SCAFFOLDING PROTEIN FOR GENERATING ANTIGEN-BINDING CHIMERAL PROTEINS

Abstract

Disclosed is a scaffolding protein having SEQ ID NO: 1, derived from a conotoxin, which does not have amino acid residues associated with the toxic activity of the conotoxin and which can be used to generate chimeral proteins having 19-47 amino acids, fragments of a CDR3 of a vNAR with affinity for a specific antigen being inserted between amino acids 11 and 12 thereof.

Claims

1. A scaffolding protein derived from a conotoxin of SEQ ID NO: 1: TABLE-US-00004 Gly-Asp-Cys-Pro-Pro-Trp-Cys-Gly-Ala-Arg-Cys-  1  2  3  4  5  6  7  8  9  10  11  12 (XXX)-Cys where (XXX) represents the scaffolding protein insertion site.

2. An antigen-binding chimeric protein characterized in that it comprises the scaffolding protein of claim 1 and; a fragment between 7 and 35 amino acids of a CDR3 of a vNAR with affinity for a specific antigen, which is inserted at the insertion site (XXX) between amino acids 11 and 12 of SEQ ID NO: 1, provided that said CDR3 fragment from vNAR generates a chimeric protein exhibiting an antigen binding strength of between 85 and 150% relative to the antigen binding strength of CDR3 from vNAR.

3. The antigen-binding chimeric protein according to claim 2, characterized in that the inserted fragment is a CDR3 fragment from a shark vNAR.

4. The antigen-binding chimeric protein according to claim 3, characterized in that the CDR3 fragment from shark vNAR is selected from the group consisting of CDR3 fragments of vNAR from Heterodontus fransisci, Orectolobus maculatus and Ginglymostoma cirratum sharks.

5. The use of the scaffolding protein of claim 1, for the generation of antigen-binding chimeric proteins, wherein is inserted between amino acids 11 and 12, into said scaffolding protein, a fragment of between 7 to 35 amino acids of a CDR3 from a vNAR with affinity for a specific antigen.

6. The use of the chimeric protein according to claim 2, as a medicine.

7. A pharmaceutical composition comprising a scaffolding protein according to claim 1 or a chimeric protein according to claim 2 and; a pharmaceutically acceptable vehicle.

8. The pharmaceutical composition according to claim 7, for the treatment of a pathology associated with the expression of an antigenic molecule.

9. The pharmaceutical composition according to claim 7, characterized in that it is adapted to be administered systemically or locally.

10. The pharmaceutical composition according to claim 8, characterized in that the pathology associated with the expression of an antigenic molecule is selected from the group consisting of autoimmune diseases, infectious diseases, chronic-degenerative diseases and neoplasms.

11. The use of the scaffolding protein of claim 1 or the chimeric protein of claim 2 to treat a pathology associated with the expression of an antigenic molecule.

12. The use according to claim 11, wherein the scaffolding protein and the chimeric protein are adapted to be administered systemically or locally.

13. The use according to claim 11, wherein the pathology associated with the expression of an antigenic molecule is selected from the group consisting of autoimmune diseases, infectious diseases, chronic-degenerative diseases, and neoplasms.

14. The use of the scaffolding protein of claim 1 or the chimeric protein of claim 2, in a kit for the in vitro detection of antigenic molecules.

15. The use of the pharmaceutical composition according to claim 7, for the treatment of a pathology associated with the expression of an antigenic molecule.

16. The use according to claim 15, wherein the pathology associated with the expression of an antigenic molecule is selected from the group consisting of autoimmune diseases, infectious diseases, chronic-degenerative diseases, and neoplasms.

17. The use according to claim 15, wherein the composition is adapted to be administered systemically or locally.

18. The use of the chimeric protein of claim 2, to detect or quantify antigens.

19. The use of the chimeric protein of claim 2, in the manufacture of detection tests for mammalian pathogens.

Description

DESCRIPTION OF THE FIGURES OF THE INVENTION

[0012] FIG. 1 illustrates a graph showing the results of the evaluation of the activity of the cal 14.1a scaffold, and how it loses its toxin activity when adding the CDR3 of a vNAR.

[0013] FIG. 2 shows a graph with the results of the recognition ELISA assay, where the interaction of the cal_P98Y chimeric protein with VEGF.sub.165 is shown.

[0014] FIG. 3 shows a series of images in which the behavior of the HUVEC cell line is observed in in-vitro neutralization assays with cal_P98Y.

[0015] FIG. 4 shows a graph summarizing the results of the in-vitro neutralization assay with cal_P98Y.

DETAILED DESCRIPTION OF THE INVENTION

[0016] The present invention provides a scaffolding protein having the following amino acid sequence;

TABLE-US-00001 SEQ ID NO: 1 Gly-Asp-Cys-Pro-Pro-Trp-Cys-Gly-Ala-Arg-Cys-  1  2  3  4  5  6  7  8  9  10  11  12 (XXX)-Cys

[0017] where (XXX) represents the scaffolding protein insertion site.

[0018] The SEQ ID NO:1 scaffolding protein of the present invention can be used as a framework for the rational design of antigen-binding chimeric proteins, with a final size between 19 and 47 amino acids. To obtain the aforementioned chimeric protein, a fragment of a CDR3 of a parental vNAR with affinity for a specific antigen, with a length of between 7 and 35 amino acids between positions 11 and 12, is inserted into said scaffolding protein, in such a way that, a chimeric protein is obtained that retains the affinity for the antigen to which the CDR3 of the parental vNAR was directed. The generated chimeric protein is subjected to an in silico analysis process to determine its theoretical stability, as well as its antigen binding strength. The selection process consists of performing the homology modeling of the chimeric protein with the MODELLER program. Subsequently, the refinement is carried out by means of molecular dynamics simulations with the NAMD program. Once the structures have been obtained, the protein-protein interaction analysis (Docking) is carried out with the ClusPro program, evaluating different binding and orientation zones in order to find the optimal structural conformation through two stages of docking. The first step consists of determining the contact patterns and the second step is based on the energetic analysis of the contact regions of each of the proteins in the ROSIE platform, using as a positive control, the interaction of the CDR3 of the parental vNAR with the antigenic molecule, to obtain a reference binding energy. In this way, the chimeric proteins generated, which present a binding strength of between 85 and 150%, with respect to the reference binding strength, are selected to be used.

[0019] The above-described construction allows the formed chimeric protein to maintain the ability to bind to the same epitope of the parent antibody, without losing effectiveness. In addition, due to the smaller size of the chimeric protein obtained, compared to the size of the parental antibody, it has a greater capacity to penetrate tissues. Likewise, due to their conformation, the chimeric proteins obtained present an improvement in their thermal stability, which increases their resistance to temperature changes.

[0020] The SEQ ID NO:1 scaffolding protein of the present invention, even when it is based on the structure of a conotoxin, does not present any type of toxic activity, since it does not present any amino acid sequence associated with the activity of the toxin (FIG. 1), so it can be used as a medicine in pathologies associated with the expression of a molecule or the blocking of a metabolic pathway. Likewise, the chimeric proteins obtained can be used in in vitro detection processes of antigenic molecules, such as, for example, those produced by the presence of a pathology.

[0021] The chimeric proteins obtained by inserting a fragment of a CDR3 of a vNAR with affinity for a specific antigen between amino acids 11 and 12 of SEQ ID NO: 1, have a size much smaller than that of an IgG type antibody, therefore, they are characterized by having greater penetration into tissues and also present two disulfide bonds in the scaffolding protein, which considerably improve their thermal stability, so that when used as an active component of a drug, they allow obtaining a better rate of penetration into tissues and also significantly improve their thermal stability, which has an impact on better handling and storage of the drug in which the chimeric proteins obtained with the present invention are used.

[0022] The chimeric proteins obtained using the scaffolding protein of SEQ ID NO: 1 of the present invention can be used in the manufacture of medicines intended to treat pathologies associated with the expression of a particular antigenic molecule produced by autoimmune diseases, infectious diseases, chronic-degenerative diseases and neoplasms. For example, chimeric proteins using the scaffolding protein of SEQ ID NO: 1 of the present invention can be designed to interact with antigenic molecules produced in various pathologies.

[0023] In addition, the chimeric proteins obtained using the scaffolding protein of SEQ ID NO:1 of the present invention can alternatively be used as antigen detection molecules in vitro. Due to their high thermal stability, the chimeric proteins obtained according to the teachings of the present invention can be placed in detection kits, being stored for longer periods than would be possible with other types of proteins.

[0024] In order to make more evident the technical advantages obtained by using the scaffolding protein of SEQ ID NO: 1 of the present invention, several chimeric proteins directed against different unrelated antigenic targets were generated, as shown in Table 1.

TABLE-US-00002 TABLE 1 Parental antibodies used and chimeric proteins generated. Target CDR3 antigen vNAR obtained chimeric protein VEGF.sub.165 C-P98Y GDCPPWCGARCKNLLPRYLVNGIAAMGYSSSC TGF-β N-T10 GDCPPWCGAPCHTKWGFFPLSWKLVGAALINR SC TGF-β N-T21 GDCPPWCGAPCQAKKWWAADPLLFLIGRWLNV GC CEA N-CV043 GDCPPWCGARCDMVWSWWGGWRPVRRLGWKGW SC TNF-α C-T16 GDCPPWCGARCKAQGLIDTSVRGLAVPGNCER CSSYHC TNF-α C-T65 GDCPPWCGARCKARESDYNRVGIRDYKDC PCSK9 N-PK13 GDCPPWCGARCARVWVSWVARAFFRGINFLPV FSC AMA1 N-14I-1 GDCPPWGARCFYSLPLRDYNYSLLC Lysozyme N-A07 GDCPPWCGARCESRYGSYDAECAALNDC SPIKE N-MSP24 GDCPPWCGARCRSVLQVGVSVGGLAYYC SARS- CoV-2

[0025] Once the chimeric proteins were generated from the binding of the selected fragment of the chosen parental antibody with the scaffolding protein of SEQ ID NO:1, the in silico binding strength thereof, with the binding site was compared with respect to the binding strength with the binding site of its parent antibody. Likewise, its thermal stability was evaluated in a comparative way. A summary of the results obtained is shown in Table 2.

TABLE-US-00003 TABLE 2 Comparison between the binding strength and the thermal stability of the parental antibodies against their chimeric proteins. Binding strength Organism VEGF.sub.165 Cal_P98Y −41.54 REU Heterodontus fransisci P98Y −45.54 REU VEGF.sub.165 Cal_VS04 −47.07 REU Heterodontus fransisci VS04 −49.00 REU TGF-β Cal_T10 −27.24 REU Heterodontus fransisci T10 −34.55 REU TGF-β Cal_T21 −34.02 REU Heterodontus fransisci T21 −38.26 REU TNF-α Cal_T16 −27.05 REU Heterodontus fransisci Tn16 −33.01 REU TNF-α Cal_T65 −28.34 REU Heterodontus fransisci Tn65 −34.01 REU PCSK9 Cal_pk13 −28.20 REU Heterodontus fransisci PK13 −20.39 REU AMA1 Cal_AMA1 −37.18 REU Orectolobus maculatus 14I-1 −36.53 REU Lysozyme Cal_lis −29.78 REU Ginglymostoma A07 −32.29 REU cirratum SPIKE SARS- Cal_MSP24 −25.37 REU Heterodontus fransisci CoV-2 MSP24 −34.18 REU

[0026] As can be seen, some of the chimeric proteins generated, collectively presented a greater binding strength with the binding site than their parental antibodies and, in addition, this strategy was tested with three sharks that are currently used to generate vNAR for commercial purposes, so it is clear that the described invention can be carried out in any suitable species of shark.

[0027] To demonstrate the function of the chimeric proteins obtainable in accordance with the teachings of the present invention, in-vitro assay of cal 14.1a scaffold activity was performed. The “complete” scaffold has the effect of inhibiting TNF expression in HUVEC cell culture. As can be seen in FIG. 1, the negative control that did not express TNF in the culture is observed. When LPS+IFN was added, TNF expression increased, when only the scaffold was added, there was no expression, and when the chimeric was added, there was no expression. These last two trials were without LPS or Interferon. On the other hand, the “complete” scaffold is observed plus LPS and Interferon, and it is seen how the scaffold inhibited the TNF expression (toxin effector function). However, when the chimeric protein plus LPS and Interferon were added, no inhibition of TNF expression was observed. Therefore, the chimeric protein did not inhibit, that is, the scaffold loses its biological activity and only works as a scaffold to place other sequences.

[0028] In another test, an ELISA assay was performed to identify the interaction of cal_P98Y chimeric protein with VEGF.sub.165 (FIG. 2). For this, the comparison with its parental vNAR was made. As can be seen in the graph shown in FIG. 2, the chimeric protein has the ability to recognize the antigen against which the parental vNAR is targeting.

[0029] Finally, an in vitro neutralization assay was performed. As can be seen in FIG. 3, VEGF generates angiogenesis. In panel A, HUVEC cells are observed in culture medium, with little angiogenesis; in panel B, cells plus VEGF are observed, therefore angiogenesis is increased; in panel C, cells plus VEGF plus the parental antibody are seen, observing an inhibition of angiogenesis and; in panel D, cells plus VEGF plus the chimeric molecule are seen, and the inhibition of angiogenesis is appreciated with respect to panel B. FIG. 4 shows the graphical representation of the four experimental conditions shown in the panels of the FIG. 3, showing that the Cal_P98Y chimeric protein inhibits VEGF, which corroborates that the present invention makes it possible to obtain functional chimeric proteins.

[0030] The present invention has been described in accordance with one of its preferred embodiments; however, it will be apparent to a technician with average knowledge in the matter, that modifications may be made to the invention, without departing from its spirit and scope.