A Method Of Detecting an Analyte and Related Systems

20230375531 · 2023-11-23

    Inventors

    Cpc classification

    International classification

    Abstract

    There is provided a method of detecting an analyte in a sample, the method comprising: incubating said sample with a reporter agent to allow said reporter agent to bind to said analyte, if present, in said sample; applying the incubated sample to a cellulose substrate to allow said analyte that is bound to said reporter agent to be captured onto said cellulose substrate by a capture agent comprising a cellulose binding domain (CBD), wherein said capture agent is: (i) incubated with said sample prior to the applying step; and/or (ii) immobilised on said cellulose substrate prior to the applying step; and detecting a signal effected by the reporter agent to determine the presence or absence of said analyte. There is also provided related systems and methods of identifying an infection and detecting an antibody against an infection in a subject, in particular SARS-Cov-2 via lateral flow or vertical flow assays.

    Claims

    1. A method of detecting an analyte in a sample, the method comprising: applying the sample to a cellulose substrate to allow said analyte, if present in said sample, to be captured onto said cellulose substrate by a capture agent comprising a cellulose binding domain (CBD), wherein said capture agent is: (i) incubated with said sample prior to the applying step; and/or (ii) immobilised on said cellulose substrate prior to the applying step; and determining a presence or absence of said analyte captured on said cellulose substrate by said capture agent.

    2. The method of claim 1, wherein determining a presence or absence of said analyte captured on the cellulose substrate by said capture agent comprises detecting a signal effected by a reporter agent on the cellulose substrate, wherein said reporter agent: (i) comprises an analyte binder and said reporter agent is contacted with the sample to allow said reporter agent to bind to said analyte, if present, in said sample; or (ii) comprises a competing binder having affinity for said capture agent and said reporter agent is contacted with said capture agent to allow said reporter agent to bind to said capture agent.

    3. The method of claim 1, wherein the amount of said capture agent is not more than 1000-fold molar excess, optionally not more than 100-fold molar excess, further optionally not more than 60-fold molar excess of said analyte.

    4. The method of claim 2, wherein where said reporter agent comprises an analyte binder, the method comprises incubating the reporter agent and the capture agent with said sample prior to the applying step and said analyte, when present, is part of a reporter agent-analyte-capture agent complex prior to the applying step.

    5. The method of claim 2, wherein where said reporter agent comprises an analyte binder, the method comprises incubating the reporter agent with said sample and immobilizing said capture agent on the cellulose substrate prior to the applying step and said analyte when present, is bound to the reporter agent to form a reporter agent-analyte complex prior to the applying step.

    6. The method of claim 2, wherein where said reporter agent comprises a competing binder, the method comprises incubating said capture agent with said reporter agent and/or said sample prior to the applying step to form a reporter agent-capture agent complex and/or an analyte-capture agent complex prior to the applying step.

    7. The method of claim 2, wherein where said reporter agent comprises a competing binder, the method comprises incubating said reporter agent with said sample and immobilizing said capture agent on said cellulose substrate prior to the applying step and dispensing the reporter agent incubated with said sample on said cellulose substrate after the applying step.

    8. The method of claim 1, wherein a plurality of capture agents is immobilised on said cellulose substrate in a substantially uniform orientation.

    9. The method of claim 1, wherein in said capture agent, said CBD is coupled to a C-terminus of a binding protein for said analyte.

    10. The method of claim 1, wherein the presence or absence of said analyte in said sample is determined within 15 minutes from the start of the incubating step.

    11. The method of claim 1, wherein said method is a method of detecting coronavirus in a sample.

    12. The method of claim 1, wherein said method is a lateral flow assay method.

    13. The method of claim 1, wherein said method is a vertical flow assay method and the applying step comprises allowing the sample to flow through a plurality of cellulose substrate layers.

    14. The method of claim 11, wherein the analyte is an antibody against SARS-CoV-2, and wherein the method comprises: applying a sample from the subject to a cellulose substrate to allow said antibody, if present in said sample, to be captured onto said cellulose substrate by a capture agent comprising a cellulose binding domain (CBD), wherein said capture agent is: (i) incubated with said sample prior to the applying step; and/or (ii) immobilised on said cellulose substrate prior to the applying step; contacting the capture agent with a reporter agent to allow said reporter agent to bind to said capture agent, wherein the reporter agent comprises a competing binder having affinity for said capture agent; and detecting a signal effected by the reporter agent to determine a presence or absence of said antibody captured on said cellulose substrate by said capture agent.

    15. The method of claim 14, wherein the sample is selected from the group consisting of: a plasma sample, a serum sample and a whole blood sample.

    16. The method of claim 14, wherein said capture agent is incubated with said sample before said capture agent is contacted with said reporter agent.

    17. The method of claim 11, wherein the analyte is a SARS-CoV-2 protein, and wherein the method comprises: incubating a sample obtained from a subject with a reporter agent to allow said reporter agent to bind to a SARS-CoV-2 protein, if present, in said sample; applying the incubated sample to a cellulose substrate to allow the SARS-CoV-2 protein that is bound to said reporter agent to be captured onto said cellulose substrate by a capture agent comprising a cellulose binding domain (CBD), wherein said capture agent is: (i) incubated with said sample prior to the applying step; and/or (ii) immobilised on said cellulose substrate prior to the applying step; and detecting a signal effected by the reporter agent to determine a presence or absence of said SARS-CoV-2 protein captured on said cellulose substrate by said capture agent.

    18. The method of claim 17, wherein the SARS-CoV-2 protein comprises SARS-CoV-2 nucleocapsid (N) protein.

    19. The method of claim 17, wherein said reporter agent and said capture agent are configured to bind to different epitopes of the SARS-CoV-2 protein.

    20. The method of claim 17, wherein said sample is selected from the group consisting of: a saliva sample, a sputum sample, a nasal fluid sample, a pharyngeal fluid sample, a nasopharyngeal fluid sample and an oropharyngeal fluid sample.

    Description

    BRIEF DESCRIPTION OF FIGURES

    [0164] FIG. 1. The scheme of a conventional sandwich complex for analyte detection.

    [0165] FIG. 2. A conventional rapid diagnostic test (RDT) format.

    [0166] FIG. 3. A scheme of a capture agent and a sandwich complex in accordance with embodiments disclosed herein. (A) a capture agent comprising a cellulose binding domain (CBD) and (B) a sandwich complex comprising such a capture agent in accordance with embodiments disclosed herein.

    [0167] FIG. 4. A comparison between a conventional RDT format and a cellulose pull down assay format in accordance with an embodiment disclosed herein.

    [0168] FIG. 5. A scheme of a cellulose pull down full complex method in accordance with an embodiment disclosed herein.

    [0169] FIG. 6. A scheme of a cellulose pull down half complex method in accordance with an embodiment disclosed herein.

    [0170] FIG. 7. The colorimetric results of different reagent interaction times on cellulose papers in an example. (A) very short incubation time (SI), (B) limited incubation time (LI), (C) sufficient incubation time for formation of half sandwich complex and pull down using pre-immobilized capture agent comprising CBD (i.e. cellulose pull down half complex—CP-H) and (D) sufficient incubation time for formation of full sandwich complex and pull down using high interaction affinity between CBD and cellulose substrate (i.e. cellulose pull down full complex—CP-F).

    [0171] FIG. 8. The colorimetric results obtained from different assay formats. (A) an assay in a comparative example (B) a cellulose pull down half complex (CP-H) method in accordance with an embodiment disclosed herein, (C) a cellulose pull down full complex (CP-F) method in accordance with an embodiment disclosed herein and (D) a combination of the CE and CP-H method in accordance with an embodiment disclosed herein.

    [0172] FIG. 9. Overview of the test construction and image acquiring devices. (A) Exploded scheme of the cellulose testing unit, comprising 2 pieces of acrylic manifold to hold the testing unit together, 3 layers of the folded and printed cellulose test strip whereby hydrophobic ink (black area) was used to determine liquid flow path and folded Kim Wipes which is used as an absorbent pad. (B) An Image of the assembled cellulose testing unit which is held together using paper binders. (C) An image of the top piece of the acrylic manifold which contains an opening to access the cellulose test strip. (D) An image of cellulose test strip. The strip was printed and cut as one piece. Wax ink was used for printing (black area) to define the liquid flow path. To create 3 layers of the test strip, the printed paper is folded in a zig-zag motion until the hydrophobic regions are aligned (inset). The top most layer of the cellulose paper contains a circular testing region (white, hydrophilic area without ink) with a diameter of 5 mm whereas the lower two layers, each, contain hydrophilic regions with a diameter of 6 mm. Each cellulose testing unit contains two test zones for testing of two reactions. (E) An image of the folded Kim Wipes which was folded in half for 6 times and used as absorbent material. (F) An image of the lower piece of the acrylic manifold which contain 3 mm spacers at two ends. The spacers are used to control consistent pressure that applies to different cellulose testing units. (G) An image of the light box with the phone placed at the top face. (H) An image of a slight opened light box showing phone fixture and a void for phone camera access at the top face. (I) An image of opened light box showing internal structure of the box. Warm-white LED light strips were attached to the inner top face of the light box to provide consistent lighting for all images. Cylindrical, white papers were covered parts of the LET strips to diffuse light from the strip, prevent shadow which may form on the cellulose test unit. Fixture was placed at the base of the light box to provide a fixed location to place the cellulose test unit.

    [0173] FIG. 10. Overview of workflow and signal analysis of cellulose pull-down VNT. (A) Schematic of working principle and workflow of cellulose pull-down VNT (cpVNT). (i) Un-diluted plasma is mixed with receptor binding domain (RBD) tagged to cellulose binding domain (RBD-CBD) and angiotensin-converting enzyme 2 (ACE2) receptor tagged to biotin and streptavidin horse-radish peroxidase (ACE2-BA-SA-HRP). (ii) The reaction is incubated for 5 min to allow NAbs/RBD-CBD or ACE2-BA-SA-HRP/RBD-CBD complex formations. (iii) The mixture is applied on the cellulose-based vertical-flow device. (iv) Washing solution and ready-to-use 3,3′,5,5′-tetramethylbenzidine (TMB) substrate solution are sequentially applied to the device. Colorimetric reaction is allowed to develop for 3 min. Signals were captured using camera. (B) Representative images of cpVNT test results at different concentrations of NAb (mouse anti SARS-CoV-2 neutralizing antibodies) and non-NAb (human anti RBD non-neutralizing antibodies) spiked non-diluted human plasma. (C) Plots of inhibitory percentages of different antibody concentrations derived from cyan intensity signals on the cellulose test strips. % Inhibitions were calculated using the following formula:

    [00001] % inhibition = 1 - ( Inhibition % = ( 1 - Cyan intensity of sample Cyan intensity of negative control ( no NAb ) ) * 100 %

    Limit of detections (LOD) were determined using mean+3SD formular and represented as the dotted lines. All data were represented as mean±SD. Each data points were performed in triplicates. 4 Parameters logistic model was used to draw the fitted curve with R.sup.2 value of 0.9534.

    [0174] FIG. 11. Comparison of COVID-19 NAb status from convalescents samples between pVNT and sVNT methods. Evaluation of NAb status from COVID-19 convalescent samples at different time points post infection from different follow up visits (FV) using (A and B) pVNT and (D and E) sVNT. Data shown in (A and D) were mean±SD of % neutralization for pVNT and mean±SD % inhibition for sVNT, respectively. Each data points were performed in triplicates. Lines connecting different data points represented samples that were obtained from the same subjected collected at different time points. Data shown in (B and E) were mean values of % neutralization for pVNT and % inhibition for sVNT from different samples. (C) Correlation between sVNT and pVNT. Mean values from each data point were represented on the graph. (F) Alternative correlation plot between sVNT and pVNT where data were arranged from highest to lowest values of pVNT neutralization percentages. Data were represented as mean±SD. Grey and black dotted lines represent cut-off values at 50% and 20% for pVNT and sVNT, respectively, to distinguish positive and negative NAb status.

    [0175] FIG. 12. Evaluation of NAb status from COVID-19 convalescent samples, at different time points post infection, from different follow up 1.0 visits (FV) using cpVNT. (A) NAbs from all samples and visits as compared to pre-COVID plasma samples. Cut-off value which distinguished positive from negative NAb levels was designated at 20% inhibitory percentage (grey line). Each data point represented mean value of % inhibition of different samples. Each point was performed in triplicates. (B) NAbs detection using cpVNP from different samples at different time points. Data were represented as mean±SD. Each data point was performed in triplicates. Lines connecting different data points represented signals obtained from the same sample at different time points. (C) Alternative presentation of NAbs detected from different visits. Each data point represented mean value of % inhibition obtained from different samples. Each point was performed in triplicates. (D) Correlation between cpVNT and pVNT. Black and grey lines represent cut-off values at 20% and 50% for cpVNT and pVNT, respectively. Each data point represented mean value of % inhibition or % neutralization for cpVNT and pVNT, respectively. Each point was performed in triplicates. (E) Correlation between cpVNT and sVNT. Black and grey lines represent cut-off values at 20% for cpVNT and pVNT. Each data point represented mean value of % inhibitions for cpVNT and pVNT. Each point was performed in triplicates. (F) Cross reactivity test of cpVNT using antibodies against different viruses or viral antigens spiked in healthy plasma samples. Grey line represents a cut-off value at 20%. Each data point represented % inhibition from a single cpVNT experiment. Three separate experiments were performed for each condition.

    [0176] FIG. 13. The cpVNT method enables shorter NAb detection time than current standards. Comparison between different VNTs including conventional VNT (cVNT) using live virus, pVNT using pseudovirus, sVNT using plate-based ELISA format and cpVNT using cellulose-based vertical flow device.

    [0177] FIG. 14. RBD-CBD and mFc-ACE2 purifications and kinetic study and example of images obtained from light box and phone camera. (A) SDS-PAGE images of recombinant RBD-CBD, mFc-ACE2 receptor and N proteins expressed and purified for this study. (B) Bio-layer Interferometry (BLI) of biotinylated mFc-Ace2 receptor on streptavidin probes and different concentrations of RBD-CBD ranging from 6.25 nM-100 nM. K.sub.D value was observed at 12.7 nM. (C) BLI of biotinylated mFc-Ace2 receptor on streptavidin probes with 100 nM RBD-CBD and N protein from SARS-CoV-2. (D) Examples of images obtained from the phone camera and the light box. Each cellulose testing unit was tested using different NAb concentrations spiked in healthy control plasma, including 0 nM in the left unit, 10 and 5 nM in the middle unit, and 100 nM in the right unit. Optimized cpVNT testing condition was used to perform these tests.

    [0178] FIG. 15. Comparison of signals on cellulose-based vertical flow device using different test configurations. Inset depicts drawings of (a) CBD, (b) RBD, (c) RBD tagged with CBD (RBD-CBD), (d) ACE2 receptor conjugated biotin (ACE2-BA) and (e) HRP conjugated streptavidin (SA-HRP). (A) Different test configurations were tested to ensure that signals detected from RBD-CBD/ACE2-BA-SA-HRP complex were specific and integration of RBD-CBD promotes rapid signal detection. (B) Cyan intensities measured from each test configuration are in presented in a bar chart format. Based on the BLI data (FIG. 18B), >80% of RBD-CBD/ACE2 complex was formed within 300 sec (5 min). Therefore 300 sec incubation time were used to allow RBD-CBD/ACE2-BA-SA-HRP to form for the cellulose-based vertical flow device. (i) ACE2-BA-SA-HRP alone or with (ii) bare RBD or (iii) bare CBD produced equally low signals of cyan intensities. These results indicated that bare RBD alone could not be immobilized on the cellulose matrix within the 10 second flow-through time. In addition, CBD does not produce non-specific signal between ACE2-SA-HRP and CBD. (iv) Equivalent amount of RBD-CBD to the liquid phase premix conditions was immobilized on cellulose matrix. Data demonstrated that only slight increase in cyan intensity was observed as compared to the baseline value (shown in A). This data indicated that the 10 second flowthrough time was not sufficient to allow the complex formation. (v) In a similar configuration to (iv), longer incubation time between RBD-CBD and ACE2-BA-SA-HRP allowed significant increase in cyan intensity, indicating that the complex formed much more efficient with longer incubation time. However, pre-immobilizing of RBD-CBD on cellulose paper introduced complicated workflow to the assay in which solution has to be maintained on the cellulose surface for 5 min before it is allowed to flow pass the test spot. (vi) Due to the known property of CBD which can interact rapidly to cellulose matrix, the pre-mix condition was introduced to allow RBD-CBD/ACE2-BA-SA-HRP complex formation before the whole complex can be captured onto the cellulose paper. Cyan intensity from this configuration showed the highest value as compared to others, confirming that CBD can be captured rapidly onto the cellulose matrix. In addition, cyan intensity from condition (vi) has shown to be significantly higher than condition (v) (Student t-test, p-value of 0.00076), suggesting that the liquid phase incubation promoted more efficient complex formation as compared to the pre-immobilized capture reagent at equimolar concentration. Each data point was represented as mean±SD and was performed at least in triplicates.

    [0179] FIG. 16. Optimization of RBD-CBD, ACE2-BA and SA-HRP concentrations for cpVNT. To optimize for reagent concentrations, plasma samples containing 0 or 100 nM NAb were used to determine the maximal and minimal cyan intensity signals. Concentrations of reagents that provide the highest ratio of max/min (0 nM:100 nM) signals were selected for the cpVNT. (A) Cyan intensity obtained from different RBD-CBD concentrations when ACE2-BA and SA-HRP concentrations were fixed at 20 nM and 2 nM, respectively. (B) Ratio of cyan intensity obtained from 0 nM:100 nM NAb. Highest ratio was observed from 10 nM of ACE2-BA, therefore this concentration was selected. Two different concentrations of RBD-CBD were tested including 10 and 20 nM. Concentrations of ACE2-BA and SA-HRP were fixed at 10 nM and 2 nM, respectively. The ratio between 0 nM:100 nM NAb of both RBD-CBD concentrations show similar value at ˜2.1, therefore different concentrations of NAb were tested to further inspect changes in cyan intensities. Cyan signals obtained from (C) 20 nM RBD-CBD showed minimal changes in the color intensities at low NAb concentrations whereas the signals obtained from (D) 10 nM RBD-CB showed distinguishable signals at low NAb concentrations, therefore nM RBD-CBD was selected for cpVNT. To optimize for SA-HPR concentration, RBD-CBD and ACE2-BA concentrations were fixed at 10 nM. (E) Cyan intensities obtained different concentrations of SA-HRP showed minimal changes at 100 nM NAb. More changes were observed from 0 nM NAb where 6 nM SA-HRP show the highest signal. (F) Ratios between 0 nM: 100 nM NAb obtained from different concentrations of SA-HRP. Highest ratio was observed at 6 nM SA-HRP, therefore this concentration was selected for cpVNT.

    [0180] FIG. 17. Detection of IgG, IgA and IgM against SARS-CoV-2 Spike (S), receptor binding domain (RBD) and nucleocapsid (N) proteins using ELISA. Plasma samples were obtained from COVID-19 convalescent patients at different follow up visits (FV) post infections. FV1, 2, and 3 were ranged from 29-73 days, 82-129 days and 183-213 days, respectively. Each data point represented mean values of optical signal read at 450 nm. Each point was performed in triplicates. Overall mean±SD values from different samples from each visit were shown in dark grey lines.

    [0181] FIG. 18. Assessment of IgG against different SARS-CoV-2 antigens. Assessment of IgG against (A) S, (B) RBD and (C) N proteins from plasma samples obtained from confirmed COVID-19 patients at different visits. Only samples from patients who came for the follow up visits were included in this analysis. Sample sizes for each of the follow up visit for FV1, FV2 and FV3 were 13, 13 and 10, respectively. Statistical analysis was done using student pair T-test. * indicates statistical difference at p value of 0.002. Each data point represented mean values of optical signal read at 450 nm. Each point was performed in triplicates. Lines connecting between different data point indicated that signals were obtained from the same sample from different visits.

    [0182] FIG. 19. Analysis of sVNT performance using known concentrations of antibodies to define a cut-off inhibitory percentage. (A) Dose response curves of SARS-CoV-2 NAbs and hAnti-RBD non-neutralizing antibodies spiked in human plasma. Each data point represented mean±SD. Each point was performed at least in triplicates. 4 Parameters logistic model was used to draw the fitted curve with R.sup.2 value of 0.9901. (B) Receive operating characteristic (ROC) curve and (C) sensitivity and specific of sVNT at different signal inhibitory percentages. At ˜20% inhibitory percentage, sVNT sensitivity maintains high at 75% and achieve specificity of 100%. As such, 20% cut-off is employed for sVNT.

    [0183] FIG. 20. Correlation between NAbs measured using sVNT and IgG against different SARS-CoV2 proteins obtained from ELISA. Correlation of sVNT and IgG against (A) S, (B) RBD and (C) N proteins. (D) NAbs status from follow up visit 1 (FV1) determined using sVNT. Data were arranged in the order of highest to lowest values. Grey bars represent samples which exhibit moderate to severe symptoms whereas black bars represent samples which exhibit mild to no symptoms. Each data point in dot plots represented mean values of different samples. Each point was performed in triplicates. Data in bar chart were represented at mean±SD. Each point was performed in triplicates.

    [0184] FIG. 21. Alternative correlation plots of cpVNT against pVNT and sVNT. (A) Correlation plot between pVNT and cpVNT with NAb status arranged from highest to lowest values. Grey and black lines represent cut-off values which determine positive and negative NAb status of pVNT and cpVNT at 50% and 20%, respectively. (B) Alternative correlation plot of sVNT and cpVNT with NAb status arranged from highest to lowest values. Black line represents a cut-off value for sVNT and cpVNT at 20%. All data points were represented as mean±SD. Each point was performed at least in triplicates.

    [0185] FIG. 22. cpVNT test results obtained from human serum samples.

    [0186] Inhibitory percentages derived from cyan intensity signals obtained from different concentrations of mouse anti SARS-CoV-2 neutralizing antibodies and human anti S1 antibodies that did not possess neutralizing property. Limit of detections (LOD) were determined using mean+3SD formular and represented as a dotted line. All data points were represented as mean±SD. Each point was performed at least in triplicates.

    [0187] FIG. 23. Comparison chart between different VNTs.

    [0188] FIG. 24. Schematic of RAPIDS process for screening of complementary binder pair.

    [0189] FIG. 25. Bio-layer Inferometry (BLI) analysis of rcSso7d binders against SARS-CoV-2 N protein. (A and B) BLI results showed that Sso.E1 bound to CTD and Sso.E2 bound to NTD of the N protein, respectively and solely. (C) Results showed that only the combination of Sso.NP.E1/N protein/Sso.NP.E2 displayed stepwise increase in the binding curve, confirming that the binder pair bind to complementary epitopes on SARS-CoV-2 N protein.

    [0190] FIG. 26. Assessment of different vertical flow assay (VFA) formats. (A) Four different assay approaches were assessed: 1) short incubation (SI) where capture molecule was immobilized on a cellulose surface and analyte and reporting molecules were applied to the cellulose paper in a stepwise manner, 2) limited incubation (LI) where capture molecule was immobilized on a cellulose surface, but analyte and reporter molecules were allowed for a short incubation period of 10 seconds prior loading to the cellulose test matrix, 3) half complex cellulose pulldown (CP-H) where capture molecule was immobilized on a cellulose paper while analyte and reporting molecules were allowed for interaction for a longer period of 1 minute prior loading onto the test matrix and 4) full complex cellulose pulldown (CP-F) where the interaction between capture molecule, analyte and reporting molecule was allowed in an aqueous phase for 1 minute prior loading onto the test matrix. (B) Results revealed that the CP-F test format produced the strongest signal intensity. (C) The CP-F test format also showed the highest ‘signal-to-noise’ ratio (+antigen/−antigen).

    [0191] FIG. 27. Construction of control reaction. (A and B) The control reaction was constructed by pre-immobilizing the cellulose control spot with SARS-CoV-2 N protein. To immobilize the N protein on the cellulose surface, the protein was fused to CBD at its C terminus (NP-CBD). The NP-CBD on the cellulose control spot is designed to capture the reporting molecule (BA-MBP-Sso.E1) presented in the sample mixture, followed the CP-F test format. (C) The control spot performance was tested with pooled healthy control saliva samples spiked with either N protein or PBS. Results showed that the control spots produced cyan intensity signals higher than 0.2 for both testing conditions.

    [0192] FIG. 28. Rapid SARS-CoV-2 vertical flow assay (VFA) workflow and performance. (A) Workflow of assay. (B) Dose response curve of different concentrations of N protein ranging from 0-50 nM spiked in saliva. Results showed that the VFA achieved a LoD at 2.5 nM. (C) Dose response curve of different SARS-CoV-2 concentrations spiked in saliva. Results revealed that the test can detect live virus at a concentration as low as 6.3×10.sup.4 TCID50/mL. (D) Cross-reactivity study of the rapid cellulose-based SARS-CoV-2 antigen test using different types of flu-causing pathogens spiked in saliva. All 18 pathogens had signal below the cut-off value (negative+3σ), while positive control with 4 nM SARS-CoV-2 N protein showed positive results.

    [0193] FIG. 29. Translation of rapid SARS-CoV-2 VFA for Point-of-Care (PoC) applications. (A) In a first approach, a complementary ‘light box’ was created to ensure the consistency of lighting condition and the phone camera distance. (B) The software in the first approach utilizes phone camera to capture an image, followed by cyan intensity analysis and result interpretation. (C) With this approach, LoD of 2 nM SARS-CoV-2 N protein was achieved. (D) In a second approach, a spectrophotometer was designed to measure the red absorbance at 650 nm. (E) LoD of 4.0×10.sup.3 TCID50/mL virus was achieved using the custom-made spectrometer system.

    [0194] FIG. 30. Images of purified proteins.

    [0195] FIG. 31. Analysis of colorimetric signals obtained from control spots. (A) Evaluation of the performance of the control spots with different concentrations of N protein spiked in saliva matrix. (B) Evaluation of the performance of the control spots with different amount of SARS-CoV-2 virus spiked in saliva matrix. (C) Evaluation of the performance of the control spots with various pathogens spiked in saliva matrix.

    [0196] FIG. 32. Images of test strip construction. (A). Schematic representation of cassette assembly; (B). Cassette assembled with plastic manifold and paper clips; (C). Cassette assembled with plastic manifold and double-sided tape; (D). Aluminum cassette assembled with screw.

    [0197] FIG. 33. Assessment of washing step. (A). Test spot images of VFAs carried out with and without washing step and with or without 5 nM SARS-CoV-2 NP respectively; (B). Cyan intensity analysis for VFAs carried out with and without washing step; (C). Signal to noise ratio (S/N) analysis for VFAs carried out with and without washing step.

    [0198] FIG. 34. Assessment of different colorimetric developmental times. (A). Test spot images of VFAs carried out with or without 5 nM SARS-CoV-2 NP that are developed for 1 or 2 or 3 minutes; (B). Cyan intensity analysis for VFAs carried out with or without SARS-CoV-2 NP for different development times; (C). Signal to noise ratio (S/N) analysis of VFAs that have been development for signal for 1 or 2 or 3 minutes.

    [0199] FIG. 35. Analysis of colorimetric signals obtained from control spots of the PoC tests. (A). Cyan intensity at control spot with different concentrations (0, 1, 2, 3, 4, 5 nM) of SARS-CoV-2 NP spiked in saliva test matrix; (B). Absorbance (650 nm) at control spot using Attonics spectrophotometer absorbance reader system with different concentrations (0, 0.032, 0.16, 0.8, 4, 20, 1,000×10.sup.3 TCID.sub.50/mL) of SARS-CoV-2 virus spiked into saliva test matrix.

    [0200] FIG. 36. Test principle and results of the rapid cellulose-based SARS-CoV-2 test that detect NAb from non-processed whole blood samples. (A) The modified assay workflow which comprises two incubation steps. (B) Simplified schemes represent assay reaction on the ‘Test’ and ‘Control’ spots of the vertical flow device. (C) Fluorescent intensities obtained from different concentrations of NAb in non-infected, non-vaccinated whole blood samples. (D) % Inhibition of fluorescent signals derived from FIG. 3B. % Inhibitions were calculated using the following formula:

    [00002] % inhibition = ( 1 - Fluorescent intensity of sample - Baseline fluorescent intensity Fluorescent intensity of negative control ( no NAb ) - Baseline fluorescent intensity ) * 100 % * Baseline fluorescent intensity was obtained from ACE 2 - FI applied on the paper without R BD - CBD .

    [0201] FIG. 37. Results obtained from the rapid cellulose-based SARS-CoV-2 NAb test. Inhibition percentages of (A) all samples representing different stages of COVID-19 vaccination (B) samples received BNT 162b2 vaccine from Pfizer and (C) samples received mRNT-1273 vaccine from Moderna. % Inhibitions were calculated using the following formula:

    [00003] % inhibition = ( 1 - Fluorescent intensity of sample - Baseline fluorescent intensity Fluorescent intensity of negative control ( no NAb ) - Baseline fluorescent intensity ) * 100 % * Baseline fluorescent intensity was obtained from ACE 2 - FI applied on the paper without R BD - CBD .

    [0202] FIG. 38. Results obtained from RBD variants. (A) Fluorescent intensities obtained from non-infected and non-vaccinated whole blood samples tested on different RBD-CBD variants capture reagents. (B) Inhibition percentages of fully vaccinated whole blood samples tested on different RBD-CBD variants. % Inhibition was calculated using the following formula:

    [00004] % inhibition = ( 1 - Fluorescent intensity of sample - Baseline fluorescent intensity Fluorescent intensity of WT negative control ( no NAb ) - Baseline fluorescent intensity ) * 100 % * Baseline fluorescent intensity was obtained from ACE 2 - FI applied on the paper without R BD - CBD .

    EXAMPLES

    Example 1—Comparison Between a Conventional Rapid Diagnostic Test (RDT) Format and a Cellulose Pull Down Assay Format

    [0203] FIG. 1 shows a scheme of a conventional sandwich complex 100 for analyte detection. The conventional sandwich complex 100 comprises a target analyte 102 captured between a reporter agent 104 and a capture agent 106.

    [0204] FIG. 2 shows a conventional rapid diagnostic test (RDT) format 200 using a cellulose substrate 208. A sample fluid containing analytes 202 is applied onto a sample loading pad 210 in a sample loading step 218. The sample fluid containing analytes 202 then travel under capillary action in step 220 to reach reporter agent pad 212 containing reporter agents 204. The analytes 202 come into contact with the reporter agents 204, which bind to the analytes 202. The sample fluid now containing reporter agent-bound analytes 202 continue to flow through the cellulose substrate 208 in step 222 to reach test zone 214 containing immobilized capture agents 206. Here, the capture agents 206 bind to the reporter agent-bound analytes 202 and immobilize them, forming a sandwich complex for signal detection at test zone 214. After the test zone 214, in step 224, the sample fluid is absorbed by waste pad 216 which facilitates consistent sample flow across the test zone 214.

    [0205] The conventional RDT format suffers from several shortcomings. In the conventional paper-based RDTs, the reporter agents have to be dry stored on the cellulose substrate or other types of substrate used as reporter agent pad 212 and the capture agents have to be immobilized to the test zone, commonly cellulose substrate, prior to performing the assay. Analytes are brought to the reporter agents and capture agents via the capillary force. Once they reach the reporter agent pad, the analytes have less than 10 seconds to form half sandwich complexes with the reporter agents. The half sandwich complexes are then brought to the test zone to form a full sandwich complex with the immobilized capture agents. Here, the capture agents only have a few seconds to capture the half sandwich complexes. With the limited interaction time, most half sandwich complexes flow past the test zone without being captured. The inefficient formation of full sandwich complexes results in low assay sensitivity and potentially false negative results.

    [0206] Furthermore, the immobilization of capture agents onto the cellulose substrate occurs spontaneously through hydrophobic and electrostatic interactions. These interactions offer only moderate strength, and thus a substantial amount of capture agents is lost through this process. In addition, this process happens without control over the orientation of the capture agents. As a result, not all of the capture agent binding faces are oriented towards the sample solution, as shown in FIG. 4A, further contributing to the low assay sensitivity.

    [0207] FIG. 3 shows a scheme of a capture agent 300 (FIG. 3A) and a sandwich complex 314 (FIG. 3B) in accordance with embodiments disclosed herein. The capture agent 300 comprises a cellulose binding domain (CBD) 304 that may be fused to an analyte binder 302. In a sandwich complex 314, a target analyte 306 is captured between the capture agent 300 comprising a CBD 304 and a reporter agent 308. The reporter agent 308 may comprise an analyte binder 310 coupled to a label 312. CBD is a protein domain that exists in many carbohydrate-active enzymes. It has very high affinity towards cellulose substrate in which interaction between the CBD and the cellulose substrate can happen in less than a second. The incorporation of CBD in the capture agent facilitates efficient capture of full sandwich complex to a cellulose substrate.

    [0208] FIG. 4 shows a comparison between a conventional RDT format 400 and a cellulose pull down assay 402 format in accordance with an embodiment disclosed herein. FIG. 4A shows a conventional RDT format 400. Capture agents 408 are immobilized on the cellulose substrate 412 in random orientations, resulting in non-uniform directions of the binding surfaces 410. Only the capture agents 408A with binding surfaces 410 facing the correct directions are able to bind the analytes 404 to form a sandwich complex together with the reporter agents 406 bound to the analytes 404. A substantial fraction of the capture agents 408B with binding surfaces 410 facing the incorrect directions are not able to capture the reporter agent-bound analytes 404, resulting in a resource waste of these capture agents. Only a limited amount of analytes 404 can be captured per area of the cellulose substrate 412, and hence the signal that may be generated from the analyte-bound reporter agents 406 is also limited. This increases the incidences of false negative results and reduces the sensitivity of the assay. FIG. 4B shows a RDT format 402 in accordance with an embodiment disclosed herein. The CBDs 424 of the capture agents 418 bind to the cellulose substrate 422, orienting the binding faces 420 of the capture agents 418 in a uniform direction towards the solution containing analytes 414. A large fraction of the capture agents 418 can bind successfully to the analytes 414. As a result, more analytes 414 can be captured per area of the cellulose substrate 422 and signal from the analyte-bound reporter agents 416 is enhanced. This reduces the incidences of false negative results and increases the sensitivity of the assay. A resource waste of the capture agents is also minimized.

    [0209] FIG. 5 shows a scheme of a cellulose pull down full complex method 500 in accordance with an embodiment disclosed herein. In step 502, analytes 506, reporter agents 508 and capture agents 510 comprising CBDs 512 are incubated in solution 516 to form full sandwich complexes 514 off-site of a cellulose substrate. This step allows sufficient interaction time between the analytes 506 and the reagents 508 and 510, thereby promoting effective formation of the full sandwich complexes 514. Typically, the full sandwich complexes 514 are formed within 1-3 minutes. Once the full sandwich complexes 514 are formed, the pre-incubated solution 516 containing the full sandwich complexes 514 (and any unbound analytes, unbound reporter agents, unbound capture agents and half sandwich complexes (not depicted) e.g. reporter agent-bound analytes and capture agent-bound analytes) are applied to a cellulose substrate 518 in step 504. The contents of the solution 516, including sandwich complexes 514 and any unbound reporter agents 508U and unbound capture agents 510U come into contact with the cellulose substrate 518. The interaction between the CBDs 512 and the cellulose substrate 518 is rapid. Within a period of time t (which can be as little as within seconds), the full sandwich complexes 514 become captured onto the cellulose substrate 518 via affinity between the CBDs 512 of the full sandwich complexes 514 and the cellulose substrate 518. Any unbound capture agents 510U and capture agent-bound analytes (not depicted) may also be captured onto the cellulose substrate 518. Presence of analytes 506 are detected by detecting the presence of full sandwich complexes 514 immobilised on the cellulose substrate 518. Embodiments of the cellulose pull down assay method as disclosed herein allows more interaction time between the analytes and reagents, thereby increasing effective formation of full sandwich complexes. Further, because of the high interaction affinity between CBD and cellulose, most of the complexes can be captured onto the cellulose paper, with the capture occurring within seconds. As a result, assay sensitivity is enhanced and false negative results are reduced with minimal resource waste (e.g. unbound reporter agents and unbound capture agents).

    [0210] FIG. 6 shows a scheme of a cellulose pull down half complex method 600 in accordance with an embodiment disclosed herein. Certain paper-based RDT devices may come in formats that are not compatible with the pre-incubation of full sandwich complexes, for example, devices that contain multiple layers of cellulose paper where the test zone is embedded inside the multi-layered paper, or devices that require cellulose substrate for fluidic path, etc. For such devices, application of a pre-incubated solution containing pre-formed full sandwich complexes may result in an un-desirable capture of the complexes on the first layer, or on the loading port of the cellulose entry point, due to the CBD-cellulose interaction. For such devices, the solution can be pre-incubated to form half sandwich complexes, instead of full sandwich complexes, and then applied to a cellulose substrate containing immobilised capture agents in the desired test zone(s) in accordance with embodiments of the method 600. In an embodiment of the method 600, in step 602, analytes 606 are incubated with reporter agents 608 in solution 612 to form half sandwich complexes (i.e. reporter agent-bound analytes) offsite of a cellulose substrate. This step allows sufficient interaction time between the analytes 606 and the reporter agents 608, thereby promoting effective formation of the half sandwich complexes 610. Typically, around 1-3 minutes is sufficient for the formation of the half sandwich complexes 610. Upon formation of the half sandwich complexes 610, the pre-incubated solution 612 containing the half sandwich complexes 610 (and any unbound analytes and unbound reporter agents (not depicted)) are applied to a cellulose substrate 614 in step 604. The cellulose substrate 614 comprises capture agents 616 that are pre-immobilised thereon e.g. at the desired test zones. The capture agents 616 may each contain a CBD 618 having affinity for the cellulose substrate 614. During the application step 604, the contents of the solution 612, including half sandwich complexes 610 and any unbound reporter agents (not depicted) come into contact with the capture agents 616 on the cellulose substrate 614. The capture agents 616 capture the half sandwich complexes 610 to form full sandwich complexes 620 on the cellulose substrate 614. Presence of analytes 606 are detected by detecting the presence of full sandwiches complexes 620 immobilised on the cellulose substrate 614. Embodiments of the cellulose pull down assay method as disclosed herein allows more interaction time between the analytes and reporter agents, thereby increasing the effective attachment of the analytes to the detectable reporter agents. This may promote high sensitivity signal production form the reporter agents. In addition, the incorporation or fusing of CBD to the capture agents promote homogenous orientation of the capture agents by direct the analyte binding faces toward the solution (FIG. 4B), thereby facilitating effective capture of the analytes and further enhancing high sensitivity signal production. As a result, assay sensitivity is enhanced and false negative results are reduced with minimal resource waste (e.g. unbound reporter agents and unbound capture agents).

    [0211] FIG. 7 shows the colorimetric results of different interaction times between the analyte 700 and the reagents (reporter agent 702 comprising an analyte binder 704 coupled to a label 706 and capture agent 708 comprising an analyte binder 710 fused to a CBD 712). The experiments were performed on cellulose papers 714. The conditions tested are the following: (A) very short incubation time (SI), (B) limited incubation time (LI), (C) sufficient incubation time for formation of half sandwich complex and pull down using pre-immobilized capture agent comprising CBD (i.e. cellulose pull down half complex—CP-H) and (D) sufficient incubation time for formation of full sandwich complex and pull down using high interaction affinity between CBD and cellulose substrate (i.e. cellulose pull down full complex—CP-F). The results demonstrate the proof-of-concept and also the advantages of embodiments of the method as compared with the approach where only limited interaction time is allowed on the cellulose substrate/paper for formation of complexes. Negative and positive samples refer to absence or presence of the target analyte. Results from FIG. 7A show that the sequential application of different reagents (i.e. very short interaction time, SI) produced minimal distinguishable colorimetric signal between negative and positive samples (FIG. 7E). FIG. 7B represents a condition where only limited interaction time (LI) is allowed on a cellulose substrate/RDT device. In this condition, minimal colorimetric signal difference is observed between the negative and positive samples. Results from these experiments indicate that full sandwich complexes are not formed and/or not captured effectively on to the substrate/paper (FIG. 7E). In FIG. 7C, cellulose pull down (CP) technology is applied using half complex pre-incubation (CP-H) in accordance with an embodiment disclosed herein. As compared to LI condition (FIG. 7B), the pre-incubation time is increased from 10 seconds to 1 minute, allowing sufficient interaction time for half complex formation. For this condition, distinct colorimetric signals from the two samples can be visually noticed, with darker blue colorimetric signal being observed from the positive samples (FIG. 7E). In FIG. 7D, CP with full sandwich complex (CP-F) is carried out by pre-incubating the reagents and the samples for the formation of full sandwich complexes in accordance with an embodiment disclosed herein. The pre-incubation time is 1 min off-site of the cellulose paper. The results show obvious blue colorimetric signals from the positive samples as compared to the negative samples (FIG. 7E). Results from CP-H and CP-F indicate that with sufficient pre-incubation time and CBD, full sandwich complexes are effectively formed and captured on to the cellulose paper. Results from CP-F also suggest that CBD can be captured rapidly and effectively onto the paper, therefore enhancing further the assay sensitivity. Embodiments of the methods CP-H and CP-F were observed to give 7 and 26 times increase in colorimetric signal production respectively, as compared to SI assay format. The increase in signal production indicates improved capture efficiency of full complex on to the cellulose paper. With this improvement, embodiments of the methods are expected to advantageously lower the Limit of Detection (LoD) of biomarkers when applied in RDT.

    [0212] FIG. 8 shows the colorimetric results obtained from varying the interaction time between the analyte 800 and reagents (reporter agent 802 comprising analyte binder 804 coupled to a label 806 and capture agent 808 comprising an analyte binder 810 fused to a CBD 812) and/or the concentration of the capture agent 808. The experiments were performed on cellulose papers 814. The conditions tested are the following: (A) an assay performed according to a comparative example (CE) where a high molar concentration of capture agents comprising CBD were immobilized on the cellulose substrate and other reagents were applied sequentially as per standard immunoassay protocol, (B) cellulose pull down half complex (CP-H) where 1 minute pre-incubation for formation of half sandwich complexes is performed before addition to the test zone of the substrate that contain capture agents comprising CBD. The capture agent concentration is 8 times lower than the CE test format. (C) cellulose pull down full complex (CP-F) where 1-minute pre-incubation for formation of full sandwich complexes is performed before adding to the test zone. The capture agent concentration is 8 times lower than the CE test format. (D) Combination of the CE and CP-H where high molar concentration of capture agents comprising CBD were present at the test zone and half sandwich complexes were allowed to be formed by 1-minute pre-incubation before adding to the test zone. The results show the superior performance of cellulose pull down (CP) assays in accordance with the embodiments disclosed herein as compared to the comparative example. The comparative example is based on a previous concept of employing high molar concentration of capture agents on the cellulose substrate to improve capture efficiency of the target analytes. The high molar concentration of capture agents is allowed to be uniformly immobilised on the cellulose substrate via the CBD of the capture agents. Follow this principle, 2 μL of 20 μM (40 pmol) CBD-tagged capture agent was immobilised onto cellulose paper and antigen detection assay was carried out following standard immunoassay protocol, namely to sequentially add different reagents ((i) analyte, (ii) reporter agent, and (iii) colorimetric signal producing reagent) on to the cellulose substrate (FIG. 8A). Along-side this assay, CP-H and CP-F assays were performed by using 8 times less (5 μmol) CBD-tagged capture agents. For the CPH and CP-F assays, 1 minute incubation time is carried out off-site of the cellulose test zone (half sandwich complex for the CP-H and full sandwich complex for the CP-F) to allow all reagents to interact before applying them to the test zones. Results showed that both CP-H and CP-F produced significantly higher signals than the comparative example (CE) by 8 (FIGS. 8B and E) and 22 times (FIGS. 8C and E), respectively. Additional experiments to combine the method of the comparative example with the CP-H method disclosed herein and it was found that, by allowing for a 1 minute incubation for the formation of half sandwich complexes instead of sequential application, the signal can be improved by 17 times as compared to the signal observed from the CE assays (FIGS. 8D and E).

    [0213] The low concentration of capture agents used in CP-H, CP-F and the hybrid method CP-H+CE is not expected to improve assay sensitivity. However, the results surprisingly indicate that the combination of (i) the reagents pre-incubation and (ii) the capture agents comprising CBD, allows the low concentration of the capture agents to effectively capture the full sandwich complexes and be efficiently pulled down to the cellulose substrate (in CPF). Embodiments of the method disclosed herein advantageously improve assay sensitivity and minimise resource waste i.e. use of capture agents and reporter agents are optimised.

    [0214] In the comparative example, a high concentration of capture agent at 18 μM was required to be deposited on cellulose substrate to ensure efficient capture of analytes-reporter agents complex in sequential matter. Although analytes can typically be captured efficiently and rapidly using high molar concentration of capture agent, without being bound by theory, it is believed that the sequential application of reporter agents in the comparative example hinders the high sensitivity signal production because the reporter agents have short resident time to interact with the analytes on cellulose substrate. As a consequence, low sensitivity of the assay and false negative results are observed since the binding of the analytes and the reporter agents does not happen within seconds.

    Example 2—Cellulose Pull Down of SARS-CoV-2 Nucleocapsid Protein (NP)

    Engineering of Capture Agent (or Cbd Tagged Capture Reagent)

    [0215] rcSso7d binder proteins that bind specifically to SARS-CoV-2 nucleocapsid protein (NP) were engineered using directed evolution approach. In brief, a library comprising theoretically 10.sup.9 variants of rcSso7d was generated. Each variant was cloned into a yeast surface display vector pCTcon2 and transformed into yeast S. cerevisiae. Recombinant SARS-CoV-2 N protein immobilized on magnetic particles were introduced to the rcSso7d yeast library. Yeast clones that bound to magnetic particles were sorted using magnetic stand and cultured to amplify the yeast cell number. His-tagged SARS-CoV-2 N protein was introduced to the yeast cells amplified from magnetic bead sorting. The SARS-CoV-2 N protein was stained using anti-His antibodies conjugated to fluorophore. Yeast cells that bound to SARS-CoV-2 and carried fluorescent antibody were sorted using FACS and cultured to amplify the yeast cell number. FACS sorting were repeated for 5 more rounds, each round with lower concentrations of SARS-CoV-2 N protein. Following 6 rounds of FACS sorting, rcSso7d sequences were sequenced and subcloned into bacterial expressing vector pET28b for protein expression in bacterial cells.

    [0216] The pair of engineered rcSso7d proteins that bind to different epitopes of SARS-CoV-2 N protein were used as capture and reporter reagents for all proof-of-concept studies in this disclosure. The DNA sequence encoding CBD (Table 1) was tagged to the C-terminus of the capture reagent using standard restriction enzyme and ligation methods. In brief, the DNA sequence encoding CBD that contains (i) BamHI restriction enzyme sequence and a 3×GS spacer sequence (GGA GGT GGA GGT TCT GGT GGA GGA GGA TCT GGA GGT GGT GGT TCT) at its N-terminus and (ii) XhoI restriction enzyme sequence at its C-terminus was synthesized by a commercialized service provider and cloned into His-pET28b vector using indicated restriction enzyme sites and T4 ligase (New England BioLabs®, Inc., USA). Cloning of CBD into His-pET28b vector created a His-CBD-pET28b vector template for the subsequent cloning of capture reagent. To tag CBD to capture reagent, the DNA sequence encoding capture reagent that contains (i) NdeI restriction enzyme sequence at its Nterminus and (ii) BamHI at its C-terminus, was amplified (using Phusion high-fidelity DNA polymerases, ThermoFisher Scientific, USA) and cloned into His-CBD-pET28b vector using indicated restriction enzyme sties and T4 ligase. This process created His-rcSso7d.sub.SARS-CoV-2-NPcapture-pET28b vector that will be used to generate the ‘capture reagent’. All restriction enzymes and T4 ligase were obtained from New England BioLabs®, Inc., USA. The procedure for restriction enzyme digestion and ligation were performed as per manufacturer recommendation.

    TABLE-US-00001 TABLE 1 CBD DNA and protein sequences CBD CCGGTATCAGGCAATTTGAAGGTTGAATTCTACAACAGC DNA AATCCTTCAGATACTACTAACTCAATCAATCCTCAGTTC sequence AAGGTTACTAATACCGGAAGCAGTGCAATTGATTTGTCC AAACTCACATTGAGATATTATTATACAGTAGACGGACAG AAAGATCAGACCTTCTGGTGTGACCATGCTGCAATAATC GGCAGTAACGGCAGCTACAACGGAATTACTTCAAATGTA AAAGGAACATTTGTAAAAATGAGTTCCTCAACAAATAAC GCAGACACCTACCTTGAAATAAGCTTTACAGGCGGAACT CTTGAACCGGGTGCACATGTTCAGATACAAGGTAGATTT GCAAAGAATGACTGGAGTAACTATACACAGTCAAATGAC TACTCATTCAAGTCTGCTTCACAGTTTGTTGAATGGGAT CAGGTAACAGCATACTTGAACGGTGTTCTTGTATGGGGT AAAGAACCC CBD PVSGNLKVEFYNSNPSDTTNSINPQFKVTNTGSSAIDLS protein KLTLRYYYTVDGQKDQTFWCDHAAIIGSNGSYNGITSNV sequence KGTFVKMSSSTNNADTYLEISFTGGTLEPGAHVQIQGRF AKNDWSNYTQSNDYSFKSASQFVEWDQVTAYLNGVLVWG KEP

    Engineering of Reporter Reagent (or Analyte Binder or Binding Protein)

    [0217] To allow the reporter reagent to generate colorimetric signal, the reporter reagent was tagged to biotin acceptor (BA) sequence (GGC CTG AAC GAT ATT TTT GAA GCG CAG AAA ATT GAA TGG CAT GAA). In brief, DNA sequence encoding NdeI-BA3×GS_linker-EcoRI was synthesized by a commercialized service provider and cloned into HispET28b vector via NdeI and EcoRI restriction enzyme sites using T4 ligase. This process generated His-BA-pET28b vector. DNA sequence encoding maltose binding protein (MBP) that contains EcoRI sequence at its N-terminus and BamHI at its C-terminus was amplified and cloned into His-BA-pET28b at the indicate restriction enzyme sites using T4 ligase. This process created His-BA-MBP-pET28b vector. To prepare ready-to-used vector template with a spacer protein after MBP, DNA sequence encoding 3×GS_linker with BamHI and SpeI restriction enzyme sequences at its N- and C-terminus was synthesized and cloned into His-BA-MPB-pET28b vector using T4 ligase. Finally, the rcSso7d reporter reagent sequence containing SpeI and XhoI at its N and C terminus was amplified and cloned into the His-BA-MBP-pET28b vector using T4 ligase. This process created His-BA-MBP-rcSso7d.sub.SARS-CoV-2-NP-reporter-pET28b vector which will be used to generate the ‘reporter agent’.

    Expression and Purification of Capture and Reporter Agents

    [0218] In brief, the pET28b plasmids containing capture reagent tagged with CBD or reporter reagent tagged with BA were transformed to BL21-DE3 cells, plated on LB-agar plate containing 50 μg/mL of kanamycin and incubated for 12-18 hr at 37° C. A single colony was selected from each plate and inoculated in 10 mL LB media containing 50 μg/mL of kanamycin at 37° C. on a shaker for 12-18 hr. Cells were passage into a larger volume of 0.5-1 L of LB media containing kanamycin and cultured at 37° C. on a shaker until they reach log phase growth (˜OD of 0.6 at 600 nm). Protein expression was induced using 0.5 mM of Isopropyl β-D-1-thiogalactopyranoside (IPTG). For the reporter reagent 0.3 mM biotin was also supplemented to the culture. The cells were continued to be cultured at 20° C. on a shaker for 16-20 hr.

    [0219] Cells were harvested by centrifugation at 4,000 g for 10 min. The cell pellets were re-suspended in binding buffer (50 mM Tris, 300 mM NaCl, 10 mM imidazole, pH 7.6) at a ratio of 1 g/10 mL and lysed by sonicating at 50% amplitude with 5 s on 10 s off cycles for 5 min. The lysed cells were centrifuged at 20,000 rpm for 30 min to remove cell debris. To purify the proteins (capture/reporter reagents), supernatants were collected and incubated with nickel resin (Nuvia IMAC Resin, BIORAD, USA) at a ratio of 1 mL resin/1 mL culture for 2-3 hr at 4° C. This step allows His-tagged proteins to be captured to the nickel resin, isolating the desired protein from other endogenous background proteins. The supernatant containing nickel resin bound to His tagged proteins was flown through a column where the nickel resin would be trapped in the column and excess liquid would flow pass the column. With this column, the resin was washed twice, each with 10 mL of binding buffer. The proteins were eluted using binding buffer containing 500 mM of imidazole. The eluted proteins were buffer exchanged to phosphate buffer saline (PBS) using Amicon® Ultra Centrifugal Filters (Merck, Singapore).

    Generation and Preparation of the Cellulose Paper-Based Matrix

    [0220] Cellulose paper (Whatman No. 1) was printed with wax ink (Xerox ColorCube, Xerox, USA) to create a 2.5 mm hydrophilic test zone and baked at 150° C. for 1 min. An 11.4 cm×21.6 cm Kimwipes paper (Kimberly-Clark Professional™, Singapore) was folded in half for 4 times and placed underneath the printed cellulose test zone to form an absorbent pad. The cellulose test zone and the absorbent pad were kept in tight contact using 2 binder clips. For all experiments, the test zones were blocked with 10 μL of 5% bovine albumin serum (BSA) (Sigma Aldrich, Singapore) in PBS. All other reagents were prepared in 10% human serum in PBS. CBD tagged rcSso7d SARS-CoV-2 N protein capture reagent and BA tagged rcSso7d SARS-CoV-2 N protein reporter reagent were used in all experiments.

    Paper-Based Colorimetric Assays (FIG. 7)

    [0221] For very short incubation time (SI) test format, 10 μL of each of the following reagents was applied to the test zone sequentially (i) 500 nM capture reagent, (ii) 0 or 50 nM of SARS-CoV-2 N protein, (iii) 500 nM of reporter reagent, (iv) 250 pM of streptavidin horse radish peroxidase (SA-HRP) (Biolegend, USA) and (v) ready-to-use 3,3′,5,5′-Tetramethylbenzidine (TMB) substrate (Sigma Aldrich, Singapore). All reagents were applied soon after the previous reagent was fully absorbed away from the test zone.

    [0222] For the limited incubation time (LI) test format, 10 μL of 500 nM capture reagent was added to the test zone. Subsequently, 10 μL of reagent containing mixture of (i) 0 or 50 nM SARS-CoV-2 N protein, (ii) 500 nM reporter reagent and (iii) 250 pM SA-HRP was incubated for 10 sec at room temperature. Following the incubation, the mixture reagent was applied to the test zone. Finally, 10 μL of TMB was applied to generate colorimetric signal.

    [0223] For half complex cellulose pull-down (CP-H) test format, 10 μL of 500 nM capture reagent was added to the test zone. For the subsequent steps, similar protocol to LI test format was carried out. However longer, 1 min, incubation time was allowed to incubate the mixture reagent before the reagent was added to the test zone. Finally, 10 μL of TMB was added to generate colorimetric signal.

    [0224] For full complex cellulose pull-down (CP-F) test format, 10 μL of mixture reagent containing (i) 500 nM capture reagent, (ii) 0 or 50 nM SARS-CoV-2 N protein, (iii) 500 nM reporter reagent and (iv) 250 pM SA-HRP was incubated at room temperature for 1 min before applying to the test zone. Subsequently, 10 μL of TMB was applied to the test zone to generate visible signals. For all test formats, the cellulose test strips were allowed to develop colorimetric signals for 3 min before images were captured.

    Comparison of the Current Cellulose-Pull Down Assay Performance to a Comparative Example (FIG. 8)

    [0225] To perform the assay in the comparative example (CE), 2 μL of 20 μM capture reagent (40 pmol) was added to the test zone to immobilize high molar concentration of capture reagent. Afterward, sequential application of the following reagents was carried out (i) 10 μL of 0 or 50 nM SARS-CoV-2 NP, (ii) 10 μL of 500 nM reporter reagent, (iii) 10 μL of 250 pM SA-HRP and (iv) 10 μL of TMB. The CP-H and CP-F assays were carried out as described earlier. The combination of CE and CP-H was done by immobilizing the cellulose test zone with 2 μL of 20 μM capture reagent. Subsequently, a mixture of the following reagents was prepared in a 10 μL solution: (i) 0 or 50 nM SARS-CoV-2 N protein, (ii) 500 nM reporter reagent and (iii) 250 pM SAHRP. The mixture was allowed to incubate at room temperature for 1 min before it was applied to the cellulose test zone. Finally, 10 μL of TMB was applied to the test zone to generate colorimetric signal. All tests were allowed to develop colorimetric signals for 3 min before images were captured.

    Image Analysis

    [0226] Images were taken by phone camera or scanner and stored in .jpg format. The color intensities were analyzed using ImageJ software by measuring cyan values in CYMK color format.

    [0227] For all applications described in the examples that follow, cellulose-based vertical flow device was used to host chemical reactions and capture the desire target analytes. The cellulose test strips were constructed by placing one or several layers of the cellulose paper above absorbent pads. Absorbent pads can be any porous materials that possess liquid absorbing properties. The cellulose test paper(s) and the absorbent pads were secured together using pressure applied by various means e.g., paper binders, chamber, cassettes, manifold, etc.

    Example 3—a Rapid Simple Point-of-Care Assay for the Detection of SARS-CoV-2 Neutralizing Antibodies

    [0228] Neutralizing antibodies (NAbs) prevent pathogens/virus from infecting host cells. Determination of SARS-CoV-2 NAbs are critical to evaluate herd immunity and monitor vaccine efficacy against SARS-CoV-2, the virus that causes COVID-19. All currently available NAb tests are lab based and time intensive. A 10 minute cellulose pull-down test to detect NAbs against SARS-CoV-2 from human plasma is described herein. The test evaluates the ability of antibodies to disrupt ACE2 receptor—RBD complex formation. The simple, portable, and rapid testing process relies on two key technologies: (i) the vertical flow paper-based assay format and (ii) the rapid interaction of cellulose binding domain to cellulose paper. This test gives above 80% sensitivity and specificity and up to 93% accuracy as compared to two current lab-based methods using COVID-19 convalescent plasma. Importantly, this approach can be easily extended to test RBD variants or to evaluate NAbs against other pathogens.

    [0229] COVID-19 is the biggest pandemic of the modern era. It affects>200 million people and, to date, has killed>4 million, worldwide. To prevent transmission of SARS-CoV-2—the virus that causes COVID-19—tight restrictions on movement and social interactions have been placed on populations across the globe. While this has had some effect on preventing the spread of the virus, they have plunged the global economy into a severe contraction. A phased relaxation of these social control measures is critical to allow business, and the world economy, to recover.

    [0230] Achieving herd immunity against SARS-CoV-2, either naturally or through vaccination, is the ultimate long-term goal that will allow lifting of the widespread social control measures currently in place. Neutralizing antibodies (NAbs) are generated in response to either exposure to the virus, or to a vaccine. For effective prevention of viral infections, NAbs must be generated in sufficient quantity. Screening populations for the presence of NAbs is a critical step to evaluate herd immunity against SARS-CoV-2, and to assess the effectiveness of vaccine immunization programmes, deployed in many countries since late 2020. To facilitate rapid screening of SARS-CoV-2 NAbs, NAbs detection tests that can be performed simply, rapidly and at low cost are highly desired.

    [0231] Currently, NAbs are generally detected using virus neutralization tests (VNTs). Standard VNTs require handling of live virus (conventional VNT (cVNT)) or pseudovirus (pVNT), BSL3/BSL2 facility, skilled personnel, and 2-4 days processing time, thus making them unsuitable for mass testing the immune status of a population. SARS-CoV-2 initiates the process of host cell entry, by interacting with angiotensin converting enzyme II (ACE2) receptors present on the host cell via the receptor binding domain (RBD) of the spike (S) protein. Based on this observation, a rapid (1-2 h) plate-based ELISA, surrogate SARS-CoV-2 neutralization test (sVNT) has been developed using recombinant hACE2 receptor and viral RBD proteins. NAbs are detected by their ability to bind RBD and block the formation of RBD/hACE2 complexes. Though much more rapid than the standard VNTs, the sVNT still require a laboratory setting and skilled personnel, presenting a barrier to large scale screening.

    [0232] Here, a rapid cellulose pull-down viral neutralization test (cpVNT) that detects SARS-CoV-2 NAbs in plasma samples within 10 minutes and that can be used at the point of care (POC) is described. The test principle relies on the interaction between RBD and ACE2 to determine the presence of NAB. To allow the test to be compatible with cellulose matrix, RBD is fused to the cellulose binding domain (CBD), generating RBD-CBD which is used as a capture reagent. ACE2 is conjugated to biotin (BA), creating ACE2-BA which is capable of interacting with various kinds of reporting molecule via BA—streptavidin (SA) interaction. In this application, SA-horse radish peroxidase (SA-HRP) bound to ACE2-BA (ACE2-BA/SA-HRP) is used as a reporting reagent. Thus, components of the test include: (i) RBD, tagged with cellulose binding domain (CBD), (ii) ACE2 receptor, tagged with biotin (BA) and (iii) streptavidin conjugated horseradish peroxidase (SA-HRP), to detect NAbs binding to the RBD on cellulose paper. Despite the simplified and very rapid testing procedure, the cpVNT exhibits comparable performance to the lab-based tests in determining the level of NAbs in COVID-19 convalescent plasma samples with accuracy well above 80% and 90%, compared to pVNT and sVNT, respectively.

    [0233] Biological fluids including non-diluted or diluted plasma or serum can be used. Briefly, samples may be mixed with capture (RBD-CBD) and reporter (ACE2-BA/SA-HPR) reagents and incubated for at least 5 minutes prior to applying it onto the cellulose test strip. A washing step can be applied to wash away non-specific molecules on the cellulose surface. 3,3′,5,5′-tetramethylbenzidine (TMB) substrate solution may then be applied to generate colorimetric signal. The enzymatic colorimetric reaction can be left developed on the test strip for ˜3 minute before colorimetric signal can be measured.

    [0234] In the absence or low concentrations of NAb, RBD-CBD and ACE2-BA/SA-HRP are able to form complex effectively, therefore high colorimetric signals may be observed on the cellulose test strip. In the presence of high concentration of NAb, the antibodies may compete with ACE2-BA/SA-HRP complex to bind to RBD-CBD, thereby inhibiting colorimetric signals on the test strip.

    [0235] Using this developed assay workflow and construction, the test is able produce well above 80% and 90% test accuracies as compared to the lab-based pseudovirus virus neutralization test (pVNT) and surrogate virus neutralization test (sVNT) (see Results section below for more details).

    Results

    [0236] Optimization of rapid paper-based cpVNT. The assay times for the currently established lab-based and commercialized NAb tests range from 1.5 hours to 4 days. A shortening of the overall assay time and a simplified workflow are primary requirements for POC NAb tests suitable for large-scale surveillance applications. Vertical flow assays are a type of assay formats that allows reagents to flow in a top-to-bottom fashion for detection of biomolecules. Vertical flow assays offer short liquid flow paths that enable rapid and controllable flow speed for handling of liquid reagent. With an aim for POC NAb test, the vertical flow assay format was selected as a test format for this study. Cellulose is a cost-effective material that can be easily manufactured at scale. It has been demonstrated that cellulose can be used as a test matrix for vertical flow assays, whereby the assay reaction is allowed on the cellulose matrix using high affinity interaction between cellulose binding domain (CBD) and the cellulose matrix. The common construction of the assay is to fuse CBD to the capture reagent. Cellulose was adopted as the test materials to bypass the surge of high nitrocellulose demand from global ramp up of rapid COVID-19 tests which presses massive risk onto the supply chain shortage. The test principle relies on a complex formation between RBD/ACE2 receptor whereby presence of NAb interferes with the RBD/ACE2 receptor complex formation, thereby reducing the reporting signal intensity. To enable the test to be compatible to cellulose paper, CBD was tagged to RBD (RBD-CBD), allowing the RBD protein to be captured rapidly and at high affinity onto cellulose surface. ACE2 receptor was engineered to be a reporting molecule. This was done by tagging biotin (BA) on to ACE2, creating ACE2-BA. Horse radish peroxidase (HRP) conjugated streptavidin (SA), SA-HRP, was used as a colorimetric signal generator. A complex of ACE2-BA/SA-HRP was used to generate colorimetric signal via application of 3,3′,5,5′-tetramethylbenzidine (TMB)/H.sub.2O.sub.2 which hydrolyzes HRP, producing vivid blue color signals.

    [0237] To construct the test, recombinant (i) RBD-CBD and (ii) biotin (BA) tagged monoFc-ACE2 receptor proteins were expressed, purified (FIG. 14A) and evaluated for their kinetic properties using bio-layer interferometry (BLI). Various concentrations of RBD-CBD ranging from 6.25 nM-100 nM were used. Data showed specific binding between monoFc-ACE2 and RBD-CBD event at a low concentration of RBD-CBD at 6.25 nM (FIG. 15B). The pair demonstrated high affinity toward each other with a K.sub.D of 12.7 nM (FIG. 14B) which is comparable to previously reported K.sub.D ranging from 4.7-15.2 nM. In contrast, SARS-CoV-2 structural, nucleocapsid (N) protein was tested on ACE2-BA to assess specificity of the protein. BLI data showed minimal interaction of BA-ACE2 with N protein even at 100 nM of N (FIG. 14C), indicating that recombinant BA-ACE2 is highly specific to RBD protein.

    [0238] To engineer the vertical flow assay (FIG. 9), wax ink was printed on to cellulose paper to create hydrophobic boundary and define liquid flow path. Liquid flow rate was controlled by stacking 3 layers of cellulose paper together (FIGS. 9A and D) whereby the top layer has a smaller, 5 mm diameter, of hydrophilic area without wax (testing region) and the lower two layers have larger hydrophilic areas of 6 mm diameters. One unit of cellulose test strip comprises two testing regions for testing of two reactions (FIGS. 9A and B). The distance between the center of the two testing spots is 12.5 mm. (FIGS. 9A, B and D). A folded Kim Wipes paper was used as the absorbent pad (FIGS. 9A and E). An acrylic sheet with 2 mm thickness was cut using a laser cutter (Epilog Fusion Edge Laser System, USA) into two pieces of an acrylic manifold, each with dimension of 30×50 mm.sup.2 (FIGS. 9A, B, C and F). One of the acrylic pieces contains an opening of 25×10 mm.sup.2 (FIGS. 9A and C). The other piece of acrylic was equipped with two pieces of 3 mm thickness acrylic sheets which were used to form spacers for clamping of cellulose test unit (FIGS. 9A, B and F). Three layered cellulose papers were stacked on top of the folded Kim Wipes and secured together using the acrylic manifold and paper binders (FIGS. 9A and B). The 3 mm spacers between the two pieces of the manifold provide consistent pressure between different cellulose test units prepared. The test strip units provided a consistent liquid flow speed of ˜10 sec when 40 μL of liquid were used.

    [0239] To capture the colorimetric signal from the cellulose vertical flow assay, Xiaomi Redmi A9 phone was used to capture the image and save the image in a .jpg format. To fix the camera distance and angle as well as to prevent interference from the surrounding light, a ‘light box’ was created. The box has a W×L×H dimension of 150×230×90 mm (FIG. 9G). A void was made at the top face of the box to provide an access to the phone camera (FIG. 9H). Distance between cellulose test unit to the camera was 85 mm. Fixtures were made to fix locations of the test strip unit and the phone whereby the test strip unit fixture was secured to the base of the light box (FIG. 9I) and the camera fixture was secured to the top face of the light box (FIGS. 9G and H). The internal faces of the box were equipped with warm-white LED light strips (FIG. 9I). To prevent shadows on the cellulose test unit, white, cylindrical shaped papers were constructed to cover the LED strip, thus diffusing light from the LED strips. Example of images captured from the phone camera and the light box are shown in FIG. 14D. Images were analyzed using the open-source ImageJ software from National Institute of Health (NIH), USA. Only the circular areas of the hydrophilic testing regions were used for analysis. To optimize the image analysis, images were separated into different channels in RGB and CYMK color spaces. Comparing gradient color of the blue signals from HRP/TMB generated on different cellulose papers, signals recorded from cyan channel provided the highest signal (RBD-CBD+ACE2-BA/SA-HRP+TMB) over noise (ACE2-BA/SA-HRP+TMB) ratio as compared to other channels in the RGB and CYMK color spaces. Therefore, the intensity of the cyan channel in the CYMK color space was used for image analysis.

    [0240] Different cellulose vertical flow assay formats were performed to determine the most effective assay workflows (FIG. 15). Results showed that application of the reporting complex (ACE2-BA/SA-HRP) onto the pre-immobilized RBD-CBD (group (iv) in FIG. 15) generated only a slight change in cyan signal intensity as compared to control groups (group (i)-(iii) in FIG. 15). It was speculated that the rapid 10 sec. liquid flow speed contributed significantly to the inefficient capture of the reporting complex onto the RBD-CBD and cellulose paper. Significant signal improvement was observed when the reaction was entrapped on the paper for 5 min (group (v) in FIG. 15). Retaining the assay reaction onto the cellulose surface for minutes would complicate the assay workflow and not ideal for POC settings. CBD is known to interact rapidly and effectively to cellulose matrix. Based on this knowledge, the assay was optimized by mixing all reagents in one ‘pre-mix’ solution and incubated for 5 minutes prior to applying the reaction to the cellulose test unit. With this design, the cellulose test unit produced highest cyan signal intensity as compared to other designs (group (vi) in FIG. 15). Based on this observation, the ‘pre-mix’ format is selected for the rapid NAb test and referred to as cellulose pull-down VTN (cpVNT) following the assay principle of the optimized test format. In addition, protein kinetic data from BLI experiment showed that >80% of RBD/ACE2 receptor complex can be formed within 5 min (FIG. 14B), ensuring that most of the RBD/ACE2 complexes were formed with in the incubating period.

    [0241] Based on these optimizations, the assay can be performed by mixing the plasma sample with the reagents and incubating for 5 min to allow efficient formation of RBD-CBD/NAbs or RBD-CBD/ACE2 complexes in aqueous phase before applying it onto the cellulose paper (FIG. 10A). The high affinity vertical flow assay format ensures that most of the RBD-CBD complexes formed are exposed to the paper matrix and effectively captured through the rapid and high affinity interaction of CBD and cellulose. The high affinity of CBD to cellulose ensures a minimal loss of the complex during the washing step.

    [0242] Concentrations of RBD-CBD and ACE2-BA/SA-HRP were further optimized to obtain the highest signal difference between presence and absence of NAb (FIG. 16). To do so, human serum containing 0 or 100 nM NAb were used for signal comparison. Ratio between maximal and minimal cyan intensities obtained from 0 and 100 nM NAb, respectively, were used to calculate the signal ratio. Concentration of ACE2-BA was first optimized using fixed concentrations of 20 nM and 2 nM of RBD-CBD and SA-HRP, respectively. Signals were captured at 3 min following addition of TMB and washing solution. Results showed that 10 nM ACE2-BA produced highest cyan intensity ratio from 0 nM:100 nM NAb (FIGS. 16A and B). Therefore, 10 nM ACE2-BA was selected for subsequent experiments. To optimize for RBD-CBD concentration, ACE2-BA and SA-HRP concentrations were fixed at 10 nM and 2 nM, respectively. Two different concentrations of RBD-CBD at 10 and 20 nM were tested. Results showed that both concentrations produced similar cyan intensity ratio from 0 nM:100 nM NAb which were at ˜2.1. Therefore, different concentrations of NAb were tested to further explore the different cyan intensity signals at various NAb concentrations. This showed that RBD-CBD at 10 nM produced clearer distinguishable cyan intensity signals at lower NAb concentrations (FIGS. 16C and D) and this concentration was selected for further studies. For optimization of SA-HRP, RBD-CBD and ACE2-BA concentrations were fixed at their optimized concentrations of 10 nM. Various concentrations of SA-HRP were tested in serum containing 0 nM or 100 nM of NAb. Results showed that 6 nM SA-HRP produced highest ratio of cyan intensity from 0 nM: 100 nM NAb (FIGS. 16E and F). Therefore, 6 nM SA-HRP was selected for subsequent analysis. Altogether, optimized concentrations of RBD-CBD, ACE2-BA and SA-HRP for cpVNT were 10 nM, 10 nM and 6 nM, respectively.

    [0243] The rapid paper-based cpVNT performance. To validate the cpVNT test, different concentrations of mouse anti hSARS-CoV-2 neutralizing antibodies were spiked into non-diluted human plasma and evaluated for their ability to inhibit RBD-CBD/ACE2 complex formation (FIG. 10A). This approach demonstrated efficient inhibition of RBD-CBD/ACE2 complex formation for a dynamic range of 10-100 nM SARS-CoV-2 NAbs (FIGS. 10B and C). The cpVNT was tested using plasma samples containing non-neutralizing human anti-RBD antibodies produced from the lab. Results showed that only minimal inhibitory signals were observed from these samples even at high concentrations of the non-NAbs (FIGS. 10B and C). These data indicate that the test is highly specific to the SARS-CoV-2 NAbs but not to non-NAbs. The data shows a strong relationship between antibody concentrations and inhibition of complex formation (FIG. 10C) with a limit of detection (LOD), calculated by using ‘mean negative+3SD’ formula, of 10 nM NAbs.

    [0244] Assessments of SARS-CoV-2 immunological profile from COVID-19 convalescent plasma. Prior to validating the cpVNT using clinical samples, general assessments of the clinical samples were performed. Plasma samples from 24 confirmed COVID-19 patients were collected between 29 days and 73 days (median of 49 days) post positive PCR test (follow up visit 1 (FV1)). Subgroups of patient plasma samples were collected on two subsequent occasions (FV2 (n=13); and FV3 (n=10)) (Table 2).

    TABLE-US-00002 TABLE 2 No. days post admission No. of days FV1 of symptoms (Follow before Sample Severity up visit) FV2 FV3 admission Remark P01 Mild 38 7 P02 Moderate 50 6 P04 Mild 29 114 196 14 P06 Mild 30 99 183 8 P07 Severe 36 5 P08 Severe 36 7 P09 Mild 36 3 P10 Mild 35 4 P11 Mild 33 NA Asymptomatic P13 Mild 51 82 194 −9 Symptom started on Day 9 post admission P14 Mild 48 NA Asymptomatic P15 Mild 38 129 192 12 P19 Mild 53 92 192 −3 Symptom started on Day 3 post admission P20 Mild 44 93 191 0 P21 Severe 59 121 213 0 P22 Mild 54 100 199 0 P23 Mild 67 107 190 −7 Symptom started on Day 7 post admission P24 Mild 73 0 P25 Severe 44 0 P30 Mild 51 98 30 P37 Mild 60 101 0 P42 Mild 64 103 196 NA Asymptomatic P45 Mild 50 7 P48 Mild 55 108 −8 Symptom started on Day 8 post admission

    [0245] General assessments were performed, for each convalescent plasma sample, to obtain immunological profiles against SARS-CoV-2 and to determine reference points for cpVNT evaluation. Antibody subtypes IgA, IgM and IgG against SARS-CoV-2's S, RBD, and nucleocapsid (N) proteins were evaluated using ELISA (FIG. 17). IgA and IgM levels against RBD peaked in FV1 in several samples and decline to baseline in FV2 and FV3. IgA and IgM against S and N were found to be low throughout the enrolment period. The minimal levels of IgA and IgM observed in this study are in good agreements with recent studies showing that IgA and IgM against RBD and N peaked at 14-20 days post symptom onset and started to wane after ˜20 days. Plasma samples collected for this study began on day 29 post admission in which IgA and IgM are expected to be low or declining. IgG levels were found to be higher than IgA and IgM (FIG. 17). No statistical difference in IgG levels against all three SARS-CoV-2 biomarkers were observed from FV1 and FV2 (FIG. 18). Significant reduction of 15%-25% in IgG levels against all biomarkers were seen in FV3 as compared to FV2 (FIG. 18). These findings suggest that IgG levels against S, RBD and N proteins were maintained at high level for around 4 months post admission and started to decline slowly after 5-6 month.

    [0246] To determine the levels of NAbs present in different plasma samples, two lab-based VNTs were used (i) chemiluminescent-based pseudovirus VNT (pVNT) and (ii) a modified format of the published ELISA-based surrogate VNT (sVNT) (Tan, C. W. et al. A SARS-CoV-2 surrogate virus neutralization test based on antibody-mediated blockage of ACE2-spike protein-protein interaction. Nat. Biotechnol. 38, 1073-1078 (2020)). The established pVNT protocols (Jahrsdörfer, B. et al. Characterization of the SARS-CoV-2 Neutralization Potential of COVID-19-Convalescent Donors. J. Immunol. 206, 2614-2622 (2021) and Nie, J. et al. Quantification of SARS-CoV-2 neutralizing antibody by a pseudotyped virus-based assay. Nat. Protoc. 15, 3699-3715 (2020)) were used as references for pVNT performed in this study. pVNT determined NAb status by measuring chemiluminescent signals from cells infected with pseudovirus. Presence of NAbs prevent virus from infecting the cells thereby reducing chemiluminescent signals. Based on the reference studies, a wide range of sample dilution factors from 1-10.sup.6 were used to determine the effective cut-off between presence and absence of NAb. A 50% signal inhibition was indicated as an effective value to distinguish between presence and absence of NAb. During the test optimization, it was found that, a dilution factor of at least 1:80 is necessary to minimize false positives produced by healthy control samples, therefore a fix 1:80 dilution factor is used in this study. The chemiluminescent signals measured were normalized with the signals from non-infected and pseudovirus infected cells. The status of NAbs was expressed as neutralization percentage.

    [0247] For sVNT, while it retains the same test principles as the published method, the modified sVNT configuration used recombinant RBD protein as a capture reagent and ACE2 receptor conjugated with HRP as a reporter reagent. In this test format, the presence of NAbs causes signal reduction that can be expressed as inhibitory percentages. The higher percentages represent higher level of NAbs and vice versa. 10×dilution were chosen as the lowest dilution factors that give reliable results without showing false positives from healthy control samples. The cut-off value for sVNT was determined by analyzing the test sensitivity and specificity using known concentrations of NAbs and non-NAbs spiked in plasma samples (FIG. 19). Receive Operating Characteristic (ROC) curve showed that the test maintained a high sensitivity of 75% while achieving a high specificity of 100% at the inhibitory percentage of ˜20%, therefore 20% inhibition is used as a cut-off value to distinguish positive from negative NAb status. Using this cut-off, the sVNT is sensitive to detect RBD-specific neutralizing antibodies at a concentration of 313 ng/mL (2 nM), much lower than the average concentration of these antibodies in COVID-19 convalescent patients.

    [0248] Data obtained from pVNT and sVNT are shown in FIGS. 11A, B, D and E. The pVNT and sVNT exhibit a high Pearson correlation coefficient of 0.8 (FIGS. 11C and F), indicating that both tests produced results that are in good concordance. In addition, it was observed that NAb status is highly correlated to IgG levels against S and RBD with Pearson coefficients of 0.72 and 0.74, respectively (FIGS. 20A and B) and moderately correlated with IgG level against N with a Pearson coefficient of 0.59 (FIG. 20C). No clear correlation is observed between NAb status and disease severity in the study (FIG. 20D), in line with the recent observation reported by a study.

    [0249] pVNT presents a test format that is closely related to events that occur in a physiological condition. Therefore, pVNT will be used as a baseline to determine the accuracy of sVNT. Using the defined 50% cut-off for pVNT and 20% cut-off for sVNT, the sVNT provides test sensitivity and specificity of 90.0% and 86.5%, respectively with an overall accuracy of 87.2% (with 95% CI of 74.3% to 95.2%) (Table 3).

    TABLE-US-00003 TABLE 3 Statistic Value 95% CI Sensitivity 90.0% 55.5% to 99.8% Specificity 86.5% 71.2% to 95.5% Positive Predictive Value* 64.3% 43.7% to 80.7% Negative Predictive Value* 97.0% 83.2% to 99.5% Accuracy* 87.2% 74.3% to 95.2%

    [0250] It is also observed that most samples showed negative NAb status (FIG. 11). Majority of the positive NAbs detected came from FV1 samples in both test formats.

    [0251] Evaluating of cpVNT performance using COVID-19 convalescent plasma. To evaluate the ability of the cpVNT in determining the level of NAbs, results obtaining from cpVNT using COVID-19 convalescent plasma, from different visits, were plotted against the pre-COVID plasma samples collected from earlier studies. Based on these data, the inhibitory signal cut-off which distinguished positive from negative NAbs levels was determined at 20% (FIG. 12A). Negative inhibitory percentages were observed from some data points. The negative values were due to the higher cyan intensity signals as compared to the reference point calculated from mean value of pre-COVID and non-infected samples. In the context of cpVNT, it can be interpreted that no NAbs were detected from these samples. In a similar fashion to pVNT and sVNT (FIG. 11), results from cpVNT showed that most of the COVID-19 convalescent samples exhibit negative NAb status with positive status observed mostly from FV1 (FIGS. 12B and C). An average value of NAbs from FV1 falls between the designated cut-off value and average values from FV2 and 3 fall below the cut-off value. Similar trends were also observed from pVNT and sVNT (FIGS. 11B and E).

    [0252] Data obtained from cpVNT show a high correlation with pVNT and sVNT with Pearson correlation coefficients of 0.70 and 0.87, respectively, (FIGS. 12D and E and FIGS. 21A and B). As compared to pVNT, cpVNT exhibits the test sensitivity and specificity of 80.0% and 84.4%, respectively with an overall test accuracy of 83.3% (with 95% CI of 68.6% to 93.0%, Table 4).

    TABLE-US-00004 TABLE 4 Statistic Value 95% CI Sensitivity 80.0% 44.4% to 97.5% Specificity 84.4% 67.2% to 94.7% Positive Predictive Value* 61.5% 40.31% to 79.1%  Negative Predictive Value* 93.1% 79.5% to 97.9% Accuracy* 83.3% 68.6% to 93.0%

    [0253] As compared to sVNT, cpVNT exhibits a sensitivity and specificity of 85.71% and 96.55%, respectively, with an overall test accuracy of 93.02% (with 95% CI of 74.37% to 96.02%, Table 5).

    TABLE-US-00005 TABLE 5 Statistic Value 95% CI Sensitivity 85.7% 57.2% to 98.2% Specificity 96.6% 82.2% to 99.9% Positive Predictive Value* 92.3% 63.4% to 98.8% Negative Predictive Value* 93.3% 79.5% to 98.1% Accuracy* 93.0% 80.9% to 98.5% *These values depend on the prevalence of the disease. The prevalence is calculated from the sample size. It may not reflect the real disease prevalence.

    [0254] Cross reactivity tests were performed to ensure the test specificity. High concentrations (100 nM) of IgG against different viruses were spiked in plasma from healthy controls and tested on cpVNT. Data show minimal cross reactivity to antibodies against other viruses, or to SARS-CoV-2 S and N proteins (FIG. 12F), which possess non-neutralizing ability, suggesting that cpVNT is highly specific to SARS-CoV-2 NAbs. cpVNT specificity is comparable to the commercialized lab-based sVNT. In addition to plasma, the cpVNT was also tested using human serum samples. Results showed dose response curves that are comparable to the plasma samples (FIG. 22 and FIG. 10C) with an improved LOD of 5 nM, compared to 10 nM in plasma.

    [0255] Altogether, the cpVNT offers a rapid test, that can be performed in ten minutes, for reliable detection of NAbs against SARS-CoV-2. Accuracy of cpVNT, compared to the lab-based methods are well above 80% and 90%, for pVNT and sVNT. The test can be performed both in plasma and serum samples without dilution, therefore facilitating simple workflow at POC settings.

    [0256] Unlike other report which predicted that high level of NAb could be detected from convalescent samples, most of the convalescent samples collected for this study showed relatively low NAb level from all three VNT formats tested. The plasma samples collected for this study begun at ˜1 month post admission. Samples containing NAb came mostly from FV1. pVNT, sVNT and cpVNT detected 10, 9 and 9 NAb positive samples, which accounted for 41.7%, 37.5% and 47.4%, of the sample size, respectively. pVNT showed 1 and 0 positive samples in FV2 and 3, whereas sVNT and cpVNT, each, showed 2 positive NAbs samples in FV2 and 2 in FV3. Only 3 patients which showed positive NAb status in FV1 completed all 3 visits. Although a trend of reduction in NAbs is observed in these 3 samples, the sample sizes are too small to observe statistical differences in all test formats. Aligning with the findings, a study reported that a substantial number of convalescent samples did not produce sufficient NAb to be detected using sVNT. In addition, a large subgroup of convalescent population showed rapid waning of NAb at 2-month post symptom onset, a timeline in which majority of samples were collected for this study.

    Discussion

    [0257] Global efforts are underway to improve SARS-CoV-2 surveillance and manage long term prevention of COVID-19. Assessment of SARS-CoV-2 NAbs is one of the key surveillance criteria required to evaluate herd immunity and the impact of SARS-CoV-2 on a larger population scale. Existing technologies for NAb detection (cVNT, pVNT and sVNT) all require laboratory facilities, skilled personnel and long execution times (1 hr-4 days) that are not favorable for large-scale surveillance outside a laboratory setting. cpVNT provides a robust NAb surveillance detection test, that is simple, rapid and can be easily conducted both inside and outside of laboratory settings in as little as 10 minutes. In addition to the cpVNT performance evaluated in this study, it is now feasible to compare its performance to the commercialized sVNT, c-Pass™ from GenScript®.

    [0258] SARS-CoV-2 vaccination programmes have been rolled out in many countries, since late 2020, initially providing vaccines to healthcare frontline workers and members of high-risk communities. A serological neutralizing antibody test is a valuable companion test to evaluate the effectiveness of available vaccines. Data from different VNT formats obtained from this study suggested that ˜37-48% of the samples showed positive NAb status in the first 1-2 months (FV1), post admission. The number declined to ˜7-15% in the subsequent visits. However, due to the small sample size of follow up visits, no statistical difference was observed from different visits. Nonetheless, findings from other studies demonstrated that NAbs declined gradually over 3-month period post symptom onsets, therefore suggesting that vaccine boosters may be required to maintain the immunity status at a desirable level. The rapid neutralization test described here would be a suitable tool to regularly assess the immune status of individuals, particularly in the vulnerable population. The simple nature and speed of this test provides an accessible POC tool, which can be used at community clinics or in low resource settings, to prioritize vaccine administration. In addition, the test can be rapidly adapted to evaluate the efficiency of NAbs to new virus variants and thereby guide the decision-making process in relation to the need of new booster vaccines.

    [0259] Despite a number of lateral flow assay (LFA) tests available for detection of antibodies against SARS-CoV-2, to knowledge, only one pre-print report is found for rapid NAbs test. In most LFA antibody detection tests (rapid serology tests), specific antigens are either immobilized on the testing matrix or used as reporting molecules whereas the counter reporting/capturing part are anti-IgA/IgM/IgG antibodies. It was reported that, when RBD and anti-IgA/IgM/IgG antibodies are used for detection of NAbs in the plate-based ELISA format, non-NAbs are often detected along with NAbs (due to antibodies that bind to RBD but do not possess neutralizing ability). This method is thus unable to predict the level of NAbs accurately. Adapting a NAbs test to a LFA format seems feasible due to the well-established LFA technology. However, with the test format employed for the cpVNT and sVNT reported in this study, it would be challenging for LFA to report a loss of a colorimetric signal as a positive result, particularly when anti-IgA/IgM/IgG were to use as reporting molecules. ˜15-20 incubation time is required for LFA, thus allowing substantial amount of time for non-specific binding to occur at the test line on the LFA test strip. To overcome this issue, a suitable control system would have to be designed to ensure that a positive colorimetric signal generated (i.e., lack or low level of NAb) is not due to non-specific binding.

    [0260] The rapid cpVNT neutralization test developed in this study identifies and measures the very specific interaction between RBD and ACE2 receptor. Non-NAbs will not interfere with the RBD/ACE2 receptor complex formation and the signal detected is specific to neutralizing antibodies (FIGS. 10B-C and 12F). In addition, unlike the LFA format that requires 15-20 min incubation time, the cpVNT developed in this study requires only 5 min interaction time between NAb/RBD or ACE2/RBD, thus providing minimal time for non-specific interactions and only high affinity interactions were anticipated to be captured on the cellulose surface.

    [0261] The sudden high demand for LFA COVID-19 rapid diagnostic tests has created a worldwide shortage of materials required for LFAs, particularly the nitrocellulose membrane, leading to supply chain issues. The cpVNT presented in this study utilizes cellulose membrane which is more economical to produce and supply chains are unimpeded. In addition, cellulose paper can be easily manufactured, enabling large-scale production of the test strips in a very short period, thereby facilitating mass manufacture of the test with low production cost.

    [0262] Plasma/serum is currently optimized for cpVNT. As such, a device capable of separating plasma from whole blood is needed for the POCT applications. Different aspects of test stability are currently being investigated. Based on the preliminary data, with the right preservatives and additives the cellulose test paper can last up to 6 months when kept at ambient temperature (25° C.) without controlling of humidity. The test papers last up to 3 years in a desiccator. RBD-CBD and ACE2-BA retain their activities for at least 3 months when kept in optimized conditions. In the POC settings, a test strip may comprise one ‘Test’ spot and one ‘Control’ spot, whereby the control spot hosts a chemical reaction that indicates active function of the reagents. It is critical for the test to have a control spot because the positive result is derived from loss of colorimetric signal. The control spot ensures that the loss of signal at the test is due to binding of NAb to RBD-CBD and not the malfunction of the chemistry reaction. The optimization of the control spot was started and it was found that immobilizing of RBD-CBD at high concentrations on the cellulose paper could potentially serve as a control spot reaction to capture ACE2 tagged to reporting molecules from the assay mixture. The preliminary data showed that this design of control spot produced high cyan intensity signals regardless of presence or absence of NAb in the samples. For signal analysis of cpVNT, a pre-set cyan intensity value could be pre-determined from pre-COVID or non-infected samples during the assay optimization stage. This value can be implemented for the POC applications in which the pre-determined cyan intensity value defines a reference signal for analysis of the cpVNT test results.

    [0263] In conclusion, a rapid, paper-based cpVNT that can be used at POC for effective identification of neutralizing antibodies against COVID19 is developed. Comparison of cpVNT against the existing VNTs, including, the pVNT and the sVNT (FIG. 12 and FIG. 23) shows that cpVNT offers a highly competitive solution as compared to existing technologies, including the very rapid execution time (10 min) and ease of operation (no need for laboratory facilities and does not require skilled operators). This represents a significant advance in tackling the pandemic and has far reaching applications.

    Materials and Methods

    [0264] Materials. Materials were purchased from the following sources, mouse anti-SARS-CoV-2 NAb (cat #40591-MM43-100), monoclonal mouse anti Influenza A H10 Hemagglutinin/HA NAb (cat #40359-M001), monoclonal mouse anti Influenza A Nucleoprotein IgG (cat #11675-MMO3T) and polyclonal rabbit anti SARS-CoV-2 nucleocapsid protein IgG (cat #40588-T62) from Sino Biological, USA; monoclonal rabbit anti MERS Coronavirus Spike protein NAb (cat #MA5-29975) and polyclonal rabbit anti Dengue Virus Type 2 NS3 protein IgG (cat #PA5-32199) from Invitrogen, USA; polyclonal rabbit anti Zika virus NS5 protein IgG (cat #GTX133312), polyclonal rabbit anti Zika virus NS3 protein IgG (cat #GTX133309), monoclonal mouse anti Dengue virus envelope protein IgG (cat #GTX629117) and monoclonal mouse anti SARS-CoV-2 spike protein IgG (cat #GTX632604) from GeneTex, USA. Other chemicals were of analytical grades from Merck, Singapore, otherwise stated.

    [0265] Collection of clinical samples. Collection of COVID-19 convalescent samples were reviewed and approved under the DSRB reference #2020/00120, National University of Singapore (NUS). Peripheral blood was collected in EDTA blood tubes and subsequently diluted with an equal amount of sterile PBS. This was then gently layered on top of 13 mL Ficoll-Plaque density gradient media (GE Healthcare) in a 50 mL Falcon tube. The tube was centrifuged at 2400 rpm for 30 min with acceleration and deceleration set at 0. Plasma was harvested from the top layer and stored at −80° C. Buffy coat layer was washed with sterile PBS at 2000 rpm for 6 min followed by another wash at 1500 rpm for 5 min. Peripheral blood mononuclear cells (PBMNC) were harvested, resuspended in freezing media containing 90% FBS (Hyclone)+10% dimethyl sulfoxide (Sigma Aldrich), and stored in liquid nitrogen.

    [0266] Collection of pre-COVID samples were reviewed and approved by Institutional Review Board of Nanyang Technological University, Singapore (IRB 003/2010, IRB 11/08/03, IRB 13/09/01, IRB-2016-01-045 and IRB-2020-11-047). The whole blood was donated by healthy adult volunteers at the National University Hospital, Singapore. Informed consents were obtained from all donors in accordance with the approved protocols. Whole blood samples collected were centrifuged at 2000 rpm for 10 min. Plasma was collected and stored at −80° C. until used.

    [0267] Isolation and cloning of SARS-CoV-2 Spike RBD-specific human antibodies. Memory B cells were isolated from PBMNC derived from blood samples drawn from COVID-19 convalescent patients using a Human Memory B cell isolation kit (Miltenyi Biotec, #130-093-546). Small pools of purified Memory B cells were seeded into 384-well plates on irradiated CD40L-expressing feeder cells for differentiation into plasma cells as described previously (Liebig, T. M., Fiedler, A., Zoghi, S., Shimabukuro-vornhagen, A. & Bergwelt-baildon, M. S. Von. Generation of Human CD40-activated B cells. J. Vis. Exp. 1373 (2009). doi:10.3791/1373). After 7 days of culture, supernatants from B cell pools were screened for binding activity on SARS-CoV-2 Spike by ELISA. Antibody Heavy and Light Chain variable regions were cloned from positive wells by PCR (Collibri™ Stranded RNA Library Prep Kit for Illumina™ Systems) and whole human IgG reconstructed as described previously (Gu, Y. et al. Defining the structural basis for human alloantibody binding to human leukocyte antigen allele HLA-A*11:01. Nat. Commun. 10, 893 (2019)). Confirmation of binding specificity of cloned human monoclonal antibodies was confirmed by ELISA.

    [0268] Protein Expression and Purification. The soluble extracellular fragment of human ACE2 (residues 19-615; GenBank: AB046569.1) was cloned into a modified pHLSec (Aricescu, A. R., Lu, W. & Jones, E. Y. A time- and cost-efficient system for high-level protein production in mammalian cells. Acta Crystallogr. D Biol. Crystallogr. 62, 1243-50 (2006)) mammalian expression vector following an N-terminal monoFc, hexahistidine tag and Tobacco Etch Virus (TEV) protease cleavages site. SARS-CoV2-Spike RBD (Dalvie, N. C. et al. Engineered SARS-CoV-2 receptor binding domain improves immunogenicity in mice and elicits protective immunity in hamsters. bioRxiv 2021.03.03.433558 (2021)) fused to CBD (residues 276-434 of Hungateiclostridium thermocellum CipA) was cloned into the pHLmMBP-10 vector (Bokhove, M. et al. Easy mammalian expression and crystallography of maltose-binding protein-fused human proteins. J. Struct. Biol. 194, 1-7 (2016)) (a gift of Luca Jovine; Addgene plasmid 72348) which encodes an N-terminal octahistidine tag, codon-optimized maltose-binding protein (MBP) tag and a TEV site. The coding sequence for the single-chain variable fragment (scFv) of the anti-SARS-CoV CR3022 (Meulen, J. et al. Human monoclonal antibody combination against SARS coronavirus: Synergy and coverage of escape mutants. PLoS Med. 3, e237 (2006)), and was subcloned into pHLmMBP-10 to generate an MBP-scFv fusion construct. Verified plasmids were transfected into Expi293F cells by using the Expifectamine293 transfection kit (ThermoFisher Scientific, #A1435101) to express the secreted proteins following the supplier's standard protocol. Cells were harvested by centrifugation after 6 days of transfection and the supernatants were collected for protein purification. The media were conditioned for Ni-NTA binding by adding 2.5 mL of conditioning buffer, 200 mM HEPES pH 7.5, 3 M NaCl and 10% glycerol; 104 mammalian protease inhibitor cocktail (Nacalai Tesque, #25955-11) per 50 mL media. Proteins were first purified by affinity chromatography using Ni-NTA cartridges (Qiagen, #1046323), followed by size exclusion chromatography by using HiLoad 16/60 Sephadex 200 (Cytiva, formerly GE Healthcare) in gel filtration buffer (20 mM HEPES pH 7.5, 300 mM NaCl, 10% glycerol). To avoid protein crosslinking and aggregation, pooled fractions were supplemented with 0.5 mM TCEP before being concentrated by using Vivaspin centrifugal concentrators (Cytiva). The His-MBP tag of sRBD-CBD was cleaved off by using TEV protease (a gift of NTU Protein Production Platform, proteins.sbs.ntu.edu.sg) at 4° C. overnight with 1:40 mass ratio. Untagged sRBD-CBD was separated from His-tagged proteins by passing the reaction mixture through HisPur-Ni-NTA resin (Thermo Scientific, #88222) pre-equilibrated in 20 mM HEPES pH 7.5, 300 mM NaCl, 10 mM Imidazole. The purified sRBD-CBD sample was buffer exchanged and concentrated in 20 HEPES pH 7.5, 300 mM NaCl, 10% glycerol and 0.5 mM TCEP for storage.

    [0269] SARS-CoV-2 N protein (residues 1-419; GenBank: YP_009724397.2) was synthesized by Genewiz (USA) and cloned into pET28b(+) bacterial expression vector following a hexahistidine tag and a thrombin cleavage site. Constructed plasmid was transformed into BL21 (DE3) competent cell for protein expression, briefly, culture in LB broth miller (1.sup.st Base, #BIO-4000-1 kg) supplemented kanamycin (GOLDBIO, #K-120-25) was allowed to grow till OD.sub.600 of 0.8 prior it was induced using IPTG (isopropyl β-D-1-thiogalactopyranoside) at final concentration of 0.5 mM for overnight at 16° C. Bacterial cell pellet was then lysed in lysis buffer (20 mM Tris-HCl pH 7.9, 500 mM NaCl) supplemented with protease inhibitor cocktail (Nacalai Tesque, #04080-11) by sonication. Soluble portion was collected and incubated with HisPur-Ni-NTA resin for metal affinity purification. Size exclusion chromatography with HiLoad 16/60 Superdex 75 was carried out for final purification of SARS-CoV-2 N protein with gel filtration buffer (1×PBS pH7.9). Collected protein fractions were pooled and concentrated with Vivaspin centrifugal concentrators prior storage at −80° C.

    [0270] Biotinylation of monoFc-ACE2. Chemical biotinylation of monoFc-ACE2 was carried out by using EZ-link Sulfo-NHS-LC-Biotinylation kit (ThermoFisher, #21435). Protein was incubated with 20 molar excess of Sulfo-NHS-LC biotin at 4° C. for 2 hrs. The level of biotinylation was measured by HABA assay provided from the kit.

    [0271] Antibody Profiling by ELISA. SARS-CoV-2 Spike protein, MBP-RBD protein, or nucleocapsid protein was coated on 96-well flat-bottom maxi-binding immunoplate (SPL Life Sciences, #32296) at 7.5 nM, 27 nM, or 40 nM respectively, 100 μL/well at 4° C. overnight. Plate was washed three times in PBS and blocked for 2 hours with blocking buffer: 4% skim milk in PBS with 0.05% Tween 20 (PBST) at 350 μL/well. After three washes in PBST, 100 μL of 80 times diluted plasma samples were added to each well for 1 hour incubation. Plate was then washed three times in PBST and 100 μL of 5000 times diluted goat anti-human IgG-HRP (Invitrogen, #31413), or 5000 times diluted F(ab′)2 anti-human IgA-HRP (Invitrogen, #A24458), or 7500 times diluted goat anti-human IgM-HRP (Invitrogen, #31415) was added to each well for 1 hour incubation protected from light. After three times of plate wash in PBST, 100 μL of 1-Step Ultra TMB-ELISA (Thermo Scientific, #34029) was added to each well. After 3 min incubation in dark, reaction was stopped with 100 μL of 1 M H.sub.2SO.sub.4 and OD.sub.450 was measured using microplate reader (Tecan Sunrise). OD.sub.450 reported was calculated by subtracting the background signal from plasma binding to the blocking buffer.

    [0272] Bio-layer Interferometry (BLI). The N-terminally biotinylated monoFc-ACE2 interaction with RBD-CBD was measured on an 8-channel Octet RED96e system (Forte Bio) with streptavidin biosensor tips (Sartorius). These tips were pre-incubated with assay buffer: PBS, 0.2% BSA and 0.05% Tween 20 for 10 min at 25° C. Then, they were coated with biotinylated mFc-ACE2 to yield a loading thickness of 0.9 nm. After washing the tips with assay buffer, the binding with RBD-CBD was measured in real time by recording the increase in optical thickness of the tips during 600s of association phase. The tips were transfer back into assay buffer during dissociation phase. A two-fold dilution series of RBD-CBD ranging from 6.25 to 100 nM was used. For negative control, the concentration of N-protein was kept at 100 nM for comparison with highest concentration of RBD-CBD. The data was processed by Octet Data Analysis software then transferred into GraphPad Prism 9 for association-dissociation non-linear regression model curve-fitting.

    [0273] SARS-CoV2 pseudotyped lentivirus production. A third-generation lentivirus system, was used to produce pseduotyped viral particles expressing SARS-CoV2 S proteins via reverse transfection. 36×10.sup.6 HEK293T cells were transfected with 27 μg pMDLg/pRRE (Addgene, #12251), 13.5 μg pRSV-Rev (Addgene, #12253), 27 μg pTT5LnX-WHCoV-St19 (SARS-CoV2 Spike) and 54 μg pHIV-Luc-ZsGreen (Addgene, #39196) using Lipofectamine 3000 transfection reagent (Invitrogen, #L3000-150) and cultured in a 37° C., 5% CO.sub.2 incubator for 3 days. The viral supernatant was then, harvested and filtered through a 0.45 μm filter unit (Merck). The filtered pseudovirus supernatant was concentrated using 40% PEG 6000 by centrifugation at 1600 g for 60 minutes at 4° C. Lenti-X p24 rapid titer kit (Takara Bio, #632200) was used to quantify the viral titres, as per manufacturer's protocol.

    [0274] Pseudovirus neutralization assay (pVNT). The ACE2 stably expressed CHO cells were seeded at a density of 5×10.sup.4 cells in 1004 of complete medium [DMEM/high glucose with sodium pyruvate (Gibco, #10569010), supplemented with 10% FBS (Hyclone, #SV301160.03), 10% MEM Non-essential amino acids (Gibco, #1110050), 10% geneticin (Gibco, #10131035) and 10% penicillin/streptomycin (Gibco, #15400054)] in 96-well white flat-clear bottom plates (Corning, #353377). Cells were cultured in 37° C. with humidified atmosphere at 5% CO.sub.2 for one day. Patient plasma samples were diluted to a final dilution factor of 80 with PBS. The pseudovirus is diluted to a final concentration of 2×10.sup.6 PFU/ml. In 25 μl there will be 50,000 lentiviral particles. The diluted samples were incubated with an equal volume of pseudovirus to achieve a total volume of 50 μL, at 37° C. for 1 h. The pseudovirus-plasma mixture was added to the CHO-ACE2 monolayer cells and left incubated for 1 h to allow pseudotyped viral infection. Subsequently, 150 μL of complete medium was added to each well for a further incubation of 48 h. The cells were washed twice with sterile PBS. 100 μL of ONE-Glo™ EX luciferase assay reagent (Promega, #E8130) was added to each well and the luminescence values were read on the Tecan Spark 100M. The percentage neutralization was calculated as follows:

    [00005] Neutralization % = Readout ( unknown ) - Readout ( infected control ) Readout ( uninfected control ) - Readout ( infected control ) * 1 0 0 %

    [0275] Modified ELISA-based sVNT. ACE2-Fc was conjugated to peroxidase using Peroxidase Labeling Kit—NH.sub.2 (Abnova, #KA0014) according to manufacturer's protocol. Each well of 96-well flat-bottom maxi-binding immunoplate was coated with 100 μL of 13 nM MBP-RBD at 4° C. overnight. Plate was washed and blocked as described above. Plate was washed three times in PBST and incubated for 1 h with 100 μL/well of plasma samples diluted ten times in blocking buffer. No inhibitor control wells were incubated with blocking buffer. Positive and negative control wells were established by incubating with functionally characterized recombinant monoclonal antibodies targeting SARS-CoV-2 RBD. A characterized neutralizer was included as the positive control and a non-neutralizing binder was included as the negative control. Both monoclonal antibodies were tested at concentrations from 64 nM to 0.5 nM, prepared via 2×serial dilution in the blocking buffer. Subsequently, plate was washed three times and incubated for 1 hour with 0.4 nM ACE2-Fc-peroxidase, 100 μL/well, protected from light. The following steps of color development and absorbance measurement were performed as described above. Inhibition % was calculated as

    [00006] Inhibition % = ( OD 450 of negative control ( no inhibition ) - OD 450 of sample OD 450 of negative control ( no inhibition ) ) * 100 %

    [0276] cpVNT assay. Cellulose test strips were prepared using Whatman No. 1 chromatography paper (GE healthcare, #3001-861). The papers were printed with wax-ink printer (Xerox ColorQube 8570, Xerox, USA) to define liquid flow path and testing region. The non-testing regions were printed with the wax ink whereas the testing region were left unprinted. Circular testing region with diameters of 5 mm and 6 mm were prepared. The printed papers were baked at 150° C. for 1 min to allow the wax ink to diffuse through the paper forming hydrophobic boundary throughout the paper thickness. The wax-free testing regions were blocked with 10 μL of 5% BSA in PBS. After air-drying, the test strips were stacking into 3 layers with the 5 mm strips on the topmost layers and 6 mm strips on the second and third layers. The three layered of wax printed paper allows consistent flow of liquid at ˜10 sec when 40 μL of liquid are applied. One piece of Kimwipes paper (11.4 cm×21.6 cm, Kimberly-Clark Professional, #34155) folded in half for 6 times was used as absorbent pad. The three-layered test strips were stacked on top of the folded Kimwipes. All layers were secured together using two paper binders.

    [0277] nM RBD-CBD in 1% BSA in PBS was prepared and assigned as reagent “A”. 10 nM biotinylated monoFc-ACE2 with 6 nM SA-HRP (Biolegend, #405210) in 1% BSA in PBS was prepared and assigned as reagent “B”. To perform the test, one part of reagent A and one part of reagent B were mixed with two parts of plasma samples, i.e., for one reaction, the mixture contains 10 μL of A, 10 μL of B and 20 μL of sample. The mixture was incubated for 5 minutes at room temperature. 40 μL of the mixture was applied to the testing region. Once sample was fully absorbed the test was washed once with 40 μL of PBS, followed by 40 μL of TMB/H.sub.2O.sub.2 solution (Merck, #T0440). Signals were allowed to develop for 3 min. Images were taken using Xiaomi Redmi A9 phone in a light box equipped with LED lights and save as .jpg format. Images were transferred to a PC. and analyzed using the opened source ImageJ software from NIH. Images were converted from RGB color space to CMYK. Cyan intensity in the testing regions were analyzed. Inhibition % was calculated using the following formula:

    [00007] Inhibition % = ( 1 - Cyan intensity of sample Cyan intensity of negative control ( no NAb ) ) * 100 %

    [0278] Pearson's correlation Pearson's correlation coefficiency was calculated using Microsoft Excel function PEARSON.

    [0279] Calculation of test performance. Disease prevalence was calculated from the sample size. It may not represent the true prevalence. Calculations of each parameter of test performance were done using the following formula:

    [00008] Sensitivity = True positive True positive + False Negative Specificity = True negative False positive + True negative Positive predictive value ( PPV ) = S e n s i t i v i t y * p r e v a l e n c e ( ( s e n s i t i v i t y * p r e v a l e n c e ) ) + ( ( 1 - s p e c i v i c i t y ) * ( 1 - p r e v a l e n c e ) ) Negative predictive value ( NPV ) = S p e c i f i c i t y * ( 1 - p r e v a l e n c e ) ( ( 1 - s e n s i t i v i t y ) * p r e v a l e n c e ) ) + ( ( s p e c i f i c i t y * ( 1 - p r e v a l e n c e ) ) Accuracy = ( Sensitivity * Prevalence ) + ( Specificity * ( 1 - Prevalence ) )

    Example 4—an Antibody-Free Cellulose-Based Vertical Flow Assay for COVID-19 Surveillance

    [0280] At the end of 2019, emergence of an unusual pneumonia in Wuhan, Hubei province, China was reported. It was later discovered to be caused by infection with the virus SARS-CoV-2 (Severe Acute Respiratory Syndrome Coronavirus-2), which led to the COVID-19 pandemic. COVID-19 is the largest pandemic in the modern era. It has affected more than 200 million people and claimed more than 4 million lives worldwide. Though the fatality rate of SARS-CoV-2 infection is lower than its relatives, SARS-CoV (Severe Acute Respiratory Syndrome Coronavirus) and MERS-CoV (Middle East Respiratory Syndrome Coronavirus), it has high infectivity and transmissibility. Furthermore, emerging of new viral variants have imposed higher risk of infection due to the increase viral infectivity and replication rates. Vaccination programs against SARS-CoV-2 have been initiated world-wide in the late 2020. Although the vaccines provide potential promise to help limit the viral infection and spreading, recent reports revealed that infection can still occur post vaccination. Therefore, to effectively control the pandemic without closing all social activities, frequent surveillance of SARS-CoV-2 infection remains a valuable mean to timely isolate infected individuals. As such, early diagnostic and surveillance of SARS-CoV-2 infection is essential and continues to be urged.

    [0281] Currently, there are two types of diagnostic tests available for detecting active SARS-CoV-2 infection: 1) molecular-based tests for detecting viral genomic material and 2) antigen rapid tests (ARTs) for detecting viral proteins predominantly spike protein (S protein) and nucleocapsid protein (N protein). Though molecular-based tests are known for their high accuracy and sensitivity, they are not suitable for frequent surveillance applications as lab settings and equipment are needed. Additionally, almost all molecular-based tests are approved for nasopharyngeal swab samples collected by trained personnel, a semi-invasive method that frequently leads to unpleasant experience.

    [0282] Antigen rapid tests (ARTs) can be deployed as Point-of-Care (PoC) tests and can be used for frequent surveillance. Although ARTs may not have the same high level of sensitivity as the molecular-based tests, the ease of ART workflow allows for high frequency testing. It is suggested that test frequency and rapid turn-around time are more critical than the test sensitivity for COVID-19 surveillance. The larger number of individuals being screened, the more infected yet infectious patients can be identified. Positive results from ARTs suggest relatively high viral loads, hence highly transmissible virus. Therefore, the rapid identification of infected patients via ARTs provides a critical and rapid means to effectively and timely isolate individuals with high transmission potency. For this reason, high attention is drawn to ARTs for surveillance of SARS-CoV-2 infection. Many of the approved ARTs are constrained to nasopharyngeal or nasal swab specimen as the sample matrix. Despite the easy deployment and simple operating procedure, the unpleasant experience of nasopharyngeal and nasal swabs is not appealing to individuals and hence, there may be less motivation to adopt ARTs for frequent testing. In addition, most of the commercial ARTs available use the lateral flow assay (LFA) platform and hence the raw materials required for making of LFAs are in high demand globally. The high demand for LFA production leads to global supply shortage on one of the key LFA components, nitrocellulose paper. Therefore, an alternative system to traditional LFAs for antigen detection would be a great complementary test for surveillance of active SARS-CoV-2 infections.

    [0283] A new method/system for detecting SARS-CoV-2 antigen to detect COVID-19 is described here. The example describes the detection of SARS-CoV-2 N (Nucleocapsid) protein using saliva as a testing matrix. Engineered scaffold binder proteins rcSso7d are used as capture and reporter reagents to detect SARS-CoV-2 nucleocapsid (N) protein. The binders are engineered using the RAPIDS process. A complementary pair of rcSso7d binders are engineered to bind to the N protein at two different epitopes. One of the binders is fused to CBD (Sso.E2-CBD) and used as a capture reagent. The counterpart binder is tagged to a spacer protein maltose binding protein (MBP) and BA (BA-MBP-Sso.E1) to allow the protein to interact with various types of reporting molecule via the BA-SA interaction. Similar to Example 3, SA-HRP is used as a reporting molecule. A complex of BA-MBP.Sso.E1/SA-HRP is used as the reporter reagent.

    [0284] Saliva is used as a sample matrix due to its ease of collection. Usage of saliva offers a less invasive sample collection approach as compared to nasal and nasopharyngeal swab. To reduce viscosity of the sample, saliva may be filtered through a 5 μm filter unit prior to running the assay. In addition, because the target protein (N protein) is enclosed inside the virus, the sample is treated with detergent (1% triton X-100) to break the viral membrane and release the N protein. This filtered and detergent-treated saliva matrix is used for the rapid SARS-CoV-2 antigen assay development.

    [0285] The test is performed by incubating the prepared saliva samples with capture (Sso.E2-CBD) and reporter (BA-MBP-Sso.E1/SA-HPR) reagents for 1 minute. The reaction is then applied onto the cellulose test strip. A washing step is introduced to minimize non-specific binding on the cellulose surface. Finally, TMB substrate is applied to generate colorimetric signal. The colorimetric reaction is left to develop for 3 minutes before the signal is measured. In this example, cyan intensity is used to measure the blue colorimetric signal from HRP/TMP reaction on the cellulose surface. Results showed that when there was an increase in recombinant N protein or SARS-CoV-2 concentration, the cyan intensities increased proportionally, indicating that the test successfully detected the SARS-CoV-2 biomarker and can be used to diagnose COVID-19. Cross-reactivity study showed that the test produced no cross-reactivity to flu-causing pathogens spiked in saliva. These results suggest that the test is highly specific to SARS-CoV-2 (see Results section below for more details).

    [0286] Advantageously, embodiments of the test can be easily implemented on children and adults for ‘painless’ sample collection, and is thus suitable for frequent testing of SARS-CoV-2 infection for all age ranges. Embodiments of the test provides a short turn-around-time of 5-10 min, up to 4 times shorter than the currently available ARTs which require up to 15-20 min. Using the unique protein engineering technology, the test is designed to be compatible with cellulose paper, an alternative, cost-effective and readily available material. Usage of cellulose paper avoids the risk of nitrocellulose supply chain shortage, an issue that currently hampers the production of many LFA tests. In addition, thermostable rcSso7d proteins are used instead of antibodies for capture of SARS-CoV-2 N protein. Therefore, the reagents may be produced using bacterial system, which is a more cost-effective method as compared to the mammalian cell line system required for antibody production. In addition, a unique vertical flow assay (VFA) with short flow path is developed as an alternative approach to LFA.

    Results

    [0287] Generation of Affinity Paired rcSso7d Binders Targeting SARS-CoV-2 N Protein

    [0288] To develop the rapid vertical flow test for detecting SARS-CoV-2 antigen from saliva, a pair of rcSso7d binders binding to different epitopes of N protein were engineered. The RAPIDS screening process (FIG. 24) was applied for discovery of binder pairs from the naïve yeast library that contains 1.4×10.sup.9 of thermostable rcSso7d variants. Detailed screening of the rcSso7d binding pair was carried out. In brief, recombinant SARS-CoV-2 N protein was used as the target for primary rcSso7d binder screening. The N protein immobilized on magnetic beads were introduced to the naïve yeast library whereby each yeast cell displayed only one variant of rcSso7d on its surface (FIG. 24, step (I)). Following 3-4 rounds of positive (beads labelled with N protein) and negative (bare beads) magnetic bead sorting (MBS), the selected yeast clones were subjected to a more stringent screening using fluorescence-activated cell sorting (FACS). For FACS sorting, the sub-library of the MBS yeast cells was incubated with His(6)-tagged N protein. Each rcSso7d variant was stained with anti c-Myc/AF488 and N protein was stained with anti-His/AF647 (FIG. 24, step (II)). Using AF488 and AF647 markers for FACS, yeast cells which bound strongly to N protein were selected for subsequent round of FACS sorting, whereby N protein concentration was reduced at every subsequent round to ensure selection of high affinity clones. Following 5-6 rounds of FACS sorting, the primary clone, Sso.E1, was selected and characterized (FIG. 24, step (III)). The Sso.E1 was fused to a spacer maltose binding protein (MBP), and a biotin (BA), and referred as BA-MBP-Sso.E1 (FIG. 24, step (IV)). Tagging of BA-MBP improves protein stability and allows biotin-mediated labeling or immobilization. For screening of the secondary rcSso7d binder, a complex of N protein and BA-MBP-Sso.E1 binder was used as the target for the screening (FIG. 24, step (V)). This ensured that the primary binding epitope for Sso.E1 on N protein was blocked, and the selected secondary rcSso7d binders bound to an alternate epitope, thus forming a complementary affinity pair with Sso.E1. A series of MBS (FIG. 24, step (V)) and FACS sorting (FIG. 24, step (VI)) were performed in a similar fashion to the screening of the first binder. For FACS sorting, streptavidin (SA) conjugated with AF647 (SA-AF647) was used for labelling of the rcSso7d BA-MBP-Sso.E1 instead of anti-His/AF647 used in the screening of primary binder rounds (FIG. 24, step (VI)). Finally, the secondary binder, Sso.E2, was selected. The Sso.E2 was fused to cellulose binding domain (CBD), and referred as Sso.E2-CBD, which allows the binder to interact to the cellulose paper. This unique property of CBD facilitates rapid turn-around-time assay development in the subsequent steps.

    [0289] Through the RAPID screening process, rcSso7d binder pair which bind complementarily to different epitopes of SARS-CoV-2 N protein was successfully engineered. These binders are (i) BA-MBP-Sso.E1 and (ii) Sso.E2-CBD whereby the former will be used as the reporting binder and the latter will be used as the capture binder. The proteins can be easily scaled-up and purified to homogeneity as shown in SDS-PAGE analysis (FIG. 30). Remarkably, this affinity pair of rcSso7d that binds to N protein was successfully identified within 6 weeks.

    [0290] Both Sso.E1 (SEQ ID NO: 4: MATVKFTYQGEEKQVDISKIKIVRRGGQWISFWYDEGGGAYGAGYVSEKDAP KELLQMLEKQ) and Sso.E2 (SEQ ID NO: 5: MATVKFTYQGEEKQVDISKIKNVGRWGQIIDFDYDEGGGAIGIGAVSEKDAPK ELLQMLEKQ) interact with SARS-CoV-2 N protein with excellent binding affinities at the dissociation constants (K.sub.D) of 3.2 nM and 4.2 nM, respectively. To determine the binding epitopes of the binder pair, Bio-layer Interferometry (BLI) was performed using truncated N-terminal domain (NTD) and C-terminal domain (CTD) of N protein as ligands. For facile and orientation-specific loading of the Sso binders onto the BLI streptavidin (SA) probes, BA-MBP tag was fused to Sso.E1 and Sso.E2 resulting in BA-MBP-Sso.E1 and BA-MBP-Sso.E2, respectively. BLI results showed that Sso.E1 bound to CTD and Sso.E2 bound to NTD of the N protein, respectively and solely (FIGS. 25A and 25B). N protein is known to form dimers via its CTD. Therefore, results obtained from BLI suggested that the binder, particularly the Sso.E1, capture the tertiary form of N protein via the CTD. To further confirm that the binder pair capture SARS-CoV-2 N protein at different epitopes, stepwise BLI was carried out. BA-MBP-Sso.E1 was loaded on the SA probes. Full length N protein was loaded as a secondary ligand. Sso.E2-CBD or Sso.E1 was loaded as tertiary ligand. Results showed that only the combination of Sso.NP.E1/N protein/Sso.NP.E2 displayed stepwise increase in the binding curve, confirming that the binder pair bind to complementary epitopes on SARS-CoV-2 N protein (FIG. 25C).

    Integration of a Vertical Flow Assay (VFA) on Cellulose Platform

    [0291] Cellulose paper was selected as the sensor material due to its advantages in price, availability, and high affinity toward CBD. Cellulose is more suitable for the vertical flow assay (VFA) format than the lateral flow assay (LFA) format due to the rather large pore size, for example, as compared to nitrocellulose which is a common material used for LFA. Therefore, a vertical flow assay (VFA) was adopted for development of the rapid SARS-CoV-2 test. To optimize for the VFA, four different assay approaches were tested to determine the workflow that give the best assay performance (FIG. 26). These assay approaches include 1) short incubation (SI) where capture molecule was immobilized on a cellulose surface and analyte and reporting molecules were applied to the cellulose paper in a stepwise manner, 2) limited incubation (LI) where capture molecule was immobilized on a cellulose surface, but analyte and reporter molecules were allowed for a short incubation period of 10 seconds prior loading to the cellulose test matrix, 3) half complex cellulose pulldown (CP-H) where capture molecule was immobilized on a cellulose paper while analyte and reporting molecules were allowed for interaction for a longer period of 1 minute prior loading onto the test matrix and 4) full complex cellulose pulldown (CP-F) where the interaction between capture molecule, analyte and reporting molecule was allowed in an aqueous phase for 1 minute prior loading onto the test matrix (FIG. 26A). All tests were performed in the presence or absence of the analyte (N protein). Application of 3,3′,5,5″-tetramethylbenzidine (TMB) substrate was used to generate colorimetric signals via enzymatic reaction which occurred between TMB and SA-HRP presented on the reporting molecules and had been captured onto the cellulose surface. Cyan intensity was used to measure the test signal. Results revealed that the CP-F test format produced the strongest signal intensity (FIG. 26B) and the highest ‘signal-to-noise’ ratio (+antigen/−antigen) (FIG. 26C). Therefore, the test format 4, CP-F, was chosen for the rapid SARS-COV-2 test development.

    [0292] For a diagnostic test, a control reaction is required to ensure the active reagent activity and reliable test results, especially when a negative test result (no signal) is observed. A few criteria were considered for constructing of the control reaction including 1) assay reaction shall be able to apply to both test and control reactions to avoid extra steps of sample preparation and 2) control reaction needs to report ‘active’ reagent signal independent of the presence of absence of analyte/antigen in the test sample.

    [0293] With these considerations, the control reaction was constructed by pre-immobilizing the cellulose control spot with SARS-CoV-2 N protein. To immobilize the N protein on the cellulose surface, the protein was fused to CBD at its C terminus (NP-CBD). The NP-CBD on the cellulose control spot is designed to capture the reporting molecule (BA-MBP-Sso.E1) presented in the sample mixture, followed the CP-F test format (FIGS. 27A and B).

    [0294] The control spot performance was tested with pooled healthy control saliva samples spiked with either N protein or PBS. Results showed that the control spots produced cyan intensity signals higher than 0.2 for both testing conditions (FIG. 27C). The performance of the control spots was further evaluated under various testing conditions, including different concentrations of N protein spiked in saliva matrix (FIG. 31A), different amount of SARS-CoV-2 virus spiked in saliva matrix (FIG. 31B), and various pathogens spiked in saliva matrix (FIG. 31C). Signals obtained from control spots were observed at comparable level and above the cyan intensity of 0.2 (FIG. 31), indicating that the proposed concept of control spot achieved the desired objective and can be used to monitor the reagent activity for the rapid SARS-CoV-2 VFA.

    Assay Construction and Optimization

    [0295] A test strip contains a ‘test’ and a ‘control’ spot (FIG. 28A). The reactive testing regions of both spots were determined using printed hydrophobic ink (FIG. 28A). Diameter of each spot was 4 mm. The test strip was folded in a ‘zig-zag’ manner to construct 3 layered cellulose paper (FIG. 28A). Two pieces of cellulose paper with 1.5 mm thickness were placed underneath the 3-layer folded cellulose paper and used as absorbent pads (FIG. 28A). The folded paper and the absorbent pads were secured together using plastic manifolds and paper binders or double-sided tape (FIG. 32).

    [0296] Saliva is the desired testing matrix for this assay development. Therefore, pooled saliva from healthy control subjects was used as a testing matrix for the assay optimization. The saliva was filtered through a 5 μm filter to reduce viscosity. N protein is enclosed inside the virus. Therefore, the sample is treated with a detergent to break the viral membrane to allow the release of the N protein. To mimic the final format of the testing sample matrix, the filtered saliva sample used for optimization was treated with 1% v/v triton X-100.

    [0297] VFA workflow follows the CP-F assay format (FIG. 26). It was observed that the assay produced high background color even in the absence of N protein (FIG. 26B). A washing step was introduced to the assay prior to the colorimetric signal generation using TMB substrate. Results showed that, with the washing step, background signal was substantially reduced and signal-to-noise ratio (+N protein/−N protein) was significantly improved (FIG. 33). Therefore, a washing step was applied to the assay workflow.

    [0298] To achieve an even higher signal-to-noise ratio, enzymatic reaction time allowing for optimal colorimetric signal development was evaluated. Using the CP-F workflow with one washing step, the colorimetric reactions were left to develop for different durations following the TMB substrate application. Images of the cellulose test and control spots were taken at different development times and cyan intensities were analyzed. The highest signal-to-noise ratio was achieved with 3 minutes of the color development reaction (FIG. 34). The test was not kept longer than 3 minutes to limit the total assay time to 5 minutes. According to these data, the 3 minutes reaction time was selected for the colorimetric signal development.

    [0299] To further simplify the assay workflow, testing reagent was prepared as a single tube reaction by mixing capture molecule (Sso.E2-CBD) and reporting molecules (BA-MBP-Sso.E1/SA-HRP) together into a single tube. Based on the assay optimized procedures, the assay workflow can be describe as shown in FIG. 28A. Treated saliva sample was added to the prepared testing reagent and incubated for 1 minute at ambient temperature. 38 μL of the reaction mixture was applied to test spot and another 38 μL to the control spot, respectively. 38 μL of wash solution was applied to the test spot and another 38 μL to the control spot, respectively. 38 μL of TMB substrate was finally applied to the test spot and another 38 μL to the control spot for enzymatic reaction. Cyan intensity was measured after 3 minutes following the color development reaction.

    Assay Performance

    [0300] With the fully assembled VFA, performance was first tested with different concentrations of SARS-CoV-2 N protein spiked in filtered saliva containing 1% v/v triton X-100 to determine the test limit of detection (LoD). LoD was determined as the lowest concentration that gave signals higher than three times standard deviation values of the background (no antigen) signal (negative+3σ). Results showed that the VFA achieved a LoD at 2.5 nM (FIG. 28B). Corresponding signals from the control spots were shown in FIG. 31. The VFA performance was further evaluated using live SARS-CoV-2. Different concentrations of the virus were spiked in filtered saliva with 1% triton X-100. Results revealed that the test can detect live virus at a concentration as low as 6.3×10.sup.4 TCID50/mL (FIG. 28C). Corresponding signals from the control spots can be found in FIG. 31. According to viral load quantification studies, the amount of SARS-CoV-2 virus presented in patients is highly variable, ranging from 641 genome copies per mL to 1.34×10.sup.11 copies per mL, and the median viral load in sputum is 7.52×10.sup.5 copies per mL. With the represented LoD sensitivity, the assay can detect patients with the viral load at around the median value, which are those who are most likely to be highly infectious to others.

    [0301] To further assess the assay performance, the specificity of the rapid SARS-CoV-2 VFA to 2 pneumoniae bacterial strains and 16 viral strains (Table 6) that were spiked into filtered saliva containing 1% triton X-100 was investigated. These pathogens were chosen due to their flu-like symptoms upon infection, including fever and sore throat, symptoms that are also observed in SARS-CoV-2 infection. As shown in FIG. 28D, all 18 pathogens had signal below the cut-off value (negative+3σ), while positive control with 4 nM SARS-CoV-2 N protein showed positive results. Based on these results, it is suggested that the rapid SARS-CoV-2 VFA specificity is 100% against the selected 18 pathogens. Corresponding signal from the control spots are shown in FIG. 31.

    TABLE-US-00006 TABLE 6 List of non-specific pathogens used for the cross-reactivity study Test Remarks/expire Number Strain Source Lot # Concentration date 1 Human ATCC VR-3 70033218 4 × 10.sup.6 adenovirus 3 TCID.sub.50/mL 2 Human ATCC VR-5 70024114 4 × 10.sup.7 adenovirus 5 TCID.sub.50/mL 3 Coronavirus- ATCC VR-740 70035459 4 × 10.sup.4 229E TCID.sub.50/mL 4 Coronavirus- ATCC VR-1558 70036255 4 × 10.sup.4 OC43 TCID.sub.50/mL 5 Human ATCC VR-1572 58527797 1.25 × 10.sup.5.5 adenovirus 4 TCID.sub.50/mL 6 Coronavirus ZEC. 325222 1.17 × 10.sup.3 HI (15 Oct. 2023) NL63 0810228CFHI TCID.sub.50/mL 7 RSV Type A ZEC. 324924 1.25 × 10.sup.4 HI (25 Aug. 2023 0810040ACFHI TCID.sub.50/mL 8 RSV Type B ZEC. 323000 1.25 × 10.sup.4 HI (4 Sep. 2022 0810040CFHI TCID.sub.50/mL 9 HMPV3 Type ZEC. 325204 0.97 × 10.sup.3 HI (7 Oct. 2023) B1 0810156CFHI TCID.sub.50/mL 10 Rhinovirus ZEC. 316699 2.5 × 10.sup.4.1 HI (N/A) A16 0810285CFHI TCID.sub.50/mL 11 Influenza A AMR in house 3 × 10.sup.7 culture CFU/mL 12 Influenza B AMR in house 3 × 10.sup.7 culture CFU/mL 13 Dengue 1 AMR in house NA Doing plaque culture assay 14 Dengue 2 AMR in house 2.5 × 10.sup.3 culture PFU/mL 15 Dengue 3 AMR in house NA Doing plaque culture assay 16 Dengue 4 AMR in house NA Doing plaque culture assay 17 Klebsiella AMR in house 4 × 10.sup.6 pneumoniae culture CFU/mL 18 Streptococcus AMR in house 3 × 10.sup.7 pneumoniae culture CFU/mL

    Translation of the Rapid SARS-CoV-2 VFA to PoC Application

    [0302] Following the assay optimization and verification, the next step is to translate the rapid SARS-CoV-2 VFA into PoC applications. To do so, there has to be a portable device which could measure cyan intensity signals. Two approaches to translate the VFA to PoC test were tested: 1) adopting of mobile phone camera to capture and interpret the test signals and 2) developing of a portable reader for analysis of the colorimetric signals.

    [0303] For the first approach, a complementary ‘light box’ was created to ensure the consistency of lighting condition and the phone camera distance (FIG. 29A). A black box dimension 150×230×90 mm.sup.3 was equipped with LED light strips at the inner face. The external, top face of the box contains a phone holder to fix the phone position therefore defining a fixed camera distance to all tests measured. A colorimetric signal analysis application was developed for IOS/Android system. The software utilizes phone camera to capture an image, followed by cyan intensity analysis and result interpretation (FIG. 29B). With this approach, LoD of 2 nM SARS-CoV-2 N protein was achieved (FIG. 29C). To the surprise of the inventors, this value outperforms the lab based VFA (FIG. 28B) which achieved LoD of 2.5 nM using Epson scanner and ImageJ software for signal analysis.

    [0304] For the second approach, a spectrophotometer was designed to measure the red absorbance at 650 nm. The device equipped with a complementary software for signal analysis was outsourced to Attonics Systems Pte. Ltd., Singapore (FIG. 29D). For this approach, the form factor of the cellulose test strips was slightly modified to accommodate the reader system. The test construction remained in a similar fashion to the other experiments performed in this study, in which hydrophobic ink was used to defined hydrophilic boundary and the cellulose paper was folded into 3 layers. Two pieces of 1.5 mm thick cellulose paper was used as absorbent pads. All the pieces were secured together using customized cassette that was produced using aluminum or plastic material. Opening windows were designed above the test and control spots, each with a diameter of 3.8 mm (FIG. 29D). Live SARS-CoV-2 virus spiked in filtered saliva containing 1% v/v triton X-100 was used to assess the performance of the absorbance reader. Results showed that this system achieved LoD of 4.0×10.sup.4 TCID50/mL, 10 times more sensitive as compared to the LoD obtained from the lab based VFA (FIG. 28C). Based on these two pilot PoC translational approaches, the inventors are confident that the rapid SARS-CoV-2 VFA developed can be practically applied to the PoC settings.

    Discussion

    [0305] Amidst the available options of SARS-CoV-2 vaccines, the COVID-19 pandemic continues. The importance of early detection and surveillance of SARS-CoV-2 infection has been emphasized and highlighted. Rapid, cheap, and easy-to-use diagnostic tests are still urged and employed as critical tools to help controlling the spreading of the virus.

    [0306] The inventors have successfully developed a rapid SARS-CoV-2 VFA, on a cellulose platform using unique rcSso7d binder pair, that could detect SARS-CoV-2 N protein from saliva samples. During the lab-based verification, the system achieved LoD of 2.5 nM (FIG. 28B) and 6.3×10.sup.4 TCID50/mL (FIG. 28C) using recombinant N protein and live virus, respectively, spiked in filtered saliva containing 1% v/v triton X-100. The disclosure has also demonstrated a practicality of translating the developed test to two PoC systems, using the custom designed mobile phone application and the portable absorbance reader device. Results obtained from the PoC systems showed improved test performance in which the tests achieve LoD of 2 nM N protein using the application on the mobile device (FIGS. 29A, B and C) and 4.0×10.sup.3 TCID50/mL virus using the custom-made spectrometer system (FIGS. 29D and E). Cross-reactivity challenged against 18 pathogens showed non-specific signal detection, suggesting that the rapid SARS-CoV-2 VFA exhibited 100% specificity against the selected pathogens that cause flu-like symptoms (FIG. 28D).

    [0307] The group have developed, in parallel, two types of rapid SARS-CoV-2 VFA, one being the ‘bottom readout’ test and the second one being the test described in this example. Building upon the first developed ‘bottom readout’ test where the cellulose test strips required the ‘flipping’ action to apply TMB and for detection the colorimetric signals, the current test simplified the workflow by omitting the ‘flipping’ step. This workflow provides simpler operating steps at PoC settings as well as paves the way for ease of high throughput applications, where the cellulose test strips can be easily treated by different solutions via a liquid handling system.

    [0308] Saliva has gained much interest as the alternative sample matrix for diagnosis and health monitoring as it provides easy mean of sampling and is non-invasive. Usage of saliva for diagnosing of SARS-CoV-2 infection has been proven feasible by many studies, in which the amount of viral load in saliva was shown to be in a comparable range to the viral load in naso- or oropharyngeal swabs. With an intention to improve the usability of ARTs for SARS-CoV-2 which currently employed nasal or nasopharyngeal swabs as a sample matrix, saliva was selected as a sample matrix due to its ‘painless’ and non-invasive sample collection method. Though the sampling of saliva is easy and straightforward, the sample processing was rather challenging. As the high viscosity of saliva caused by mucous content was problematic for controlling of fluid flow rate. This issue was resolved by filtering of saliva prior to performing the assay. Filtration of saliva may seem trivial during the test development phase, however to implement the test for PoC applications, an easy-to-operate device for saliva filtration at PoC settings has to be considered and sorted.

    [0309] In conclusion, the inventors have successfully developed a rapid SARS-CoV-2 VFA that detects clinically relevant concentrations of viral N protein present in saliva. Thus far, this test offers the shortest turn-around-time of 5-10 minute from sample to results. Results obtained from this study indicated that the test has a great potential to be practically translated into a PoC diagnostic test for rapid detection of COVID-19. With more frequent testing, the control and isolation of COVID-19 infected individuals could be done more effectively, facilitating safe social interactions within the new community norms.

    Materials and Methods

    Materials

    [0310] All chemicals were of analytical grades. Sources of standard chemicals that were not listed in the method sections were purchased from Merck/Sigma-Aldrich, Singapore.

    Protein Expression and Purification

    [0311] All cloning and protein expression work were done in the Escherichia coli DH5α and BL21 (DE3) strains, respectively. N protein NTD and CTD domain boundaries were scouted with the help of NTU Protein Production Platform. Coding sequences were cloned into the pET28b plasmid backbone. For protein expression, relevant plasmids were transformed into E. coli BL21 (DE3). Single colonies were obtained on LB agar plates supplemented with 50 μg/mL kanamycin (Sigma-Aldrich, Singapore) and inoculated in LB media supplemented with 50 μg/mL kanamycin. Each starter culture was grown overnight with shaking at 37° C. and added to 1 L of LB media for protein expression. Each expression culture was allowed to grow at 37° C. with shaking until the OD.sub.600 reached 0.6-0.9. The culture was then supplemented with 0.5 mM IPTG (Sigma-Aldrich, Singapore) to induce protein production and was grown overnight (16-20 hours) with shaking at 16° C. When expressing the reporting binder BA-MBP-Sso.E1, 0.2 mM of D-biotin (Sigma-Aldrich, Singapore) was also added to the culture prior to IPTG supplementation.

    [0312] Cell pellet was harvested by centrifugation and subjected to lysis by sonication in lysis buffer (50 mM Tris-HCl, 300 mM NaCl, 10 mM Imidazole, pH 7.6) supplemented with protease inhibitor cocktail (Nacalai Tesque Inc., USA). The lysate was then clarified by high-speed centrifugation at 25,000 g. The soluble fraction (supernatant) was collected and incubated with HisPur Ni-NTA resin (Thermo Fisher Scientific, USA) for metal-affinity purification. Protein-bound resin was washed with buffers containing increasing imidazole concentrations before the desired protein was eluted by using elution buffer containing 300 mM imidazole. All constructs except SARS-CoV-2 N protein were collected at this step. Proteins collected from each fraction were ran on SurePAGE™ precast gels (GenScript, Hongkong, China), and stained using Brilliant Blue R Staining Solution (Sigma-Aldrich, Singapore) for visualization. Fractions containing pure protein of interest were concentrated and buffer-exchanged to PBS with Vivaspin centrifugal concentrators (Sigma-Aldrich, Singapore) and stored at −80° C. SARS-CoV-2 NP was further subjected to size exclusion chromatography with HiLoad 16/60 Superdex 75 (Sigma-Aldrich, Singapore) and eluted with gel filtration buffer. Pure SARS-CoV-2 N protein fractions were pooled and concentrated with Vivaspin centrifugal concentrators and stored at −80° C.

    Processing of Saliva Samples

    [0313] Pooled saliva was collected from healthy donors by passive drool saliva into collection tubes. To reduce the sample viscosity, collected saliva was filtered with 5 μm syringe filter (Sartorius, USA) and treated with 1 v/v % triton X-100 (Sigma-Aldrich, Singapore). This saliva sample matrix was used for all experiments, otherwise stated.

    Preparation of SARS-CoV-2 Virus Sample

    [0314] African green monkey kidney cells Vero E6 (CRL-1586; American Type Culture Collection, Manassas, VA, USA) were maintained in Dulbecco's modified Eagle's medium (DMEM; Gibco, Grand Island, NY, USA) supplemented with 8% fetal bovine serum (FBS) and penicillin-streptomycin at 37° C. in 5% CO.sub.2. SARS-CoV-2 (hCoV-19/Singapore/2/2020) virus was previously isolated (Anderson et al., 2020). and the genome sequence is deposited in GISASID (Accession ID EPI_ISL_407987). The virus stock was propagated in Vero E6 cells using DMEM supplemented with 2% FBS. The virus was titrated in ten-fold serial dilutions on 96-well plates of Vero E6 cells to obtain a 50% Tissue Culture Infectious Dose (TCID.sub.50). After 4 days incubation, the TCID.sub.50 of stock virus was calculated based on eight replicates by the Reed and Muench method (Reed & Muench). The viral stock was pre-diluted in FBS-free DMEM culture media to 107 TCID.sub.50/mL. Then, five-fold (2×10.sup.5, 4×10.sup.4, 8×10.sup.3, 1.6×10.sup.3 TCID.sub.50/mL) and two-fold dilutions (3.2×10.sup.2, 1.6×10.sup.2, 0.8×10.sup.2, 0.4×10.sup.2 TCID.sub.50/mL) were prepared using DMEM media. Three replicates of SARS-CoV-2 virus samples were prepared at each dilution for the VFA assay.

    Cellulose Test Strips Preparation

    [0315] Whatman Grade 1 Chr filter paper (GE Healthcare, USA) was used for fabrication of the test strip. Each test strip contained 1 test spot and 1 control spot, each with a reactive circular testing area of 4 mm diameter. To define the reactive testing area that allows liquid to pass through, wax ink was printed (ColorQube 8570, Xerox, USA) on to the cellulose paper to create hydrophobic boundary around the testing areas. The printed paper was baked for 1 minute at 150° C. to allow the wax ink to diffuse throughout the paper thickness, forming continuous hydrophobic boundary throughout the paper layer. The test strip was folded in a zig-zag motion to create a 3 layered test strip, generating the final strip ‘length×width’ dimension of 30×15 mm.sup.2. The top layer of the wax ink printed test strip was treated with 10 μL of 5% BSA dissolved in PBS. The treated papers were air dried and stored at 4° C. until used.

    Optimization of Different VFA Test Formats

    [0316] For the test conditions that required immobilization of Sso.E2-CBD on the test strip, the top layered of the test strip was treated with 10 μL of 2 μM Sso.E2-CBD diluted in PBS. To ensure that the proteins were immobilized on the cellulose surface, the cellulose test strip was suspended in the air, allowing the protein to remain on the test strip for ˜2 min, subsequently excess liquid was absorbed away using multi-purpose towel paper. The test strip was blocked with 10 μL 5% BSA in PBS, air dried and stored in 4° C. until used. For the condition which did not require pre-immobilization of Sso.E2-CBD, the cellulose test strip was treated with only 5% BSA. The test strips were constructed following the protocol described in the ‘VFA Test Assembly’.

    [0317] PBS was used as the ‘sample matrix’ base for this experiment. The sample matrix was prepared by spiking PBS or 5 nM N protein into the PBS mixture reaction. Reporting molecule was prepared by mixing 500 nM of BA-MBP-Sso.E1 with 62.5 pM of streptavidin (SA) horse radish peroxidase (SA-HRP), (Biolegend, USA) in PBS. The reaction was kept incubated for at least 15 min on ice to ensure effective complex formation of BA-MBP-Sso.E1/SA-HRP prior to use. For the condition which did not require Sso.E1-CBD to be pre-immobilized onto the cellulose surface, 500 nM of Sso.E1-CBD was used for the mixture reaction. All mixture reaction volumes were prepared at 40 μL per reaction. This reaction volume maintained the hypothetical equimolar concentration of Sso.E1 in the solution and on the pre-immobilized cellulose surface, which was equivalent to 2×10.sup.−18 moles. 40 μL of 3,3′,5,5″-tetramethylbenzidine (TMB) substrate (Sigma-Aldrich, Singapore) was applied to generate colorimetric signal. After 3 minutes of the color development Image was taken using Epson Perfection V750 Pro Scanner (Epson, Singapore). Images were stored as .jpg files for subsequent colorimetric signal analysis.

    VFA Test Assembly

    [0318] The 3 layered wax ink printed cellulose test paper was prepared according to the protocol described in ‘Cellulose Test Strip Preparation’. 1.5 mm-thick cellulose filter paper (Whatman gel blotting papers grade GB005, Sigma-Aldrich, Singapore) was cut to 30×15 mm.sup.2 and was used as a material for absorbent pads. Two pieces of the absorbent material were placed underneath the 3 layered wax ink printed paper. To hold all the cellulose test strip components together, plastic manifolds were created using 2 mm thickness acrylic sheet. The acrylic sheet was cut into two pieces using a laser cutter (Epilog Fusion Edge Laser System, USA), each piece with a dimension of 30×50×2 mm.sup.3. An opening dimension 20×10 mm.sup.2 was cut through on one of the acrylic pieces, providing access to the test strips (FIG. 32). 3 mm thickness acrylic sheet was laser cut into two pieces of rectangular cuboid, each with a dimension of 10×30×3 mm.sup.3. These two pieces of acrylics were used as spacers that restricted the clamping of acrylic manifolds to 3 mm (FIG. 32), therefore defining consistent pressure applied to different test strips. The acrylic manifolds and the test strip components were held together using paper binders or double-sided tape.

    [0319] The test strip used for the custom-made spectrophotometer (Attonics Systems, Singapore) was assembled using re-usable cassettes made of aluminum, dimensioned 30×50×3.2 mm.sup.3. The cassette contained two circular openings, each with 3.8 mm diameter, for accessing of test and control spots. Following the principle set by the acrylic manifolds, the height in the inner chamber of the cassette was maintained at 3 mm for a consistent pressure applied to the test strip components.

    Image Analysis

    [0320] Images of all test strips were taken using Epson Perfection V750 Pro Scanner (Epson, Singapore), otherwise stated. All images were saved in .jpg format. Cyan intensity was analyzed from each image using an open-source ImageJ software from The US National Institute of Health (NIH). Image was separated into single channel of CYMK color space. Cyan intensity was calculated based on a mean value of the defined area in an image.

    [0321] For assessment of live virus performed on the VFA, test result images were taken using an iPhone 5S instead of the scanner. The phone was used instead of the scanner due to restrictions of the BSL3 facility employed to perform the test. Images from the phone were transferred to a PC and analyzed using ImageJ software. The analysis was performed using a similar process applied to images acquired from the scanner. Despite the different image acquisition devices, cyan intensities were found to be within a comparable range.

    Example 5—Rapid Detection of SARS-CoV-2 Neutralizing Antibodies from Non-Processed Whole Blood Samples and its Application on Monitoring of Immunity Status Against SARS-CoV-2 Variants

    [0322] Stemming from the application in Example 3, the inventors further developed a test better suited to Point-of-Care (PoC) applications by using non-processed whole blood samples (fingertip or venous) instead of plasma or serum samples which require sample processing steps in a laboratory. Similar to the application in Example 3, this test utilizes the interaction between RBD/ACE2 to determine the level of NAb. However, HRP cannot be used as a reporting molecule in whole blood sample due to the presence of peroxidase in red blood cells that interferes with the colorimetric signal generation. Instead of using HRP, the ACE2 protein was conjugated to fluorescent molecules (ACE2-FI) i.e., AF594 and used as a reporting reagent (FIG. 36A).

    [0323] A modified workflow was applied to this assay application to improve the test sensitivity. Whole blood sample was first incubated with RBD-CBD for 3 minutes, subsequently ACE2-FI was added to the reaction and incubated for another 5 minutes (FIG. 36A). This two-step incubation allows NAb to interact with RBD-CBD first before exposing to ACE2-FI, therefore facilitating effective interaction of NAb to RBD-CBD. Following the incubation steps, the reaction was applied to ‘Test’ and ‘Control’ spots on the cellulose-based vertical flow device (FIGS. 36A and B). A washing step was applied to minimize non-specific signals on the cellulose surface before fluorescent intensities were measured.

    [0324] In a similar fashion to Example 3, absence or low concentrations of NAb led to high fluorescent intensities (FIG. 36C) whereas increase in NAb concentrations resulted in proportional reduction of fluorescent intensities (FIG. 36C). For ease of test result interpretation, inhibition percentage graph was plotted (FIG. 36D), in which the high fluorescent intensity signals obtained from low NAb levels were represented as low % inhibition and vice versa.

    [0325] Because the positive NAb signals are derived from the absence of fluorescent intensity, a control spot is critical to ensure that the loss of signals are due to presence of NAb and not the malfunction of reagents. A control spot was designed to produce high fluorescent signal regardless of presence or absence of NAb. To do so, high concentration of RBD-CBD was immobilized on the cellulose surface at the control spot to capture ACE2-FI from the sample mixture (FIG. 36B).

    [0326] Using this assay workflow, the inventors demonstrated that the test can detect different levels of NAb from samples that present different stages of COVID-19 vaccination (FIG. 37). These results indicate that the rapid cellulose-based SARS-CoV-2 NAb test can distinguish different levels of NAb from different stages of vaccinated subjects, therefore supporting the usability of the test for PoC mass screening of herd immunity and vaccine efficacy.

    [0327] In addition, the inventors have also demonstrated that the rapid cellulose-based SARS-CoV-2 NAb test can be used to monitor immunity status against the SARS-CoV-2 variants. Recombinant RBD proteins from each of the SARS-CoV-2 variant were fused to CBD (RBDv-CBD) and used as capture reagents. Using non-infected and non-vaccinated blood as sample matrix, the results showed that most of the RBD from the variants produced higher fluorescent intensities as compared to the wild-type (WT) SARS-CoV-2 (FIG. 38A). These results indicated that the variants interact with ACE2 more effectively thereby producing higher fluorescent intensities. Blood samples from fully vaccinated samples were tested on these variants. Results showed that, more than 50% inhibitions were still observed from most of the subjects on all variants. These data suggested that majority of the tested vaccinated samples exhibited protective immunity against SARS-CoV-2 variants (FIG. 38B).

    Applications

    [0328] Embodiments of the method and system disclose herein relates to a cellulose pull down (CP) technology that can capture target analytes more effectively using (i) pre-mixing solution and (ii) cellulose binding domain fused to an analyte binder. Cellulose binding domain (CBD) has a very high affinity toward cellulose substrate. It can be captured on to the cellulose substrate within less than a second. By fusing the analyte binder to CBD, embodiments of the method and system take advantage of the CBD to pull the assay complex down to a cellulose substrate.

    [0329] In embodiments of the method and system, the sample, the reporter agents and optionally the capture agents are pre-incubated in a solution off site of a cellulose substrate. The pre-incubation step allows excess time for the assay complex (e.g. reporter agent-analyte complex or reporter agent-analyte-capture complex) to form (typically 1-3 min is sufficient). Once the complex is formed, it is applied to the cellulose substrate. The whole assay complex can be instantaneously pulled down to the cellulose paper via high affinity CBD-cellulose interaction, resulting in high sensitivity of signal production. In a scenario where a full assay complex incubation is not favorable, half complex pre-incubation (analytes with reporter reagents) can be applied. The capture agents comprising CBD can be pre-immobilized on to the cellulose substrate prior to performing the assay. The half complex formation during the pre-incubation allows most of the target analytes captured to generate signals, therefore promoting high sensitivity of signal production.

    [0330] Rapid diagnostic tests often compromise sensitivity for rapid detection time. Embodiments of the method and system disclosed herein generally improve the performances of RDTs to the next level of sensitivity while maintaining the rapid detection time. Embodiments of the cellulose pull down (CP) technology allows sufficient time for full sandwich complex formation and effective capture of the full sandwich complex on to cellulose substrate. As a result, embodiments of the method allow high sensitivity signal detection in a short period of time. In addition, the use of low capture agent concentration could save up to 8 times on raw materials which could further lower down the production cost significantly.

    [0331] In addition to RTD, embodiments of the method and system can be applied to wide array of biomedical and life science applications including protein separation. Altogether, embodiments of the method have great potential to be expanded to many applications. Examples of such applications include, but are not limited to, the rapid detection of SARS-CoV-2 neutralizing antibodies from human plasma/serum samples, the rapid detection of SAR-CoV-2 antigen from saliva samples and the rapid detection of SARS-CoV-2 neutralizing antibodies from non-processed whole blood samples and its application on monitoring of immunity status against SARS-CoV-2 variants.

    [0332] It will be appreciated by a person skilled in the art that other variations and/or modifications may be made to the embodiments disclosed herein without departing from the spirit or scope of the disclosure as broadly described. For example, in the description herein, features of different exemplary embodiments may be mixed, combined, interchanged, incorporated, adopted, modified, included etc. or the like across different exemplary embodiments. The present embodiments are, therefore, to be considered in all respects to be illustrative and not restrictive.