] LP2str_CAR_4F3 #182 contains incompatible or “heterospecific” recombinase target sites. At one side of the expression cassette, there is wild-type recognition site of Cre recombinase, known as LoxP site. A mutated target site, Lox2272 is flanking the expression cassettes from another side. Recombination occurs between two LoxP sites or between two Lox2272 sites, but not between the incompatible LoxP and Lox2272 sites. The introduction of different recombinase target sites to the plasmids helps to avoid the intramolecular recombination events. In addition, this landing pad cassette includes another set of incompatible recombinase target sites, FRT1 and FRT6 that are used by Saccharomyces cerevisiae site specific recombinase flippase (Flp). Recombination occurs between two FRT1 sites or between two FRT6 sites but not between the incompatible sites. For GOI-cell line development, the exchange vectors should also have two incompatible recombinase target sites, either Lox2272 and LoxP site, or FRT1 and FRT6 sites. At the same time, the Cre or Flp recombinase should be expressed.
[0087] pQMCF-7-BPVE2 #32 is the expression vector for BPV1 E2 protein. Expression cassette contains herpes simplex virus thymidine kinase promoter followed by human elongation factor 1α intron A, the coding region for BPV1 E2 protein and SV40 polyA sequence. SV40 enhancer and early promoter (pSV40e) drives expression of aminoglycoside phosphotransferase from Tn5 that gives resistance to aminoglycoside antibiotics, such as kanamycin and geneticin, used for selecting bacterial and mammalian cells, respectively. The purpose of using BPV1 E2 protein was to bind it to E2BS present in landing pad expression cassette in order to facilitate the loading of landing pad sequences to transcriptionally active chromatin region.
[0088] Designing of Gene-of-Interest Expression Vectors
[0089] Depending on the type of protein to be produced, vectors containing either one (e.g. SEQ ID NO:14) or two expression cassettes (SEQ ID NO:15) can be used. It is to be understood that other vectors may also be developed for this purpose. For driving the expression of gene of interest, human eIF4A1, human hEF1α, CAG promoter and RSV LTR are introduced to the cassettes. It is to be understand that other weak promoters may also be used. Also replacing these weak promoters with a stronger one, e.g. with CMV promoter or even with a transcriptionally active cellular promotor may be used.
[0090] Recombination vectors contain the expression cassette of another selection marker compared to landing pad cell lines, e.g. Streptoalloteichus hindustanus Sh ble gene, conferring resistance to zeocin or puromycin N-acetyltransferase, conferring resistance to puromycin. The expression of resistance gene is driven by SV40 early enhancer and promoter or HSV TK promoter and the bgh polyA signal is used in both cases.
[0091] For RMCE, recombinase target sites must be introduced to the recombination vectors. In order to use cell lines containing the LP2str #132 landing pad for protein-of-interest cell line development, recombination plasmids containing two wild-type LoxP sites or two attP sites should be used. For using cell lines having the LP2str_CAR_4F3 #182, recombination plasmids with incompatible Lox2272 and LoxP or recombination plasmids with incompatible FRT1 and FRT6 sites are use in RMCE to develop new cell lines.
[0092] Cell Culture and Transfections
[0093] CHO cells were cultivated in medium containing 1:1 mixture of CD CHO (Thermo Fisher Scientific, Cat No. 10743-029) and 293 SFMII (Thermo Fisher Scientific, Cat No. 11686-029). Medium is supplemented with 6 mM GlutaMax (Thermo Fisher Scientific, Cat No. 35050-038) and 10 ml/l HT Supplement (Thermo Fisher Scientific, Cat No. 41065-12). For selecting landing pad cell pools, medium is supplemented with 400 μg/ml Hygromycin B (Thermo Fisher Scientific, Cat No. 10687-010). For selecting cells expressing protein of interest, medium is supplemented with 100 μg/ml zeocin (Thermo Fisher Scientific, Cat. No. R250). Cells were grown at 37° C. in a humidified 8% CO.sub.2 environment. For cultivating cells in 24-well, 6-well plates or 125 ml shaker flasks, orbital shaking incubator at 110 rpm (orbital diameter 25 mm) is used.
[0094] Cells were transfected by electroporation with Bio-Rad Gene Pulser II that was supplied with a capacitance extender (Bio-Rad Laboratories). For transfecting plasmid DNA or co-transfecting mRNA and plasmid DNA, capacitance and voltage settings were at 975 μF and 220 V. Cre (Cat. No. 30-101-113) and Flp mRNA (Cat. No. 130-106769) were obtained from Miltenyi Biotec.
[0095] Western Blot Analysis and Coomassie Blue Staining
[0096] Western blot analysis is performed to evaluate the expression of intracellular BPV1 E2 protein or the secreted human transferrin present in the cell culture media or fed-batch production media. For lysis, cells were collected by centrifugation, suspended in phosphate buffered saline, lysed in equal volume of Laemmli buffer containing DTT and heated at 100° C. for 5 minutes. The cases when DTT is not added, will be marked. Proteins were separated by SDS-polyacrylamide gel electrophoresis and transferred by a semidry blotting method to a polyvinylidene difluoride (PVDF) membrane (Millipore Corp.). For detecting BPV1 E2, membranes were incubated with in-house developed antibodies against E2 protein (1:1 mixture of #1E4 and #3E8, concentration 1 μg/ml). For detecting hTF, membranes were incubated with antibody against human transferrin (Abcam, Cat. No. 82411, concentration 1:8000). As secondary antibodies, goat anti-mouse IgG or goat anti-rabbit IgG, conjugated with HRP were. Detection was performed using TMB Solution III (Biopanda Diagnostics, Cat. No. TMB-P-001) following the manufacturer's recommendations.
[0097] SEAP and GLuc Measurement
[0098] For evaluating SEAP and GLuc expression, Secrete-Pair Dual Luminescence Assay Kit (GeneCopoeia, Cat. No. LF032) was used according to manufacturer's suggestions.
[0099] ELISA
[0100] To evaluate the expression of reporter gene 4F3 scFv by ELISA, in-house produced recombinant Zaire Ebolavirus glycoprotein (1 μg/ml) diluted in PBS was coated onto 96-well MaxiSorp NUNC-immunoplates and incubated overnight at 4° C. Plates were washed with 0.05% Tween20 (PBS-Tw) in PBS and blocked for 1 hour with 2% BSA in PBS-Tw. Dilutions from the cell culture media was prepared and incubated for one hour at room temperature on the shaker. Typically, growth media collected from the 96-well plate is diluted 1:2 to 1:10 and growth media collected from 6-well plate is diluted 1:1000. Horseradish peroxidase (HRP)-conjugated goat anti-human IgG (LabAS), diluted in 1% BSA in PBS-Tw, was used as a secondary antibody for 45 min. After washing, the reaction was developed with the TMB solution VIII (2 in 1) (Biopanda Diagnostics, Cat. No. TMB-P-003) for 10 min and stopped with 0.5 M H.sub.2SO.sub.4. The absorbance at 450 nm was measured spectrophotometrically using the ELISA plate reader. For evaluating the concentration of 4F3 scFv in growth media, 2-fold serial dilutions of in-house purified 4F3 scFv antibody were added as standards.
[0101] For evaluating the expression level of hTF and calculating the productivity of hTF cell lines, the Elisa kit from Abcam (Cat. No. ab187391) was used according to manufacturer's protocol.
[0102] Fed-Batch Production
[0103] For fed-batch production analysis, cells were seeded at 4×10.sup.6 cells/ml in 25-30 ml (in 125 shaker flasks) and the incubation temperature was shifted from 37° C. to 30° C. Cells were fed on days 0, 2, 4, 6 and 8 with 6% of proprietary feed and the production media was collected at day 10. For production of recombinant proteins, Feed B (Thermo Fisher Scientific, Cat. No. A1024001) supplemented with 6 mM GlutaMax (Thermo Fisher Scientific, Cat No. 35050-038) was used. For production of antibodies, the 1:1 mixture of Feed A (Thermo Fisher Scientific, Cat. No. A1023401) and Feed B (Thermo Fisher Scientific, Cat. No. A1024001), supplemented with 6 mM GlutaMax (Thermo Fisher Scientific, Cat No. 35050-038) was used.
Example 1. BPV1 E2 Protein Increases the Expression Level of Recombinant Proteins in Mammalian Cells
[0104] To test whether BPV1 E2 protein affects the recombinant protein expression in mammalian cells and could be used in stable cell line development, the landing pad vectors with (SEQ ID NO:2) and without BPV1 E2 binding sites (SEQ ID NO:3) were generated. Expect in the presence or absence of E2 binding sites, both vectors are similar and contain the expression cassettes of two reporter genes—one for in-house developed single chain antibody (4F3 scFv, encoded by SEQ ID NO: 11) and the other for secreted alkaline phosphatase (SEAP). SEAP-2A-Hygromycin is transcribed as a single transcript and cleaved during translation by 2A peptide to SEAP and hygromycin phosphotransferase that gives resistance to hygromycin B. Compared to SEAP-2A-Hygromycin, 4F3 scFv was expressed from opposite strand.
[0105] Before transfection, LP2str_4F3_CAR #182 (SEQ ID NO:2) and LP2str_4F3_wo BS #3 (SEQ ID NO:3) were linearized with VspI restrictase to excise unnecessary bacterial origin of replication and prokaryotic selection marker region. The gel-purified linearized landing pad cassettes and the circular expression vector of bovine papillomavirus E2 protein (SEQ ID NO:4) were co-transfected to CHO-S clone #QE3 cells by electroporation.
[0106] In each transfection, 150 ng of landing pad vector (either SEQ ID NO:8 or SEQ ID NO:9) was used, whereas the amount of transfected BPV1 E2 vector was changed in the experiment. The scheme of the transfection is the following: [0107] 1) mock [0108] 2) 150 ng LP2str_4F3_CAR #182/VspI [0109] 3) 150 ng LP2str_4F3_CAR #182/VspI+5 ng pQMCF-7-BPV1E2 #32 [0110] 4) 150 ng LP2str_4F3_CAR #182/VspI+50 ng pQMCF-7-BPV1E2 #32 [0111] 5) 150 ng LP2str_4F3_CAR #182/VspI+250 ng pQMCF-7-BPV1E2 #32 [0112] 6) 150 ng LP2str_4F3 w/o BS #3/VspI+5 ng pQMCF-7-BPV1E2 #32 [0113] 7) 150 ng LP2str_4F3 w/o BS #3/VspI+50 ng pQMCF-7-BPV1E2 #32 [0114] 8) 150 ng LP2str_4F3 w/o BS #3/VspI+250 ng pQMCF-7-BPV1E2 #32
[0115] Two days after transfection, the 400 μg/ml Hygromycin B was added to the media and the cells were selected in the presence of antibiotic for one week to generate stable cell pools containing integrated landing pad cassettes. The probe number 1 (mock) did not survive the selection as it was not transfected with landing pad cassette and therefore, it does not contain the hygromycin phosphotransferase gene. 7 days after the addition of hygromycin B, the cells of selected pools were counted, seeded with equal density and the probes for analyzing the expression of reporter genes were collected 2 days after the normalization. The expression of 4F3 scFv was tested by enzyme-linked immunosorbent assay (ELISA) and the expression of SEAP was measured by Secrete-Pair Dual Luminescence Assay Kit (GeneCopoeia) according to manufacturer's recommendations.
[0116] As seen in
[0117] Taken together, the expression of BPV1 E2 protein increases the reporter gene expression when E2 binding sites are introduced to the landing pad vectors. Thus, BPV 1 E2 protein could be used in stable mammalian cell line development to increase the expression of recombinant protein, such as antibodies or other secreted proteins.
Example 2. The Generation of #504C6 Landing Pad Cell Line
[0118]
[0119] For mini-pool cloning, the cell pool was counted, diluted to density of 250 cells/ml and seeded to 90 96-well plates (100 μl per well). 5 days later, the ELISA screen for testing the expression of 4F3 scFv antibody was performed, after which the top 20 mini-pools were divided again (2.sup.nd round mini-pool cloning). This time, each well, containing −400-800 cells was divided between two 96-well plates and cultivated for 2 weeks, after which the screening to test the expression of 4F3 scFv was performed to select top 8 mini-pools (#51, 62, 66, 67, 60, 31, 50 and 15). These highest producers were cultivated to larger volume and divided by limiting dilution (0.5 cells/well) to achieve clonal cell lines. After the clones achieved desired cell density, the expression analysis of 4F3 scFv was performed to select top 120 cell lines that were expanded to 6-well plates.
[0120] In 6-well plates, cells were counted and diluted to similar density (5×10.sup.5 cells/ml). After 3 days, the samples from growth media were collected for evaluating 4F3 scFv expression by ELISA. In 6-well, 120 clonal cell lines were analysed and based on the ELISA results, the top 10% of cell lines (
[0121] Thus, by co-transfecting CHO cells with the landing pad vector (SEQ ID NO:2) and BPV1 E2 expression cassette (SEQ ID NO:4), it is possible to generate the parental cell lines with high expression of reporter antibody.
Example 3. #504C6 Landing Pad Cell Line has One Integration Site in the CHO Genome
[0122] Great parental cell lines have integrated the landing pad expression cassette into the active site of the genome. Random integration approach, used in the landing pad cell line development, could generate cell lines with either single or several integration sites of the cassette. Therefore, when only one integration site of the transgene is acceptable for the parental cell line, more than one clonal cell line should be developed to the RCB stage.
[0123] To investigate the monoclonality of the cell lines as well as the number of integration sites of LP2str_4F3_CAR #182 (SEQ ID NO:2) in the CHO cell genome by fluorescence in situ hybridization (FISH), metaphase chromosomes from three cell lines (#621 A2, #622 All and #504 C6) were prepared and hybridized with biotin labeled LP2str_4F3_CAR #182. Signal was amplified with Tyramide signal amplification kit and detected with HRP-Streptavidin and Alexa Fluor™ 488 Tyramide. According to the results, all three cell lines were monoclonal, meaning that all metaphase cells have a similar integration pattern. Two of the cell lines (#621 A2 and #622 A11), originating from the mini-pool #62, had two integration sites of the landing pad cassette and will therefore not used in the later stages of the development. The cell line #504 C6, originating from mini-pool #50, was selected for further studies because this cell line has a single integration site of the LP2str_4F3_CAR #182, located at telomeric region of a large chromosome. The results of FISH analysis of #504 C6 cell line are presented on
[0124] Targeted locus amplification (TLA) analysis (outsourced from Cergentis B.V.) confirmed the FISH analysis, showing that there is only one integration site of the LP2str_4F3_CAR #182 located in the scaffold 15 (data not shown).
Example 4. The Expression of 4F3 scFv Antibody is Stable for at Least 8 Weeks in #504 C6 Landing Pad Cell Line
[0125] A long generation time of mammalian cells is needed to achieve the desired growth volume and cell density in bioreactors before the production of biologics could be started. Therefore, one important requirement for the production cell line is the stability of recombinant protein expression for at least one month. For testing the stability of the reporter gene expression in our landing pad cell line #504 C6, it was cultivated for 8 weeks. Throughout the experiment, cells were monitored and diluted every 2-3 days. Each week, cells were diluted to the same density (5×10.sup.5 cells/ml in 20 ml) and after 2 days, the sample of the growth media was collected. After 8 weeks, ELISA analysis was performed to compare the amount of 4F3 scFv antibody in growth media. The results, presented in
Example 5. BPV1 E2 Expression Vector has Integrated to the Genome of the Landing Pad Cells Enabling the Constant Expression of BPV1 E2 Protein
[0126] For generation of landing pad cell line #504 C6, the unmodified CHO-S cell line was co-transfected with LP2str_4F3_CAR #182 and pQMCF-7-BPV1E2 #32. The landing pad vector has the expression cassette for hygromycin phosphotransferase, favoring the integration of the cassette in the presence of hygromycin B selection. pQMCF-7-BPV1E2 #32 contains the expression cassette for aminoglycoside phosphotransferase that makes cells resistant to neomycin and geneticin, however, these antibiotics were not used to select the integration of BPV1 E2 expression cassette. To find out whether the fragments of pQMCF-7-BPV1E2 #32 could also have integrated to the #504 C6 cell line, the TLA analysis of this vector was done together with LP2str_4F3_CAR #182 analysis. To our surprise, #504 C6 cell line contained the whole pQMCF-7-BPV1E2 #32.
[0127] Although pQMCF-7-BPV1E2 #32 was integrated to the #504 C6 landing pad cells it does not necessarily mean that the BPV1 E2 protein itself is expressed at the detectable level. Therefore, western blot analysis for evaluating BPV1 E2 expression was performed in 12 parental cell lines, characterized in
Example 6. BPV1 E2 Protein Upregulates the Transient Expression of Recombinant Proteins Via E2 Binding Sites Introduced to the Plasmids
[0128] BPV1 E2 protein is a transcription factor that regulates the transcription via its binding sites in the viral genome. To study whether the BPV1 E2 protein, encoded from the integrated expression cassette in CHO cells, could help to increase the expression level of an ectopically expressed recombinant protein via E2 binding sites introduced to the plasmid DNA, a transient expression experiment was performed in #504 C6 landing pad cell lines. For this, 4 different constructs expressing a recombinant protein such as human transferrin were prepared. In two of the plasmids, hTF transcription is driven by the heIF4A1 promoter and in another two plasmids by hEF1α promoter. In both cases, one of the cassette contained the E2 binding sites upstream of the promoter (marked with +), whereas another construct lacks E2 binding sites (marked with −). For evaluating the effect of the E2BSs on the hTF protein expression, the plasmid DNAs and a mock control (only carrier DNA) were transfected by electroporation to #504 C6 cells. 3 days later, supernatant samples were collected and the expression of hTF was analysed by western blot. As seen in
[0129] Taken together, the presence of BPV1 E2 binding sites in the proximity of promoters driving the transcription of a recombinant protein (such as human transferrin) has a positive effect on the expression level of these proteins in BPV1 E2 positive cell line such as #504 C6.
Example 7. Optimization of the Conditions for Recombination-Mediated Cassette Exchange Required for the Efficient Development of Cell Lines Producing Protein of Interest
[0130] The IcoCell parental cell lines such as #504 C6 contain the integrated landing pad cassette in the active site of the genome which facilitates the high expression of the reporter genes. In addition, the recognition sites of several site-specific recombinases were introduced to ends of the landing pad cassette so that these sites could facilitate the recombination mediated cassette exchange to replace the landing pad construct with the expression cassettes of monoclonal antibodies or other recombinant proteins. Since #504 C6 landing pad cell line maintains the stable expression of 4F3 scFv for at least 8 weeks (
[0131] #504 C6 landing pad cell line consists the LP2str_4F3_CAR #182 (SEQ ID NO:2) which contains the recognition sequences for different site-specific recombinases (Cre, Flp and BxB1). The site-specific recombinase of bacteriophage P1, the Cre protein, recognizes 34 bp DNA sequence known as LoxP site (SEQ ID NO:5), mutated sites such as Lox2272 (SEQ ID:NO6) and others. Compared to LoxP site, Lox2272 contains two mutated residues in the 8 bp spacer sequence and preferably, site-specific recombination occurs either between LoxP or Lox2272 sites. In respect to each other, the “heterospecific” LoxP and Lox2272 sites are “incompatible”, meaning that the recombination between these two sites does not take place or occurs at a very low frequency.
[0132] LoxP and Lox2272 sites are also included in exchange vectors (SEQ ID NO:7 and SEQ ID NO:8) and for targeted integration, the landing pad cells (e.g., to #504 C6 cells) should be co-transfected with exchange vectors and with either the plasmid DNA or mRNA encoding the Cre recombinase. In respect to recombination efficiency, each genomic locus is different and therefore, optimization of transfection e.g., the amount of plasmid DNA and Cre mRNA is crucial for each parental cell line.
[0133] To optimize the recombination process in #504 C6 parental cell line and find suitable conditions for protein of interest cell line development, these cells were co-transfected with pREC-Lox2272-E2BS-heIF4A1-hTF-SV40eP-Zeo #11 plasmid and Cre recombinase mRNA (Miltenyi Biotec GmbH). Scheme of the optimization experiment is presented in
[0134] As seen in
[0135] For FISH, the plasmid DNA containing unique elements of pREC-Lox2272-E2BS-heIF4A1-hTF-SV40eP-Zeo #11 was constructed, labeled with biotin and used for hybridization of metaphase chromosomes of cell pools selected with zeocin. Signal was amplified with Tyramide signal amplification kit and detected with HRP-Streptavidin and Alexa Fluor™ 488 Tyramide,
[0136] At least 100 metaphase cells were examined for each pool to calculate the frequencies of targeted integration, targeted integration with additional random integration of the recombination cassette, or random integration events with up to 2 or more integration sites. The results of FISH, summarized in
[0137] Similar experiment was also performed with Flp recombinase and the exchange vectors containing incompatible recombination target sequences of this enzyme, namely FRT1 and FRT6 sites. It has been shown by several authors that RMCE using FRT sites is efficient and precise and could be used for development of cell lines encoding for protein of interest (Kim and Lee, 2008; Zhang et al., 2015). However, in our system, the frequency of site-specific integration using the Lox2272 and LoxP sites is higher compared to the use of FRT1 and FRT6 sites. In our system, Cre recombinase and exchange plasmids containing its incompatible recombination target sites Lox2272 and LoxP are preferred according to the results of this investigation.
[0138] Transfection with 3 μg Cre mRNA and 300 μg recombination plasmid yielded the cell pool with highest frequency of RMCE and lowest frequency of random integration and thus, these conditions will be used for following cell line developments with the #504 C6 parental cell line.
Example 8. Generation of a Cell Line Expressing Recombinant Protein
[0139] For generation of clonal cell line expressing human transferrin, the cell pool that had the highest frequency of targeted integration was sub-cloned by limiting dilution. After 3-4 weeks, screening of the loss of 4F3 scFv was performed in 96-well format to select cells with targeted integration of the exchange vector and to eliminate clones with random integration of the cassette. The cell lines without 4F3 scFv were expanded to 24-well and to 6-well and normalized to similar density. hTF expression was analyzed using the commercial ELISA kit (Abcam, Cat. No. ab187391) according to manufacturer's recommendation. Cell lines #24, #57, #64, #82, #85, #89 and #107, expressing hTF at highest level, were transferred to 125 ml shaker flasks, cultivated to desired cell density for research cell bank generation. After that, the productivities of cell lines were tested in small-scale fed-batch culture, similarly to 4F3 production described in example 2, except Feed B (not the mixture of Feed A and B) was added every 2 days. Production supernatants were analyzed by SDS-Page followed by Coomassie blue staining (
[0140] The Coomassie blue staining of hTF production supernatants (
Example 9. Protein of Interest Cell Lines Developed from #504 C6 Parental Cell Line by RMCE Express BPV1 E2 Protein
[0141] The parental cell line #504 C6 is BPV1 E2 positive, meaning that it expresses E2 protein at detectable level. Although, BPV1 E2 expression cassette is integrated to the #504 C6 landing pad cell line, it is unknown whether E2 protein is also expressed in protein of interest cell lines that have undergone RMCE, antibiotic selection and the long cultivation time from single cell to RCB. Western blot analysis was performed to test the BPV1 E2 protein expression in hTF cell lines. For this, cells in fed-batch production were counted, lysed and the lysate of −50 000 cells was analyzed. The immunoblot in
[0142] Thus, BPV1 E2 protein expression is stable in protein of interest producing cell lines generated from #504 C6. It is possible, that the transactivation properties of E2 that lead to upregulation of gene expression from promoters close to E2BSs could also occur in stable cell lines generated by RMCE.
REFERENCES
[0143] Bebbington, C. R., Renner, G., Thomson, S., King, D., Abrams, D., and Yarranton, G. T. (1992). High-level expression of a recombinant antibody from myeloma cells using a glutamine synthetase gene as an amplifiable selectable marker. Biotechnol. Nat. Publ. Co. 10, 169-175. [0144] Frye, C., Deshpande, R., Estes, S., Francissen, K., Joly, J., Lubiniecki, A., Munro, T., Russell, R., Wang, T., and Anderson, K. (2016). Industry view on the relative importance of “clonality” of biopharmaceutical-producing cell lines. Biol. J. Int. Assoc. Biol. Stand. 44, 117-122. [0145] Inniss, M. C., Bandara, K., Jusiak, B., Lu, T. K., Weiss, R., Wroblewska, L., and Zhang, L. (2017). A novel Bxb1 integrase RMCE system for high fidelity site-specific integration of mAb expression cassette in CHO Cells. Biotechnol. Bioeng. 114, 1837-1846. [0146] Kaufman, R. J., and Sharp, P. A. (1982). Amplification and expression of sequences cotransfected with a modular dihydrofolate reductase complementary dna gene. J. Mol. Biol. 159, 601-621. [0147] Kim, M. S., and Lee, G. M. (2008). Use of Flp-mediated cassette exchange in the development of a CHO cell line stably producing erythropoietin. J. Microbiol. Biotechnol. 18, 1342-1351. [0148] Liu, P.-Q., Chan, E. M., Cost, G. J., Zhang, L., Wang, J., Miller, J. C., Guschin, D. Y., Reik, A., Holmes, M. C., Mott, J. E., et al. (2010). Generation of a triple-gene knockout mammalian cell line using engineered zinc-finger nucleases. Biotechnol. Bioeng. 106, 97-105. [0149] Urlaub, G., and Chasin, L. A. (1980). Isolation of Chinese hamster cell mutants deficient in dihydrofolate reductase activity. Proc. Natl. Acad. Sci. U.S.A 77, 4216-4220. [0150] Wigler, M., Perucho, M., Kurtz, D., Dana, S., Pellicer, A., Axel, R., and Silverstein, S. (1980). Transformation of mammalian cells with an amplifiable dominant-acting gene. Proc. Natl. Acad. Sci. U.S.A 77, 3567-3570. [0151] Zhang, L., Inniss, M. C., Han, S., Moffat, M., Jones, H., Zhang, B., Cox, W. L., Rance, J. R., and Young, R. J. (2015). Recombinase-mediated cassette exchange (RMCE) for monoclonal antibody expression in the commercially relevant CHOK1SV cell line. Biotechnol. Prog. 31, 1645-1656. [0152] Zhu, J. (2012). Mammalian cell protein expression for biopharmaceutical production. Biotechnol. Adv. 30, 1158-1170.