Innovative method for improving enzyme activity of NMN biosynthetic enzyme Nampt
11492627 · 2022-11-08
Assignee
Inventors
- Liqing ZHAO (Guangdong, CN)
- Jiansheng Chen (Guangdong, CN)
- Zhigang Duan (Guangdong, CN)
- Haichao Zhang (Guangdong, CN)
- Beijia Huang (Guangdong, CN)
Cpc classification
C12Y204/02012
CHEMISTRY; METALLURGY
C12N15/70
CHEMISTRY; METALLURGY
International classification
C12N15/70
CHEMISTRY; METALLURGY
C12N15/00
CHEMISTRY; METALLURGY
Abstract
The present disclosure provides an innovative method for improving the enzyme activity of an NMN biosynthetic enzyme Nampt, and relates to the technical field of genetic engineering. A mutant protein of the present disclosure is obtained by firstly analyzing a target protein Nampt using two softwares FoldX and DeepDDG, and then predicting multiple key sites influencing the enzyme functions and finally performing the semi-rational design of the enzyme. In the examples of the present disclosure, 10 mutant strains are constructed using the designed primers according to the principle of point mutation, and 8 of the mutants have higher activity than a wild-type strain, in which the NMN yield of the mutant Nampt-V365L is increased by 62%, and the NMN yields of the mutants Nampt-S248A, Nampt-N164L, Nampt-S382M, Nampt-A245T and Nampt-A208G are increased by 34%, 27%, 27%, 22% and 17% respectively.
Claims
1. A recombinant expression vector comprising a nucleotide sequence encoding a mutant protein of a nicotinamide phosphoribosyltransferase Nampt, wherein the mutant protein of the nicotinamide phosphoribosyltransferase Nampt has a point mutation on an amino acid sequence of the nicotinamide phosphoribosyltransferase Nampt, the amino acid sequence of the nicotinamide phosphoribosyltransferase Nampt comprises a sequence shown in SEQ ID NO:1; wherein sites of the point mutation are: N67K, N164L, R166W, A208G, A245T, S248A, V365L or S382M; wherein the nucleotide sequence has a sequence shown in SEQ ID NO:2 with base changes compared of 202_204aac>aaa corresponding to N67K, 493_495aac>ctg corresponding to N164L, 499_501cgc>tgg corresponding to R166W, 625_627gct>ggc corresponding to A208G, 736_738gct>acc corresponding to A245T, 745_747tca>gcg corresponding to S248A, 1096_1098gtt>ctg corresponding to V365L, or 1147_1149tca>atg corresponding to S382M.
2. The recombinant expression vector according to claim 1, wherein a basic vector of the recombinant expression vector is a pPSUMO vector, and the nucleotide sequence encoding the mutant protein of the nicotinamide phosphoribosyltransferase Nampt is connected between HindIII and NdeI enzyme digestion sites of the pPSUMO vector.
3. A recombinant bacteria expressing the recombinant expression vector of claim 1.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
DETAILED DESCRIPTION
(4) The present disclosure provides a mutant protein of a nicotinamide phosphoribosyltransferase Nampt configured to perform point mutation on the amino acid sequence of the nicotinamide phosphoribosyltransferase Nampt, in which the amino acid sequence of the nicotinamide phosphoribosyltransferase Nampt includes a sequence shown in SEQ ID NO:1: GNAAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKT ENSKVRKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAKEVYREHFQDDVFNER GWNYILEKYDGHLPIEVKAVPEGSVIPRGNVLFTVENTDPECYWLTNWIETILVQS WYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASAH LVNFKGTDTVAGIALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVT QFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTEAPLIIRPDSGNPLDTVLKVL DILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINTLQEIVEGMKQKKWSIENVSFG SGGALLQKLTRDLLNCSFKCSYVVTNGLGVNVFKDPVADPNKRSKKGRLSLHRTP AGNFVTLEEGKGDLEEYGHDLLHTVFKNGKVTKSYSFDEVRKNAQLNIEQDVAPH; and
(5) sites of the point mutation include: N67K, N164L, R166W, A208G, A245T, S248A, V365L or S382M.
(6) The present disclosure preferably integrates the methods of sequence-based conservation analysis and structure-based Gibbs free energy change analysis and employs two softwares FoldX and DeepDDG to predict a high-quality mutation site. The software FoldX simulates the influence of the mutation site on the protein unfolding free energy (ΔG) using a bioinformatics method. If the mutant ΔG (mutant) is less than the wild-type ΔG (wild), the mutation has a positive role on the thermal stability of the protein. If ΔG is increased after mutation, the mutation site is unfavorable for the stability of the protein. The software DeepDDG in protein engineering can accurately predict a change in the protein stability caused by point mutation. DeepDDG analysis is a method based on a neutral network, and the neutral network has already been tested on more than 5,700 manually planned experimental data points. As for three independent test sets, the Pearson's correlation coefficient is 0.48-0.56. The results of the software analysis indicate that the solubility of a mutant residue and the contact area are the most important features, which indicates that the buried hydrophobic area is a major factor determining the protein stability. With the above-mentioned method, a total of 10 mutation sites are selected in the examples of the present application, namely, N67K, S155I, N164L, R166W, A208G, A245T, S248A, V365L, S382M and V467L, and changes of the above-mentioned 10 mutation sites in the amino acid and nucleotide sequence are shown in Table 1.
(7) TABLE-US-00001 TABLE 1 Changes in amino acid and nucleotide sequence in point mutation Changes of Base Changes of Base Site amino acid changes Site amino acid changes N67K N.fwdarw.K aac-aaa A245T A.fwdarw.T gct-acc N164L N.fwdarw.L aac-ctg S248A S.fwdarw.A tca-gcg R166W R.fwdarw.W cgc-tgg V365L V.fwdarw.L gtt-ctg A208G A.fwdarw.G gct-ggc S382M S.fwdarw.M tca-atg S155I S.fwdarw.I tca-atc V467L V.fwdarw.L gta-ctg
(8) The present disclosure further provides a recombinant expression vector including a nucleotide sequence encoding the above-mentioned mutant protein.
(9) A basic vector of the recombinant expression vector of the present disclosure preferably includes a pPSUMO vector, and the nucleotide sequence encoding the mutant protein is preferably connected between the HindIII and NdeI enzyme digestion sites of the pPSUMO vector.
(10) The present disclosure further provides recombinant bacteria expressing the mutant protein or including the above-mentioned recombinant expression vector.
(11) A basic strain of the recombinant bacteria of the present disclosure preferably includes Escherichia coli.
(12) The present disclosure further provides a construction method for the recombinant bacteria, including the following steps: (1) performing codon optimization on a gene encoding the amino acid sequence shown in SEQ ID NO:1, to obtain an optimized gene;
(13) (2) performing a PCR amplification using a site-directed mutation primer and a high-fidelity enzyme respectively by taking the optimized gene as a template, to obtain amplification products;
(14) (3) digesting the amplification products with a DpnI enzyme respectively, and then connecting to the pPSUMO vector respectively, to obtain a recombinant expression vector; and
(15) (4) transforming the recombinant expression vector into E. coli competent cells respectively, and picking positive clones, to obtain the recombinant bacteria.
(16) The present disclosure performs codon optimization on a gene encoding the amino acid sequence shown in SEQ ID NO:1, to obtain an optimized gene. The present disclosure preferably adopts a codon fitting the E. coli preference to carry out codon optimization, and the nucleotide sequence of the obtained optimized gene includes a sequence (1,482 bp) shown in SEQ ID NO:2: CATATGAACGCTGCTGCTGAGGCCGAGTTCAATATATTGT TAGCGACCGACTCGTACAAGGTCACGCATTATAAACAGTATCCTCCTAACACAT CAAAGGTCTACTCATATTTCGAGTGCCGCGAGAAGAAGACGGAGAACTCGAAA GTCCGAAAGGTGAAGTATGAAGAAACAGTGTTCTACGGGCTTCAGTATATTCTT AACAAATATCTTAAAGGCAAAGTTGTTACAAAGGAGAAGATCCAGGAAGCTAA AGAAGTTTATCGCGAACATTTCCAAGACGATGTCTTCAATGAGCGCGGCTGGA ACTATATTCTTGAGAAGTACGACGGCCATCTICCTATTGAAGTTAAAGCTGTTC CTGAAGGCTCAGTTATTCCTCGCGGCAACGTCCTGTTTACCGTCGAGAATACGG ATCCTGAATGTTATTGGCTTACAAACTGGATTGAAACAATFCTTGTTCAGTCAT GGTATCCTATTACAGTTGCTACAAACTCACGCGAACAGAAGAAGATCCTAGCT AAATATCTTCTGAAACATCAGGCAACCTTGATGGCCTTGAATATAAACTTCAT GATTTCGGGTACCGCGGCGTTTCATCACAGGAAACAGCTGGCATTGGCGCTTCA GCTCATCTTGTTAACTTTAAAGGCACAGATACAGTTGCTGGCATTGCTCTTATT AAGAAGTACTACGGCACAAAGGACCCAGTTCCTGGTTATTCAGTTCCTGCTGCT GAACATTCAACAATTACAGCTTGGGGAAAGGATCATGAGAAGGACGCGTTCGA GCACATTGTTACACAGTTCAGTAGTGTTCCTGTITCAGTTGTTTCAGATTCTTAT GATATTTATAACGCTTGTGAGAAGATCTGGGGAGAGGACCTTCGCCATCTTATT GTTTCACGCTCAACAGAAGCTCCTCTTATTATTCGCCCTGATTCAGGCAACCCT CTTGATACAGTTCTTAAAGTTCTTGATATTCTTGGCAAGAAGTTCCCGGTTACC GAGAATTCCAAGGGTTATAAACTTCTTCCTCCTTATCTTCGCGTTATTCAGGGC GATGGCGTTGATATTAACACACTTCAGGAAATTGTTGAAGGCATGAAACAGAA GAAGTGGTCCATTGAGAATGTCTCATrTGGCTCAGGCGGCGCTCTTCTTCAGAA ACTTACACGCGATCTTCTTAACTGTTCATTTAAATGTTCTTATGTTGTTACAAAC GGCCTTGGCGTTAACGTGTTCAAAGATCCCGTAGCAGACCCTAACAAACGCTC AAAGAAGGGTCGACTTTCACTTCATCGCACACCTGCTGGCAACTITGTTACACT TGAAGAAGGCAAAGGCGATCTTGAAGAATATGGCCATGATCTTCTTCATACAG TGTTCAAGAATGGCAAGGTAACGAAGTCCTACTCATTTGATGAAGTTCGCAAG AATGCGCAGCTTAACATTGAACAGGATGTTGCTCCTCATAAGCTT.
(17) After the optimized gene is obtained, the present disclosure performs PCR amplification using a site-directed mutation primer and a high-fidelity enzyme by taking the optimized gene as a template, to obtain amplification products. The high-fidelity enzyme of the present disclosure preferably includes a KOD-Plus-Neo enzyme, which is purchased from Toyobo (Shanghai) Biotech Co., Ltd.
(18) The preferred information of the site-directed mutation primer of the present disclosure is shown in Table 2:
(19) TABLE-US-00002 TABLE 2 Information of site-directed mutation primer Primer name Primer sequence (5′ to 3′) SEQ ID NO: Tm(°C.) N67K-F cgggcttcagtatattcttaaaaaatatcttaaagg 3 56 N67K-R tttaagaatatactgaagcccgtagaacactGT 4 60 S155I-F ggattgaaacaattcttgttcagatctggtatccta 19 53 S155I-R gatctgaacaagaattgtttcaatccagtttg 20 59 N164L-F cctattacagttgctacactgtcacgcgaac 5 54 N164L-R cagtgtagcaactgtaataggataccat 6 53 R166W-F gttgctacaaactcatgggaacagaagaag 7 56 R166W-R ccatgagtttgtagcaactgtaataggatacc 8 57 A208G-F ggaaacagctggcattggcggctcagctcatct 9 63 A208G-R gccgccaatgccagctgtttcctgtgatgaaac 10 66 A245T-F cctggttattcagttcctgctaccgaacattcaac 11 57 A245T-R ggtagcaggaactgaataaccaggaactg 12 61 S248A-F tcctgctgctgaacatgcgacaattacag 13 56 S248A-R actatgttcagcagcaggaactgaataac 14 60 V365L-F attaacacacttcaggaaattctggaaggcatgaaac 15 55 V365L-R cagaatttcctgaagtgtgttaatatcaacg 16 57 S382M-F attgagaatgtctcatttggcatgggcggcgctc 17 61 S382M-R catgccaaatgagacattctcaatggacc 18 60 V467L-F agtgttcaagaatggcaagctgacgaagtcctactc 21 58 V467L-R cagcttgccattcttgaacactgtatgaagaag 22 60
(20) In the primer design of the present disclosure, mutation sites are preferably located on two primers, namely, on the downstream part of an overlap area of a forward mutation primer and adjacent to the overlap area, and at the 5′ end of a backward mutation primer. The primer includes a 5′ end overlap area and a 3′ end extension area. Except the mutation sites, the length of each primer is about 25-30 bp, the 5′ end overlap area includes 15-20 bases, and the 3′ end extension area includes at least 10 bases.
(21) The PCR amplification system of the present disclosure, calculated in 50 μL, preferably includes 1.5 μL of mutation primers F/R (10 μM) respectively, 5 μL of 10×PCR Buffer for KOD-Plus-Neo, 5 μL of 2 mM dNTPs, 3 μL of 25 mM MgSO.sub.4, DNA template<1 ng, 1 μL of KOD-Plus-Neo (1 U/μL), and the balance of ddH.sub.2O, adding up to 50 μL. In the present disclosure, the system is prepared preferably on ice, and the KOD-Plus-Neo enzyme is added last, so as to guarantee the enzyme activity. In the present disclosure, a procedure of the PCR amplification preferably includes: initial denaturation at 94° C. for 2 min, denaturation at 98° C. for 10 s, annealing at 55-65° C. for 30 s, and extension at 68° C. for 4 min, 30 cycles; and extension at 68° C. for 4 min.
(22) After amplification products are obtained, the amplification products are digested with a DpnI enzyme respectively, and then connected to the pPSUMO vector respectively, to obtain a recombinant expression vector. The present disclosure preferably uses a DpnI fast digestion enzyme of the Takara company to eliminate methylation in the template DNA (not mutated), and the enzyme digestion system, calculated in 50 μL, preferably includes: 1 μL of the DpnI enzyme, 5 μL of 10×Quickcut Buffer, the amplification products<1 μL, and the balance of ddH.sub.2O, adding up to 50 μL. The digestion of the present disclosure preferably includes: putting the enzyme digestion system in a constant-temperature incubator at 37° C., letting it stand and performing enzyme digestion for 3 h; heating in a metal bath at 85° C. for 5 min; and after the enzyme is deactivated, temporarily storing at 4° C.
(23) In the present disclosure, the amplification products digested by the DpnI enzyme are connected to the pPSUMO vector to obtain the recombinant expression vector, and the connection preferably includes connecting between the HindIII and NdeIenzyme digestion sites of the pPSUMO vector. The present disclosure does not impose special limitations on the connection method, and the connection may be implemented using a conventional method in the art.
(24) After the recombinant expression vector is obtained, the recombinant expression vector is transformed into E. coli competent cells, and positive clones are picked, to obtain the recombinant bacteria.
(25) The present disclosure does not impose special limitations on the transformation method, and the transformation may be implemented using a conventional method in the art. In the screening of positive clones, the present disclosure preferably adopts a sterile toothpick to pick single colony in a panel and puts in 20 μL of sterile ddH2O, then the mixture is heated in a metal bath at 95° C. for 5 min and centrifuged at a high speed of 13,000 rpm for 2 min, and the supernatant can be used as a PCR verification template. After that, the primers Nampt-F (SEQ ID NO:23: taatccttattcagtggtggtggtggtggtgctc) and Nampt-R (SEQ ID NO:24: aggaagcttgcatatgaacgctgctgctg) can be utilized to perform bacterial liquid PCR.
(26) In the present disclosure, a system of the bacterial liquid PCR, calculated in 50 μL, preferably includes: 25 μL of Premix Taq, 1 μL of Nampt-F/R respectively, a template<1 ng, and the balance of ddH.sub.2O, adding up to 50 μL. In the present disclosure, a procedure of the bacterial liquid PCR preferably includes: initial denaturation at 94° C. for 2 min, denaturation at 98° C. for 10 s, annealing at 55° C. for 15 s, and extension at 72° C. for 30 s, 30 cycles; and extension at 72° C. for 2 min. The present disclosure preferably performs verification sequencing on the positive clones picked by the bacterial liquid PCR, and the positive clones correct according to the sequencing are the recombinant bacteria.
(27) After the recombinant bacteria are obtained, the present disclosure preferably takes the yield of nicotinamide mononucleotide (NMN) as a basis for screening nicotinamide phosphoribosyltransferase (Nampt) positive mutant strains, and a transformation system generating NMN, calculated in 25 μL, preferably includes: 12.5 μL of crude enzyme liquid and 12.5 μL of mother liquid (1 mM NAM, 1 mM PRPP, 1 mM MnCl.sub.2 and 1 mM MgCl.sub.2). In the present disclosure, the above-mentioned transformation system is mixed evenly, allowed to react for 15 min in a shaking table at a speed of 180 rpm and a temperature of 37° C., and then heated for 1 min in a metal bath at 95° C., to deactivate the enzyme and terminate the reaction. After that, the product is diluted to 500 μL using a PBS buffer solution with pH of 6.0, centrifuged at a speed of 10,000 rpm for 5 min, filtered with a 0.22 μm microporous filter membrane to remove the bacteria, and transferred into a liquid-phase vial; and the yield of NMN is measured by HPLC. It is verified that among the 10 mutants obtained by the present disclosure, the mutants having higher catalytic activity than a wild-type Nampt strain (E. coli DH5 α-ppsumo-Nampt) are N67K, N164L, R166W, A208G, A245T, S248A, V365L and S382M; and the strains having a decreased catalytic activity are S155I and V476L.
(28) The present disclosure does not impose special limitations on a construction method of the wild-type Nampt strain (E. coli DH5 α-ppsumo-Nampt), preferably adopts a method of double enzyme digestion for construction, more preferably adopts a mouse-derived nicotinamide phosphoribosyltransferase (mNampt) sequence (with an amino acid sequence shown in SEQ ID NO:1) synthesized by Suzhou GENEWIZ, and constructs it in a vector pET-30a and clones into the cells E. coli-DH5 α and E. coli BL21 (DE3). The two ends of the target gene contain enzyme digestion sites Hind III and Nde I, and a label 6×His is added to the tail, to obtain E. coli DH5 α-ppsumo-Nampt.
(29) The innovative method for improving the enzyme activity of an NMN biosynthetic enzyme Nampt provided by the present disclosure is elaborated below in conjunction with examples, which should not be interpreted as a limit on the protection scope of the present disclosure.
Example 1
(30) (1) A strain E. coli DH5 α-ppsumo-Nampt preserved in 200 μL of glycerin was sucked with a pipette and inoculated to 20 mL of a LB medium (containing 50 μg/mL kanamycin), and cultured overnight through oscillation in a constant-temperature shaking table at a speed of 200 rpm and a temperature of 37° C.; plasmids were extracted with a kit Plasmid Mini Kit I (100) (purchased from OMEGA).
(31) (2) A PCR amplification system (50 μL) was prepared on ice, and a KOD-Plus-Neo enzyme was added finally to guarantee the enzyme activity: 1.5 μL of mutation primers F/R (10 μM) respectively, 5 μL of 10×PCR Buffer for KOD-Plus-Neo, 5 μL of 2 mM dNTPs, 3 μL of 25 mM MgSO.sub.4, a DNA template<1 ng, 1 μL of KOD-Plus-Neo (1 U/μL), and the balance of ddH.sub.2O, adding up to 50 μL.
(32) The mutation primers involved were the primers shown in Table 2, synthesized by the Aiji Biotechnology Co., Ltd.
(33) A procedure of the PCR amplification was initial denaturation at 94° C. for 2 min, denaturation at 98° C. for 10 s, annealing at 55-65° C. for 30 s, and extension at 68° C. for 4 min, 30 cycles; extension at 68° C. for 4 min; and storage at 4° C.;
(34) (3) 5 μL of the PCR reaction product was taken and added with 1 μL of 6×Loading Buffer, and transferred by a sample application tip into an agarose gel hole for electrophoresis, and the electrophoresis was performed for 25 min at a voltage of 120 V and at room temperature.
(35) (4) Methylation in the template DNA (not mutated) was eliminated using a DpnI fast digestion enzyme of the Takara company, the enzyme digestion system (50 μL): 1 μL of the DpnI enzyme, 5 μL of 10×Quickcut Buffer, the amplification products in (2)<1 μL, and the balance of ddH.sub.2O, adding up to 50 μL. The digestion of the present disclosure preferably included: putting the enzyme digestion system in a constant-temperature incubator at 37° C., letting it stand and performing enzyme digestion for 3 h; heating for 5 min in a metal bath at 85° C.; and after the enzyme is deactivated, temporarily storing at 4° C.; connecting between the enzyme digestion sites Hind III and Nde I of the pPSUMO vector using a method of double enzyme digestion, and then transforming into E. coli BL21 (DE3) competent cells.
(36) (5) The recombinant bacteria were introduced into a solid agar medium with resistance against kanamycin (50 μg/mL), single colony in a panel was picked with a sterile toothpick and put in 20 μl of sterile ddH.sub.2O, heated for 5 min in a metal bath at 95° C., and centrifuged for 2 min at a high speed of 13,000 rpm, in which the supernatant can be used as a PCR verifying template: 25 μL of Premix Taq, 1 μL of Nampt-F/R respectively, a template<1 ng, and the balance of ddH.sub.2O, adding up to 50 μL.
(37) The procedure preferably included: initial denaturation at 94° C. for 2 min, denaturation at 98° C. for 10 s, annealing at 55° C. for 15 s, and extension at 72° C. for 30 s, 30 cycles; extension at 72° C. for 2 min; and storage at 4° C.
(38) (6) 1% of the positive clones having stripes verified (at least 3 per panel,
(39) The primers for sequencing are listed in Table 3.
(40) TABLE-US-00003 TABLE 3 Sequencing primers at mutation sites Sequencing site Primer name Primer sequence (5′ to 3′) SEQ ID NO. N67K CX-67-F aaaggtctactcatatttcgagtgccg 25 CX-67-R tctgttcgcgtgagtttgtagca 26 S155I, CX-155, 164, 166, gtacgacggccatcttcctattga 27 N164L 208-F R166W, CX-155, 164, 166, gaactgggtcctttgtgccgtag 28 A208G 208-R A245T, CX-245, 248-F ggcgcttcagctcatcttgttaa 29 S248A CX-245, 248-R tgaataacgcgaagataaggaggaag 30 V365L, CX-365, 382-F agaggaccttcgccatcttattg 31 S382M CX-365, 382-R aggacttcgttaccttgccattc 32 V467L CX-467-F gttcaaagatcccgtagcagacc 33 CX-467-R gctagttattgctcagcggtggc 34
Example 2
(41) The 10 mutants obtained in the example 1 were subjected to SDS-PAGE electrophoresis for expression verification
(42) 1. Induced Expression
(43) (1) Seed culture: 100 μL of bacterial liquid was taken from a glycerin tube and inoculated in a conical flask (10 mL/50 mL) containing a LB liquid medium of Kana (50 μg/mL) according to an inoculation amount of 1%, and cultured for 12 h through oscillation in a constant-temperature shaking table at a speed of 200 rpm and a temperature of 37° C.
(44) (2) Fermentation culture: the seed liquid was inoculated in a conical flask (100 mL/500 mL) containing a Kana resistant LB liquid medium according to an inoculation amount of 2%, and cultured for 2-3 h in a constant-temperature shaking table at a speed of 180 rpm and a temperature of 37° C. until the optical density OD.sub.600 reached 0.5-0.6; then 0.25 mM IPTG was added, and induced expression was performed for 12 h at a speed of 180 rpm and a temperature of 30° C.
(45) 2. Sample Pretreatment
(46) (1) 1 mL of bacterial liquid was taken into a 1.5 mL EP tube, and centrifuged for 3 min at a speed of 6,000 rpm and a temperature of 25° C.; the supernatant was discarded.
(47) (2) 1 mL of a PBS buffer solution with pH of 7.4 was added to resuspend the bacteria.
(48) (3) The optical density OD.sub.600 was adjusted to 1.0, 10 μL of 4×Protein Loading Buffer was added into 30 μL of the bacterial solution in (2), and the mixture was oscillated and mixed evenly.
(49) (4) The mixture was boiled for 10 min.
(50) (5) The mixture was centrifuged instantaneously for 3 min, 20 μL of the supernatant was taken and loaded as a sample, and subjected to SDS-PAGE gel electrophoresis: 30 min at 90 V, and then 1.5 h at a voltage adjusted to 120 V.
(51) 3. Test on the Activity of Nampt Enzyme after Mutation
(52) (1) Preparation of crude enzyme liquid: 1) 10 mL of bacterial liquid was taken into a 50 mL centrifugal tube, and centrifuged for 20 min at a speed of 4.000 rpm and a temperature of 4° C.; the supernatant was discarded.
(53) 2) 10 mL of a PBS buffer solution with pH of 7.4 was added to blow, beat and resuspend the bacteria, and the bacteria were put in an ice box;
(54) 3) 200 μL of the cell solution in 2) was sucked to a 96-pore ELISA plate, and the optical density OD.sub.600 of cells was adjusted to 1.0.
(55) 4) 10 mL of the product of 3) was taken and centrifuged for 20 min at a speed of 4,000 rpm and a temperature of 4° C., and re-suspended with 2 mL of a PBS buffer solution and concentrated 5 times.
(56) 5) A clean 25 mL small beaker was prepared, and the cell liquid was poured into the beaker and put in an ice-water bath.
(57) 6) The parameters of an ultrasonic cell disrupter were set as: power of 30%, work for 5 s and pause for 5 s, and ultrasonic disruption of cells was performed for 10 min.
(58) 7) after the disruption was completed, the supernatant was centrifuged for 20 min at a speed of 4,000 rpm and a temperature of 4° C., to obtain crude enzyme liquid which can be stored in a −20° C. refrigerator.
(59) (2) Transformation reaction: a transformation system: 12.5 μl of the crude enzyme liquid and 12.5 μl of mother liquid (1 mM NAM, 1 mM PRPP, 1 mM MnCl.sub.2, 1 mM MgCl.sub.2) were mixed evenly, and allowed to react for 15 min in a shaking table at a speed of 180 rpm and a temperature of 37° C.; then the mixture was heated for 1 min in a metal bath at 95° C., to deactivate the enzyme and terminate the reaction. The product was diluted to 500 μL using a PBS buffer solution with pH of 6.0, centrifuged for 5 min at a speed of 10,000 rpm, filtered with a 0.22 μm microporous filter membrane to remove the bacteria, and then transferred into a liquid-phase vial; and the yield of NMN was measured by HPLC.
(60) The measurement conditions of HPLC:
(61) {circle around (1)} Chromatographic column: ChromCore C18 reversed phase column 5 μm, 4.6×250 mm.
(62) Mobile phase: A=phosphate buffer solution (pH 3.5), B=100% methanol.
(63) Column temperature: 25° C.
(64) Flow rate: 1.0 mL/min, ultraviolet detection at a wavelength of 260 nm, and a sample size of 20 μL.
(65) {circle around (2)} Determination of a Standard Curve
(66) 10-15 mg of a nicotinamide mononucleotide standard was weighed and added with sterile ddH.sub.2O to 25 mL, and diluted with ddH.sub.2O by 10 times, as 100% NMN standard liquid; then the 100% NMN standard liquid was diluted to NMN standard liquids with concentrations of 1%, 10%, 20%, 40%, 60% and 80% respectively; the NMN standard liquids were filtered with a 0.22 μm microporous filter membrane to remove bacteria; the peaking areas of NMN with different concentrations were determined by HPLC; and an NMN standard curve was drawn by taking the NMN concentrations as horizontal coordinates and the peak areas as vertical coordinates.
(67) {circle around (3)} NMN in the Reaction Liquid Measured by HPLC
(68) (1) Pretreatment of sample loading: the transformed liquid after reaction was diluted by 20 times to 500 μl in a 1.5 mL EP tube, and centrifuged for 3 min at a speed of 10,000 rpm and at room temperature; the centrifuged supernatant was sucked with a sterile 1 mL syringe needle, filtered with a disposable sterile 0.22 μm microporous filter membrane to remove bacteria, and transferred into a HPLC-specific liquid-phase vial, to obtain a to-be-measured sample.
(69) (2) The liquid-phase vial was put in an automatic sample loader of HPLC, and the yield of NMN after the enzyme transformation reaction was measured according to the parameters and conditions of HPLC set in Q of the method.
(70) The results are shown in
(71) Only preferred embodiments of the present disclosure are described above. It should be noted that those of ordinary skill in the art also may make multiple improvements and modifications without departing from the principles of the present disclosure, and these improvements and modifications should be considered to be within the protection scope of the present disclosure.