INDIVIDUALIZED VACCINES FOR CANCER

20220282322 · 2022-09-08

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention relates to the provision of vaccines which are specific for a patient's tumor and are potentially useful for immunotherapy of the primary tumor as well as tumor metastases. In one aspect, the present invention relates to a method for providing an individualized cancer vaccine comprising the steps: (a) identifying cancer specific somatic mutations in a tumor specimen of a cancer patient to provide a cancer mutation signature of the patient; and (b) providing a vaccine featuring the cancer mutation signature obtained in step (a). In a further aspect, the present invention relates to vaccines which are obtainable by said method.

    Claims

    1-45. (canceled)

    46. A method for preparing an individualized cancer vaccine comprising the steps: (a) identifying in a tumor specimen of a cancer patient cancer specific somatic mutations to provide a cancer mutation signature of the patient comprising cancer specific somatic mutations, wherein the cancer cells of the patient express antigens comprising said mutations and wherein said mutations are not found in non-cancerous cells of the patient; and (b) preparing an RNA vaccine featuring the cancer mutation signature obtained in step (a), wherein the RNA vaccine comprises RNA encoding a recombinant polyepitopic polypeptide comprising neo-epitopes comprising said mutations fused together by peptide bonds or linkers.

    47. The method according to claim 46, wherein the step of identifying cancer specific somatic mutations comprises identifying the cancer mutation signature of the exome of one or more cancer cells.

    48. The method according to 46, wherein the step of identifying cancer specific somatic mutations comprises single cell sequencing of one or more cancer cells.

    49. The method according to claim 48, wherein the cancer cells are circulating tumor cells.

    50. The method according to claim 46, wherein the step of identifying cancer specific somatic mutations involves using next generation sequencing (NGS).

    51. The method according to claim 46, wherein the step of identifying cancer specific somatic mutations comprises sequencing genomic DNA and/or RNA of the tumor specimen.

    52. The method according to claim 46, wherein the step of identifying cancer specific somatic mutations is replicated at least in duplicates.

    53. The method according to claim 46, comprising the further step of determining the usability of the identified mutations in epitopes for cancer vaccination, wherein determining the usability comprises one or more of the following: (i) assessing whether the identified mutations are located in known or predicted WIC presented epitopes, (ii) in vitro and/or in silico testing whether the identified mutations are located in WIC presented epitopes, and (iii) in vitro testing whether the identified mutations are able to stimulate T cells of the patient having the desired specificity.

    54. The method according to claim 46, wherein the polypeptide comprises 5 or more, 10 or more, or 20 or more neo-epitopes.

    55. The method according to claim 46, wherein the polypeptide comprises up to 30 neo-epitopes.

    56. The method according to claim 46, wherein the polypeptide further comprises epitopes not containing cancer specific somatic mutations which are expressed by cancer cells.

    57. The method according to claim 46, wherein the polypeptide comprises neo-epitopes that are based on primary basal mutations.

    58. The method according to claim 46, wherein the neo-epitopes are flanked by amino acid sequences flanking said neo-epitopes in the naturally occurring protein so as to form a vaccine sequence.

    59. The method according to claim 46, wherein the neo-epitopes are lined up head-to-tail.

    60. The method according to claim 46, wherein the neo-epitopes are spaced by linkers.

    61. The method according to claim 46, wherein the RNA further comprises an unmasked poly-A sequence.

    62. The method according to claim 61, wherein the unmasked poly-A sequence has a length of approximately 120 adenosine residues.

    63. The method according to claim 46, wherein the RNA further comprises a 3′ UTR.

    64. The method according to claim 46, wherein the recombinant polyepitopic polypeptide encoded by the RNA further comprises an MHC class I signal peptide fragment, a transmembrane domain or a cytosolic domain.

    65. The method according to claim 60, wherein at least 50% of the amino acids of the linkers are glycine and/or serine residues.

    66. The method according to claim 46, wherein the RNA further comprises a 5′ cap.

    67. The method according to claim 66, wherein the 5′ cap is: ##STR00002## wherein R.sub.1 and R.sub.2 are independently hydroxy or methoxy, and W, X, and Y are independently oxygen, sulfur, selenium or BH.sub.3.

    68. The method according to claim 67, wherein R.sub.1 and R.sub.2 are hydroxy, and W, X, and Y are oxygen.

    69. The method according to claim 67, wherein one of R.sub.1 and R.sub.2 is hydroxy, the other one is methoxy, and W, X, and Y are oxygen.

    70. The method according to claim 67, wherein X is sulfur.

    71. The method according to claim 70, wherein W and Y are oxygen.

    72. The method according to claim 66, wherein the 5′ cap is m.sub.2.sup.7,2′-OGpp.sub.spG.

    73. The method according to claim 72, wherein m.sub.2.sup.7,2′-OGpp.sub.spG is in the Rp diastereoisomeric form.

    74. The method according to claim 72, wherein m.sub.2.sup.7,2′-OGpp.sub.spG is in the Sp diastereoisomeric form.

    75. An RNA vaccine which is obtained by the method according to claim 46, wherein the vaccine, when administered to the patient, provides a collection of MHC presented epitopes incorporating sequence changes based on the identified mutations.

    76. The RNA vaccine according to claim 75, wherein the MHC presented epitopes are MHC class II-presented epitopes that elicit a CD4+ helper T cell response against cells expressing antigens from which the MHC presented epitopes are derived and/or MHC class I-presented epitopes that elicit a CD8+ T cell response against cells expressing antigens from which the MHC presented epitopes are derived.

    77. An RNA vaccine comprising RNA encoding a recombinant polypeptide comprising neo-epitopes fused together by peptide bonds or linkers, said neo-epitopes resulting from cancer specific somatic mutations in a tumor specimen of a cancer patient.

    78. The RNA vaccine according to claim 77, wherein the polypeptide comprises 5 or more, 10 or more, or 20 or more neo-epitopes.

    79. The RNA vaccine according to claim 77, wherein the polypeptide comprises up to 30 neo-epitopes.

    80. The RNA vaccine according to claim 77, wherein the polypeptide further comprises epitopes not containing cancer specific somatic mutations which are expressed by cancer cells.

    81. The RNA vaccine according to claim 77, wherein the polypeptide comprises neo-epitopes that are based on primary basal mutations.

    82. The RNA vaccine according to claim 77, wherein the neo-epitopes are flanked by amino acid sequences flanking said neo-epitopes in the naturally occurring protein so as to form a vaccine sequence.

    83. The RNA vaccine according to claim 77, wherein the neo-epitopes are lined up head-to-tail.

    84. The RNA vaccine according to claim 77, wherein the neo-epitopes are spaced by linkers.

    85. The RNA vaccine according to claim 77, wherein the vaccine, when administered to the patient, provides a collection of MHC presented epitopes incorporating sequence changes based on the tumor specific mutations.

    86. The RNA vaccine according to claim 85, wherein the MHC presented epitopes are MHC class II-presented epitopes that elicit a CD4+ helper T cell response against cells expressing antigens from which the MHC presented epitopes are derived and/or MHC class I-presented epitopes that elicit a CD8+ T cell response against cells expressing antigens from which the MHC presented epitopes are derived.

    87. The RNA vaccine according to claim 77, wherein the RNA further comprises an unmasked poly-A sequence.

    88. The RNA vaccine according to claim 87, wherein the unmasked poly-A sequence has a length of approximately 120 adenosine residues.

    89. The RNA vaccine according to claim 77, wherein the RNA further comprises a 3′ UTR.

    90. The RNA vaccine according to claim 77, wherein the polyepitopic polypeptide encoded by the RNA further comprises an MHC class I signal peptide fragment, a transmembrane domain, or a cytosolic domain.

    91. The RNA vaccine according to claim 84, wherein at least 50% of the amino acids of the linkers are glycine and/or serine residues.

    92. The RNA vaccine according to claim 77, wherein the RNA further comprises a 5′ cap.

    93. The RNA vaccine according to claim 92, wherein the 5′ cap is: ##STR00003## wherein R.sub.1 and R.sub.2 are independently hydroxy or methoxy, and W, X, and Y are independently oxygen, sulfur, selenium or BH.sub.3.

    94. The RNA vaccine according to claim 93, wherein R.sub.1 and R.sub.2 are hydroxy, and W, X, and Y are oxygen.

    95. The RNA vaccine according to claim 93, wherein one of R.sub.1 and R.sub.2 is hydroxy, the other one is methoxy, and W, X, and Y are oxygen.

    96. The RNA vaccine according to claim 93, wherein X is sulfur.

    97. The RNA vaccine according to claim 96, wherein W and Y are oxygen.

    98. The RNA vaccine according to claim 92, wherein the 5′ cap is m.sub.2.sup.7,2′-OGpp.sub.spG.

    99. The RNA vaccine according to claim 98, wherein m.sub.2.sup.7,2′-OGpp.sub.spG is in the Rp diastereoisomeric form.

    100. The RNA vaccine according to claim 98, wherein m.sub.2.sup.7,2′-OGpp.sub.spG is in the Sp diastereoisomeric form.

    101. A method for preparing an individualized cancer vaccine comprising the steps: (a) identifying cancer specific somatic mutations in a tumor specimen of a cancer patient to provide a cancer mutation signature of the cancer patient comprising cancer specific somatic mutations, comprising (aa) obtaining nucleic acid sequence information by sequencing genomic DNA and/or RNA of the tumor specimen of the cancer patient, (bb) obtaining reference nucleic acid sequence information by sequencing DNA and/or RNA of normal non-cancerous cells, and (cc) comparing the nucleic acid sequence information from the tumor specimen obtained in step (aa) with the reference nucleic acid sequence information obtained in step (bb); and (b) preparing an RNA vaccine featuring the cancer mutation signature obtained in step (a), wherein the RNA vaccine comprises RNA encoding a recombinant polyepitopic polypeptide comprising neo-epitopes fused together by peptide bonds or linkers.

    102. The method according to claim 101, wherein the step of identifying cancer specific somatic mutations comprises identifying the cancer mutation signature of the exome of one or more cancer cells.

    103. The method according to claim 101, wherein the step of identifying cancer specific somatic mutations comprises single cell sequencing of one or more cancer cells.

    104. The method according to claim 103, wherein the cancer cells are circulating tumor cells.

    105. The method according to claim 101, wherein the step of identifying cancer specific somatic mutations involves using next generation sequencing (NGS).

    106. The method according to claim 101, wherein the normal non-cancerous cells are obtained from the cancer patient.

    107. The method according to claim 101, wherein the reference nucleic acid sequence information is obtained from genomic DNA obtained from peripheral blood mononuclear cells (PBMCs).

    108. The method according to claim 107, wherein the tumor specimen is from a primary tumor, and wherein the step of identifying cancer specific somatic mutations in the tumor specimen further comprises the steps: (dd) preparing a phylogenetic tree of cancer specific somatic mutations, wherein the reference nucleic acid sequence information obtained in step (bb) is used to root the tree, (ee) reproducing ancestral sequences, wherein the ancestral sequences are sequences of nodes near the root of the phylogenetic tree containing primary basal mutations, wherein the primary basal mutations are the earliest mutations predicted to exist in the primary tumor; and (ff) selecting the primary basal mutations from the ancestral sequences identified in step (ee).

    109. The method according to claim 101, wherein the step of identifying cancer specific somatic mutations is replicated at least in duplicates.

    110. The method according to claim 101, comprising the further step of determining the usability of the identified mutations in epitopes for cancer vaccination, wherein determining the usability comprises one or more of the following: (i) assessing whether the identified mutations are located in known or predicted WIC presented epitopes, (ii) in vitro and/or in silico testing whether the identified mutations are located in WIC presented epitopes, and (iii) in vitro testing whether the identified mutations are able to stimulate T cells of the patient having the desired specificity.

    111. The method according to claim 101, wherein the polypeptide comprises 5 or more, 10 or more, or 20 or more neo-epitopes.

    112. The method according to claim 101, wherein the polypeptide comprises up to 30 neo-epitopes.

    113. The method according to claim 101, wherein the polypeptide further comprises epitopes not containing cancer specific somatic mutations which are expressed by cancer cells.

    114. The method according to claim 101, wherein the polypeptide comprises neo-epitopes that are based on primary basal mutations.

    115. The method according to claim 101, wherein the neo-epitopes are flanked by amino acid sequences flanking said neo-epitopes in the naturally occurring protein so as to form a vaccine sequence.

    116. The method according to claim 101, wherein the neo-epitopes are lined up head-to-tail and/or are spaced by linkers.

    117. The method according to claim 101, wherein the RNA further comprises an unmasked poly-A sequence.

    118. The method according to claim 117, wherein the unmasked poly-A sequence has a length of approximately 120 adenosine residues.

    119. The method according to claim 101, wherein the RNA further comprises a 3′ UTR.

    120. The method according to claim 101, wherein the polyepitopic polypeptide encoded by the RNA further comprises an MHC class I signal peptide fragment, a transmembrane domain or a cytosolic domain.

    121. The method according to claim 116, wherein at least 50% of the amino acids of the linkers are glycine and/or serine residues.

    122. The method according to claim 101, wherein the RNA further comprises a 5′ cap.

    123. The method according to claim 122, wherein the 5′ cap is: ##STR00004## wherein R.sub.1 and R.sub.2 are independently hydroxy or methoxy, and W, X, and Y are independently oxygen, sulfur, selenium or BH.sub.3.

    124. The method according to claim 123, wherein R.sub.1 and R.sub.2 are hydroxy, and W, X, and Y are oxygen.

    125. The method according to claim 123, wherein one of R.sub.1 and R.sub.2 is hydroxy, the other one is methoxy, and W, X, and Y are oxygen.

    126. The method according to claim 123, wherein X is sulfur.

    127. The method according to claim 126, wherein W and Y are oxygen.

    128. The method according to claim 122, wherein the 5′ cap is m.sub.2.sup.7,2′-OGpp.sub.spG.

    129. The method according to claim 128, wherein m.sub.2.sup.7,2′-OGpp.sub.spG is in the Rp diastereoisomeric form.

    130. The method according to claim 128, wherein m.sub.2.sup.7,2′-OGpp.sub.spG is in the Sp diastereoisomeric form.

    131. An RNA vaccine which is obtained by the method according to claim 101, wherein the vaccine, when administered to the patient, provides a collection of MHC presented epitopes incorporating sequence changes based on the identified mutations.

    132. The RNA vaccine according to claim 131, wherein the MHC presented epitopes are MHC class II-presented epitopes that elicit a CD4+ helper T cell response against cells expressing antigens from which the MHC presented epitopes are derived and/or MHC class I-presented epitopes that elicit a CD8+ T cell response against cells expressing antigens from which the MHC presented epitopes are derived.

    133. Use of the individualized cancer vaccine prepared by the method according to claim 101 for treating the cancer of said patient.

    134. Use of the RNA vaccine according to claim 131 for treating the cancer of said patient.

    135. Use of the individualized cancer vaccine prepared by the method according to claim 46 for treating the cancer of said patient.

    136. Use of the RNA vaccine according to claim 75 for treating the cancer of said patient.

    137. A method of treating cancer, the method comprising a step of: administering to cancer patients an RNA vaccine, wherein: each patient receives an individualized vaccine comprising an RNA that encodes a recombinant polyepitopic polypeptide comprising a plurality of neoepitopes expressed by that patient's tumor, the neoepitopes being linked to one another in the polyeptopic polypeptide by linker sequences.

    138. A method of producing a vaccine specific for an individual patient's tumor, the method comprising steps of: (a) synthesizing an RNA that encodes a recombinant polyepitopic polypeptide comprising a plurality of neoeptiopes spaced apart by linker sequences, wherein each of the neoepitopes: i. is expressed by the individual patient's tumor; ii. includes a somatic mutation relative to non-tumor sequence in the individual patient; iii. satisfies WIC presentation prediction.

    139. The method of claim 138, wherein detection of RNA encoding the neoepitope in a tumor sample from the individual patient determines that the neoeptitope is expressed in the individual patient's tumor.

    140. The method of claim 138, wherein the plurality of neoepitopes comprises neoepitopes from a plurality of different antigens.

    141. The method of claim 138, further comprising a step of administering the synthesized RNA to the individual patient.

    142. An individualized cancer vaccine comprising an RNA encoding a recombinant polyepitopic polypeptide, wherein said polypeptide comprises two or more immunogenic neo-epitopes expressed by tumor cells in a particular patient, the vaccine produced by a method comprising steps of: (a) obtaining nucleic acid sequence information from a sample comprising tumor cells from a patient; (b) obtaining nucleic acid sequence information from a sample comprising non-tumor cells from the same patient; (c) comparing the tumor cell sequence information with the non-tumor-cell sequence information so that somatic mutations present in the tumor cell sequence information are identified; (d) classifying as immunogenic neo-epitopes at least two of the identified somatic mutations, wherein each immunogenic neo-epitope is characterized in that it: i. occurs in a transcript; ii. occurs in a protein-coding region; iii. introduces a change in amino acid sequence; iv. is predicted to exhibit MHC binding; and (e) producing an RNA encoding a recombinant polyepitopic polypeptide, wherein said polypeptide comprises two or more immunogenic neo-epitopes identified in steps (a)-(d) and the neo-epitopes are fused together by peptide bonds or linkers.

    143. The individualized vaccine of claim 142, wherein the method further comprises a step of formulating the RNA with one or more pharmaceutically acceptable components.

    144. The individualized vaccine of claim 143, wherein the one or more pharmaceutically acceptable components are or comprise one or more lipids.

    145. An individualized cancer vaccine comprising an RNA encoding a recombinant polyepitopic polypeptide, wherein said polypeptide comprises two or more immunogenic neo-epitopes expressed by tumor cells in a particular patient, wherein each immunogenic neo-epitope is characterized in that it: i. occurs in a transcript; ii. occurs in a protein-coding region; iii. introduces a change in amino acid sequence; and iv. is predicted to exhibit MHC binding.

    Description

    FIGURES

    [0306] FIG. 1:

    [0307] Top: Process to discover and prioritize likely immunogenic somatic mutations in bulk tumor samples. Bottom: Process as applied to the B16 and Black6 system.

    [0308] FIG. 2: Example Validated Mutation in Kif18b

    [0309] A mutation identified in gene Kif18b by NGS exome-sequencing that was confirmed by Sanger sequencing. In the wild type cells, the sequence is T/T. In the tumor cells, the sequence is a mix of T/G.

    [0310] FIG. 3: Immunologic reactivity against mutated sequences

    [0311] Mice (n=5) were immunized twice (d0, d7) with mutated peptide sequences (100 μg+50 μg PolyI:C; s.c.). At day 12 mice were sacrificed and the spleen cells harvested. IFNγ ELISpot was performed using 5×10.sup.5 spleen cells/well as effectors and 5×10.sup.4 bone marrow dendritic cells loaded with peptides (2 μg/ml for 2 h at 37° C. and 5% COO as target cells. The effector spleen cells were tested against the mutated peptide, the wild type peptide and a control peptide (vesiculostomatitis virus nucleoprotein, VSV-NP, aa 52-59). Shown is the mean measured spot number from which the background spots against VSV-NP were subtracted for every mouse (empty circles: mice immunized with wildtype peptide; filled boxes: mice immunized with mutated peptides). Data are shown for each mouse and mean±SEM is depicted.

    [0312] FIG. 4: Survival benefit for mice vaccinated with newly identified mutated peptide sequence

    [0313] B16F10 cells (7,5×10.sup.4) were inoculated subcutaneously on d0. Mice were vaccinated with peptide 30 (Jerini Peptide Technologies (Berlin); 100 μg peptide+50 μg PolyI:C s.c. (Invivogen)) on day −4, day +2, day +9. The control group received only Poly I:C (50 μg s.c.). Tumor growth was monitored until day +16*, p<0.05 in Log-rank (Mantel-Cox) test.

    [0314] FIG. 5:

    [0315] (A) Examples of enhanced protein expression (left eGFP, right Luciferase) with RNA optimized for stability and translational efficiency (B) Example of polyepitopic expansion of antigen-specific CD8.sup.+ and CD4.sup.+ T cells with RNA optimized for effective antigen routing (s. Reference Kreiter, Konrad, Sester et al, Cancer Immunol. Immunother. 56: 1577-1587, 2007). T (C) Example of a preclinical proof of antitumoral efficacy in B16 melanoma model using an RNA vaccine that codes for a single epitope (OVA-SIINFEKL). Survival data were obtained for mice treated with vaccine alone or vaccine in combination with adjuvant. (D) Individualized, poly-neo-epitopic vaccine design. The vaccine vehicle integrates functional elements for increased expression and optimized immunogenicity. Up to 30 mutated epitopes that are spaced by linkers can be integrated per molecule in their natural sequence context.

    [0316] FIG. 6: Construct design

    [0317] (A) Schematic diagram of a RNA polyepitope construct. Cap: cap analogon; 5′UTR: 5′ untranslated region; L: linker; Seq. 1: RNA sequence coding for peptide containing mutated aa; 3′ UTR: 3′ untranslated sequence; poly-A: poly-A tail. (B) Sequence of the RNA constructs coding for 2 aa sequences including a mutated aa from B16F10. The start- and stop-codon as well as the signal peptide and the MITD sequence are not part of the schematic drawing which is symbolized by “ . . . ”.

    [0318] FIG. 7: Functionality of RNA poly epitope

    [0319] (A-C) Data for IFNγ ELISpot using 5×10.sup.5 spleen cells per well as effectors and 5×10.sup.4 BMDC as target cells. The BMDC were loaded with peptide (2 μg/ml for 2 h at 37° C. and 5% CO.sub.2) or transfected with RNA (20 μg) by electroporation. The control RNA was eGFP (left panel) or a RNA construct coding for 2 unrelated peptides containing mutated aa separated by a linker. Data are shown as mean±SEM. (A) Data for mutation peptide 30, wild type peptide 30 and RNA coding for mutation 30 and 31 are shown. (B) Data for mutation peptide 12, wild type peptide 12 and RNA coding for mutation 12 and 39 are shown. (C) Representative ELISpot scan from a single mouse of the read-out shown in (B) is depicted.

    [0320] FIG. 8: Two embodiments of RNA poly-neo-epitopic vaccines showing junction epitopes

    [0321] The RNA vaccine can be constructed with (top) or without linkers (bottom) between mutation-encoding peptides. Good epitopes include those that include the somatic mutation (“*”) and bind to MHC molecules. Bad epitopes include epitopes that bind to MHC molecules but contain either parts of two peptides (bottom) or parts of peptide and linker sequences (top).

    [0322] FIG. 9: Discovery and characterization of the “T-cell druggable mutanome”

    [0323] (A) Flow chart gives an overview of the experimental procedure starting from B16F10 and C57BL/6 samples to ELISPOT readout. (B) The number of hits for each evaluation step and the process for selection of mutations for DNA validation and immunogenicity testing is shown. Mutations selected for validation and immunogenicity testing were those predicted to be immunogenic and in genes expressed at RPKM>10. (C) The T-cell druggable mutanome was mapped to the genome of B16F10. Rings from outside to inside stand for following subsets: (1) present in all triplicates, (2) have an FDR<0.05, (3) are located in protein coding regions, (4) cause nonsynonymous changes, (5) are localized in expressed genes, and (6) are in the validated set. Mouse chromosomes (outer circle), gene density (green), gene expression (green(low)/yellow/red(high)), and somatic mutations (orange).

    [0324] FIG. 10: Immune responses elicited in vivo by vaccination of mice with mutation representing long synthetic peptides

    [0325] (A,B) IFN-γ ELISPOT analysis of T-cell effectors from mice vaccinated with mutation coding peptides. Columns represent means (±SEM) of 5 mice per group. Asterisks indicate statistically significant differences of reactivity against mutation and wild-type peptide (student's t-test; value p<0.05). (A) Splenocytes of vaccinated mice were restimulated with BMDCs transfected with the mutation coding peptide used for vaccination, the corresponding wild-type peptide and an irrelevant control peptide (VSV-NP). (B) For analysis of T-cell reactivity against endogenously processed mutations splenocytes of vaccinated mice were restimulated with BMDCs transfected with control RNA (eGFP) or a RNA coding for the indicted mutation. (C) Mutation 30 (gene Kif18B, protein Q6PFD6, mutation p.K739N). Sanger sequencing trace and sequence of mutation (top). Protein domains and mutation location (bottom).

    [0326] FIG. 11: Antitumoral effects of mutated peptide vaccines in mice with aggressively growing B16F10 tumors

    [0327] (A) C57BL/6 mice (n=7) were inoculated with 7.5×10.sup.4 B16F10 cells s.c. into the flank of the mice. On day 3 and 10 after tumor inoculation the mice were vaccinated with 100 μs MUT30 or MUT44 peptide+50 μg poly(I:C) or with adjuvant alone. (B) C57BL/6 mice (n=5) received one immunization of 100 μg MUT30 peptide+50 μg poly(I:C) on day −4. On day 0 7.5×10.sup.4 B16F10 cells were inoculated s.c. into the flank of the mice. Booster immunizations with MUT30 peptid (±poly(I:C)) were done on days 2 and 9.

    [0328] Kaplan-Meier survival Blot (left). Tumor growth kinetics (right).

    [0329] FIG. 12: Vaccination with mutation coding RNAs leads to CD4.sup.+ and CD8.sup.+ T-cell responses

    [0330] Intracellular cytokine staining analysis data for IFN-γ in CD4.sup.+ and CD8.sup.+ T-cell effectors from mice vaccinated with mutation coding RNAs. RNAs were coding for 1 (Monoepitope, upper row), 2 (Biepitope, middle row), or 16 (Polyepitope, lower row) different mutations. Dots represent means of 3 mice per group. Asterisks indicate statistically significant differences of reactivity against mutation and control peptide (VSV-NP) (student's t-test; value p<0.05). FACS plots show effectors from the highest IFN-γ secreting animal for each mutation and indicate phenotype of the T-cell response.

    [0331] FIG. 13: Vaccination with mutation coding Polyepitope RNA leads T-cell responses against several mutations

    [0332] IFN-γ ELISPOT analysis of T-cell effectors from mice vaccinated with mutation coding Polyepitope including 16 different mutations. Columns represent means (±SEM) of 3 mice per group. Photograph shows triplicate wells of cells from one exemplary animal restimulated with the indicated peptides.

    [0333] FIG. 14: Vaccination with 5 different model epitopes encoded by one RNA leads to immune responses against all encoded epitopes

    [0334] A) IFN-γ ELISPOT analysis of T-cell effectors from mice vaccinated with mutation coding model Polyepitope including 5 different model epitopes (SIINFEKL, Trp2, VSV-NP, Inf-NP, OVA class II). Splenocytes were restimulated with the indicated peptides. Spots represent means of triplicate wells from 5 mice per group. B) Pentamer staining of blood lymphocytes of one control mouse and one mouse immunized with the model Polyepitope. Inf-NP Pentamer stained CD8.sup.+ cells are specific for the Inf-NP peptide.

    [0335] FIG. 15: A CD4.sup.+ T-cell inducing mutation can induce a potent anti-tumoral effect B16F10 melanoma in synergy with a weak CD8.sup.+ T-cell epitope

    [0336] C57BL/6 mice (n=8) were inoculated with 1×10.sup.5 B16F10 cells s.c. into the flank of the mice. On day 3, 10 and 17 after tumor inoculation the mice were vaccinated with 100 μg MUT30, Trp2 or both peptides+50 μg poly(I:C). A) Shown are the mean tumor growth kinetics of each group. On day 28 the mean values between the single treatment groups and the untreated animals and the combination group are statistically different (Mann-Whitney test, p-value <0.05). B) Kaplan-Meyer survival plot of the different groups. The survival curves of MUT30 and MUT30+ Trp2 vaccinated mice are statistically different (Log-Rank test, p-value=0.0029).

    [0337] FIG. 16: Overview of process for finding somatic mutations in B16

    [0338] Numbers for the individual steps are given as an example for one B16 sample, compared to one black6 sample. “Exons” refers to the exon coordinates defined by all protein coding RefSeq transcripts.

    [0339] FIG. 17: Venn diagram showing the numbers of somatic variations in protein coding exons, found by the individual, two or all three software tools, respectively

    [0340] The numbers were calculated after filtering and represent the consensus of all three samples.

    [0341] FIG. 18: A Examples of single nucleotide variations found: A somatic mutation found in all three B16 samples (left), a non-somatic mutation found in all B16 and black6 samples (middle) and a mutation found in only one black6 sample (right). B The calculated FDR distribution for the dataset of which the validated mutations were selected; the distribution is visualized as an average estimated ROC curve with the grey bars giving the 95% confidence interval for the mean in both dimensions at uniformly sampled positions. The mean was obtained from the distribution of estimated ROC curves of the FDRs for all possible 18 combinations (see text).

    [0342] FIG. 19: A Estimated ROC curves for the comparison of the three different software tools (duplicates, 38× coverage). B Estimated ROC curves for the comparison of different average sequencing depths (samtools, no replication). 38× denotes the coverage obtained by the experiment, while other coverages were downsampled starting with this data. C Estimated ROC curves visualizing the effect of experiment replication (38× coverage, samtools). D Estimated ROC curves for different sequencing protocols (samtools, no replication). The curves were calculated using the results of the 2×100 nt library.

    [0343] FIG. 20: A Ten validated mutations with the lowest FDRs, selected using the optimal set of parameters out of a final set of 2396 variations. None of these mutations is present in dbSNP (version 128; genome assembly mm9). B Relative amount of variations found in the same dataset as A for a given FDR cutoff, plotted separately for all variants in the dataset and the validated mutations. For visual clarity only values of 0 to 10% FDR are shown.

    [0344] FIG. 21: Antitumoral activity of a mutation-encoding polyepitope RNA vaccine C57BL/6 mice (n=10) were inoculated with 1×10.sup.5 B16F10 cells s.c. into the flank of the mice. On day 3, 6, 10, 17 and 21 after tumor inoculation the mice were vaccinated with a polytope RNA formulated a liposomal RNA transfection reagent. The control group received liposomes without RNA. The figure shows the Kaplan-Meyer survival plot of the different groups. The survival curves statistically different (Log-Rank test, p-value=0.0008).

    EXAMPLES

    [0345] The techniques and methods used herein are described herein or carried out in a manner known per se and as described, for example, in Sambrook et al., Molecular Cloning: A Laboratory Manual, 2.sup.nd Edition (1989) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. All methods including the use of kits and reagents are carried out according to the manufacturers' information unless specifically indicated.

    Example 1: Mutation Detection and Prioritization

    [0346] We first demonstrate sequence profiling of tumor and normal samples to identify somatic mutations in an unbiased manner. We demonstrate this not only for bulk tumor samples but also, for the first time, demonstrate the ability to identify mutations from individual circulating tumor cells. Next, we prioritize the mutations for inclusion in a poly-neo-epitopic vaccine based on the predicted immunogenicity of the mutation and demonstrate that the identified mutations are indeed immunogenic.

    Mutation Detection

    [0347] The rationale for using CTCs: the detection of circulating tumor cells (CTC) from the peripheral blood of cancer Patients is a recognized independent prognostic marker for the clinical course of tumors (Pantel et al, Trends Mol Med 2010; 16(9):398-406). For many years, the clinical significance of CTCs has been the subject of intense scientific and clinical research in oncology. It has been shown that the detection of CTCs in the blood of patients with metastatic breast, prostate and colorectal cancer has prognostic relevance, providing additional information to conventional imaging techniques and other prognostic tumor biomarkers. Sequential blood samples drawn from a patient before, during an early stage, and after treatment with a therapeutic agent (systemic or targeted) provides information on treatment response/failure. The molecular analysis of drug-resistant CTCs may provide a further insight into resistance mechanisms (e.g. mutations in specific signaling pathways or loss of target expression) in individual patients. An additional possibility from the profiling and genetic characterization of CTCs is the identification of novel cancer targets for the development of new targeted therapies. This new diagnostic strategy is referred to as “Liquid Tumor Biopsy.” As this profiling could be quickly and repetitively done, requiring only patient blood and no surgery, this would provide a “real time” view of the tumor state.

    [0348] Mutations from tumor cells: We demonstrate our ability to identify mutations using B16 melanoma cells, exome capture to extract protein coding regions, next-generation sequencing using our HiSeq 2000, followed by bioinformatics analysis using our “iCAM” software pipeline (FIG. 1). We identify 2448 non-synonymous mutations and selected 50 for confirmation. We were able to confirm all 50 somatic mutations.

    [0349] The following is an example of the protein impact of a discovered somatic mutation in B16 melanoma cells:

    TABLE-US-00001 Kifl8b, NM_197959, exon 3 Mutation (+15 aa) SPSKPSFQEFVDWENVSPELNSTDQPFLPS Wild type (+15 aa) SPSKPSFQEFVDWEKVSPELNSTDQPFLPS

    [0350] Mutations from individual circulating tumor cells (CTCs): Next, we were able to identify tumor-specific somatic mutations from NGS profiling of RNA from single CTCs. Labeled B16 melanoma cells were intravenously injected into mouse tails, mice were sacrificed, blood was collected from hearts, cells sorted to retrieve labeled circulating B16 cells (CTCs), RNA extracted, a SMART-based cDNA synthesis and unspecific amplification performed, followed by the NGS RNA-Seq assay and subsequence data analysis (below).

    [0351] We profiled eight individual CTCs and identified somatic mutations. Furthermore, in eight of eight cells, previously identified somatic mutations were identified. In multiple cases, the data showed heterogeneity at the individual cell level. For example, at position 144078227 on chromosome 2 (assembly mm9), in gene Snx15, two cells showed the reference nucleotide (C) while two cells showed the mutated nucleotide (T).

    [0352] This demonstrates that we are able to profile individual CTCs to identify somatic mutations, a fundamental path to a “real-time” iVAC (individualized vaccine), in which patients are profiled repetitively and the results reflect the current patient status rather than the status at an earlier time point. Furthermore, this demonstrates that we are able to identify heterogeneous somatic mutations that are present in a subset of tumor cells, enabling evaluation of mutation frequency, such as for identification of major mutations and rare mutations.

    [0353] Methods

    [0354] Samples: For the profiling experiment, samples included 5-10 mm tail samples from C57BL/6 mice (“Black6”) and highly aggressive B16F10 murine melanoma cells (“B16”), which are originally derived from Black6 mice.

    [0355] Circulating tumor cells (CTCs) were created using fluorescent labeled B16 melanoma cells. B16 cells were resuspended in PBS and an equal volume of freshly prepared CFSE-Solution (5 μM in PBS) was added to the cells. The sample was gentle mixed by vortex followed by incubation for 10 min at room temperature. To stop the labeling reaction, the equal amount of PBS containing 20% FSC was added to the sample and mixed gently by vortex. Following 20 min incubation at room temperature, the cells were washed twice using PBS. Finally, the cells were resuspended in PBS and injected intravenously (i.v.) in mice. After 3 minutes the mice were sacrificed and blood collected.

    [0356] Erythrocytes from the blood samples were lysed by adding 1.5 ml fresh prepared PharmLyse Solution (Beckton Dickinson) per 100 μl blood. After one washing step, 7-AAD was added to the sample and incubated for 5 min at room temperature. The incubation was followed by two washing steps and the sample was resuspended in 500 μl PBS.

    [0357] The CFSE labeled circulating B16 cells were sorted with an Aria I cells-sorter (BD). Single cells were sorted on 96-well-v-bottom plated prepared with 50 RLT buffer (Quiagen). After finishing the sorting the plates were stored at −80° C. until the Nucleic acid extraction and sample preparation started.

    [0358] Nucleic acid extraction and sample preparation: nucleic acids from B16 cells (DNA and RNA) and Black6 tail tissue (DNA) were extracted using Qiagen DNeasy Blood and Tissue kit (DNA) and Qiagen RNeasy Micro kit (RNA).

    [0359] For individual sorted CTCs, RNA was extracted and a SMART-based cDNA synthesis and unspecific amplification performed. RNA from sorted CTC cells was extracted with the RNeasy Micro Kit (Qiagen, Hilden, Germany) according to the instructions of the supplier. A modified BD SMART protocol was used for cDNA synthesis: Mint Reverse Transcriptase (Evrogen, Moscow, Russia) was combined with oligo(dT)-T-primer long for priming of the first-strand synthesis reaction and TS-short (Eurogentec S.A., Seraing, Belgium) introducing an oligo(riboG) sequence to allow for creation of an extended template by the terminal transferase activity of the reverse transcriptase and for template switch [Chenchik, A., Y. et al. 1998. Generation and use of high quality cDNA from small amounts of total RNA by SMART PCR. In Gene Cloning and Analysis by RT-PCR. P. L. J. Siebert, ed. Bio Techniques Books, MA, Natick. 305-319]. First strand cDNA synthesized according to the manufacturer's instructions was subjected to 35 cycles of amplification with 5 U PfuUltra Hotstart High-Fidelity DNA Polymerase (Stratagene, La Jolla, Calif.) and 0.48 μM primer TS-PCR primer in the presence of 200 μM dNTP (cycling conditions: 2 min at 95° C. for, 30 s at 94° C., 30 s at 65° C., 1 min at 72° C. for, final extension of 6 min at 72° C.). Successful amplification of the CTC genes was controlled with specific primers to monitor actin and GAPDH.

    [0360] Next-generation sequencing, DNA sequencing: Exome capture for DNA resequencing was performed using the Agilent Sure-Select solution-based capture assay [Gnirke A et al: Solution hybrid selection with ultra-long oligonucleotides for massively parallel targeted sequencing. Nat Biotechnol 2009, 27:182-189], in this case designed to capture all mouse protein coding regions.

    [0361] Shortly, 3 ug purified genomic DNA was fragmented to 150-200 bp's using a Covaris S2 ultrasound device. gDNA fragments were end repaired using T4 DNA polymerase, Klenow DNA polymerase and 5′ phosphorylated using T4 polynucleotide kinase. Blunt ended gDNA fragments were 3′ adenylated using Klenow fragment (3′ to 5′ exo minus). 3′ single T-overhang Illumina paired end adapters were ligated to the gDNA fragments using a 10:1 molar ratio of adapter to genomic DNA insert using T4 DNA ligase. Adapter ligated gDNA fragments were enriched pre capture and flow cell specific sequences were added using Illumina PE PCR primers 1.0 and 2.0 and Herculase II polymerase (Agilent) using 4 PCR cycles.

    [0362] 500 ng of adapter ligated, PCR enriched gDNA fragments were hybridized to Agilent's SureSelect biotinylated mouse whole exome RNA library baits for 24 hrs at 65° C. Hybridized gDNA/RNA bait complexes where removed using streptavidin coated magnetic beads. gDNA/RNA bait complexes were washed and the RNA baits cleaved off during elution in SureSelect elution buffer leaving the captured adapter ligated, PCR enriched gDNA fragments. gDNA fragments were PCR amplified post capture using Herculase II DNA polymerase (Agilent) and SureSelect GA PCR Primers for 10 cycles.

    [0363] All cleanups were done using 1.8× volume of AMPure XP magnetic beads (Agencourt) All quality controls were done using Invitrogen's Qubit HS assay and fragment size was determined using Agilent's 2100 Bioanalyzer HS DNA assay.

    [0364] Exome enriched gDNA libraries were clustered on the cBot using Truseq SR cluster kit v2.5 using 7 pM and 50 bps were sequenced on the Illumina HiSeq2000 using Truseq SBS kit-HS 50 bp.

    [0365] Next-generation sequencing, RNA sequencing (RNA-Seq): Barcoded mRNA-seq cDNA libraries were prepared from 5 ug of total RNA using a modified version of the Illumina mRNA-seq protocol. mRNA was isolated using Seramag Oligo(dT) magnetic beads (Thermo Scientific). Isolated mRNA was fragmented using divalent cations and heat resulting in fragments ranging from 160-220 bp. Fragmented mRNA was converted to cDNA using random primers and SuperScriptII (Invitrogen) followed by second strand synthesis using DNA polymerase I and RNaseH. cDNA was end repaired using T4 DNA polymerase, Klenow DNA polymerase and 5′ phosphorylated using T4 polynucleotide kinase. Blunt ended cDNA fragments were 3′ adenylated using Klenow fragment (3′ to 5′ exo minus). 3′ single T-overhang Illumina multiplex specific adapters were ligated using a 10:1 molar ratio of adapter to cDNA insert using T4 DNA ligase.

    [0366] cDNA libraries were purified and size selected at 200-220 bp using the E-Gel 2% SizeSelect gel (Invitrogen). Enrichment, adding of Illumina six base index and flow cell specific sequences was done by PCR using Phusion DNA polymerase (Finnzymes). All cleanups were done using 1.8× volume of AgencourtAMPure XP magnetic beads. All quality controls were done using Invitrogen's Qubit HS assay and fragment size was determined using Agilent's 2100 Bioanalyzer HS DNA assay.

    [0367] Barcoded RNA-Seq libraries were clustered on the cBot using Truseq SR cluster kit v2.5 using 7 pM and 50 bps were sequenced on the Illumina HiSeq2000 using Truseq SBS kit-HS 50 bp.

    [0368] CTCs: For the RNA-Seq profiling of CTCs, a modified version of this protocol was used in which 500-700 ng SMART amplified cDNA was used, paired end adapters were ligated and PCR enrichment was done using Illumina PE PCR primers 1.0 and 2.0.

    [0369] NGS data analysis, gene expression: To determine expression values, the output sequence reads from RNA samples from the Illumina HiSeq 2000 were preprocessed according to the Illumina standard protocol. This includes filtering for low quality reads and demultiplexing. For RNA-Seq transcriptome analysis, sequence reads were aligned to the reference genomic sequence [Mouse Genome Sequencing Consortium. Initial sequencing and comparative analysis of the mouse genome. Nature, 420, 520-562 (2002)] using bowtie (version 0.12.5) [Langmead B. et al. Ultrafast and memory-efficient alignment of short DNA sequences to the human genome. Genome Biol 10:R25] using parameters “−v2—best” for genome alignments and default parameters for transcript alignments. The alignment coordinates were compared to the exon coordinates of the RefSeq transcripts [Pruitt K D. et al. NCBI Reference Sequence (RefSeq): a curated non-redundant sequence database of genomes, transcripts and proteins. Nucleic Acids Res. 2005 Jan. 1; 33 (Database issue): D501-4] and for each transcript the counts of overlapping alignments were recorded. Sequence reads not alignable to the genomic sequence were aligned to a database of all possible exon-exon junction sequences of the RefSeq transcripts. The counts of reads aligning to the splice junctions were aggregated with the respective transcript counts obtained in the previous step and normalized to RPKM (number of reads which map per kilobase of exon model per million mapped reads [Mortazavi, A. et al. (2008). Mapping and quantifying mammalian transcriptomes by rna-seq. Nat Methods, 5(7):621-628]) for each transcript. Both gene expression and exon expression values were calculated based on the normalized number of reads overlapping each gene or exon, respectively.

    [0370] Mutation discovery, bulk tumor: 50 nt, single end, reads from the Illumina HiSeq 2000 were aligned using bwa (version 0.5.8c) [Li H. and Durbin R. (2009) Fast and accurate short read alignment with Burrows-Wheeler Transform. Bioinformatics, 25:1754-60] using default options to the reference mouse genome assembly mm9. Ambiguous reads—those reads mapping to multiple locations of the genome—were removed, the remaining alignments were sorted, indexed and converted to a binary and compressed format (BAM) and the read quality scores converted from the Illumina standard phred+64 to standard Sanger quality scores using shell scripts.

    [0371] For each sequencing lane, mutations were identified using three software programs: including samtools (version 0.1.8) [Li H. Improving SNP discovery by base alignment quality. Bioinformatics. 2011 Apr. 15; 27(8):1157-8. Epub 2011 Feb. 13], GATK (version 1.0.4418) [McKenna A. et al. The Genome Analysis Toolkit: a MapReduce framework for analyzing next-generation DNA sequencing data. Genome Res. 2010 September; 20(9):1297-303. Epub 2010 Jul. 19], and SomaticSniper (http://genome.wustl.edu/software/somaticsniper). For samtools, the author-recommend options and filter criteria were used, including first round filtering, maximum coverage 200. For samtools second round filtering, the minimum indel qualify score was 50, the point mutation minimum quality was 30. For GATK mutation calling, we followed the author-designed best practice guidelines presented on the GATK user manual (http://www.broadinstitute.org/gsa/wiki/index.php/The_Genome_Analysis_Toolkit). The variant score recalibration step was omitted and replaced by the hard-filtering option. For SomaticSniper mutation calling, the default options were used and only predicted mutations with a “somatic score” of 30 or more were considered further.

    [0372] Mutation discovery, CTCs: As per the bulk tumor iCAM process, 50 nt, single end, reads from the Illumina HiSeq 2000 were aligned using bwa (version 0.5.8c) [5]) using default options to the reference mouse genome assembly mm9. As CTC NGS reads were derived from the RNA-Seq assay, reads were also aligned to transcriptome sequences, including exon-exon junctions, using bowtie (above). Using all alignments, the nucleotide sequences from the reads were compared to both the reference genome and the bulk-tumor derived B16 mutations. Identified mutations were evaluated both using perl scripts and manually using the software program samtools and the IGV (Integrated Genome Viewer) to image the results.

    [0373] The output of “mutation discovery” is the identification of somatic mutations in tumor cells, from sample to NGS data to a list of mutations. In the B16 samples, we identified 2448 somatic mutations using exome resequencing.

    Mutation Prioritization

    [0374] Next, we demonstrate a possibility of a mutation prioritization pipeline for vaccine inclusion. This method, called “individual cancer mutation detection pipeline” (iCAM) identifies and prioritizes somatic mutations through a series of steps incorporating multiple cutting edge algorithms and bioinformatics methods. The output of this process is a list of somatic mutations, prioritized based on likely immunogenicity.

    [0375] Somatic mutation identification: Mutations are identified using three different algorithms, for both the B16 and Black6 samples (Mutation discovery, above). The first iCAM step is to combine the output lists from each algorithm to generate a high-confidence list of somatic mutations. GATK and samtools report variants in one sample relative to a reference genome. To select high confidence mutations with few false-positives for a given sample (i.e., tumor or normal), mutations are selected that are identified in all replicates. Then, variants are selected which are present in the tumor sample but not present in the normal sample. SomaticSniper automatically reports potential somatic variations from tumor and normal data pairs. We further filtered results through the intersection of the results obtained from replicates. To remove as many false positive calls as possible, we intersected the list of mutations derived from the use of all three algorithms and all replicates. The final step for each somatic mutation is to assign a confidence value (p-value) for each mutation based on coverage depth, SNP quality, consensus quality and mapping quality.

    [0376] Mutation impact: the impact of the filtered, consensus, somatic mutations is determined by a script within the iCaM mutation pipeline. First, mutations that occur in genomic regions that are not unique within the genome, such as occur for some protein paralogs and pseudogenes, are excluded from analysis as sequence reads that align to multiple locations are removed. Second, whether the mutation occurs in a transcript is determined. Third, whether the mutation occurs in a protein-coding region is determined. Fourth, the transcript sequence is translated with and without the mutation to determine if there is a change in amino acid sequence.

    [0377] Mutation expression: the iCAM pipeline selects somatic mutations that are found in genes and exons that are expressed in tumor cells. Expression levels are determined through NGS RNA-Seq of tumor cells (above). The number of reads that overlap a gene and an exon indicates expression levels. These counts are normalized to RPKM (Reads Per Kilobase of exon model per Million mapped reads, [Mortazavi A. et al. Mapping and quantifying mammalian transcriptomes by RNA-Seq. Nat Methods. 2008 July; 5(7):621-8. Epub 2008 May 30]) and those expressed above 10 RPKM are selected.

    [0378] MHC binding: to determine the likelihood that an epitope containing the mutated peptide is binds to an MHC molecule, the iCAM pipeline runs a modified version of the MHC prediction software from the Immune Epitope Database (http://www.iedb.org/). The local installation includes modifications to optimize data flow through the algorithm. For the B16 and Black6 data, the prediction was run using all available black6 MHC class I alleles and all epitopes for the respective peptide lengths. Mutations are selected which fall in an epitope ranked in the 95th percentile of the prediction score distribution of the IEDB training data (http://mhcbindingpredictions.immuneepitope.org/dataset.html), considering all MHC alleles and all potential epitopes overlapping the mutation.

    [0379] Mutation selection criteria: somatic mutations are selected by the following criteria: a) have unique sequence content, b) identified by all three programs, c) high mutation confidence, d) non-synonymous protein change, e) high transcript expression, f) and favorable MHC class I binding prediction.

    [0380] The output of this process is a list of somatic mutations, prioritized based on likely immunogenicity. In B16 melanoma cells, there are 2448 somatic mutations. 1247 of these mutations are found in gene transcripts. Of these, 734 cause non-synonymous protein changes. Of these, 149 are in genes expressed in the tumor cells. Of these, 102 of these expressed, non-synonymous mutations are predicted to be presented on MHC molecules. These 102 likely immunogenic mutations are then passed to mutation confirmation (below).

    Mutation Confirmation

    [0381] Somatic mutations from DNA exome-resequencing were confirmed by either of two methods, resequencing of the mutated region and RNA-Seq analysis.

    [0382] For the confirmation of the mutations by resequencing, a genomic region containing the mutation was amplified by standard PCR from 50 ng of both the tumor DNA and the normal control DNA. The size of the amplified products was in the range of 150 to 400 nt. The specificity of the reaction was controlled by loading the PCR product on the Qiaxel device (Qiagen). PCR products were purified using the minElute PCR purification kit (Qiagen). Specific PCR products were sequenced using the standard Sanger sequencing method (Eurofins), followed by electropherogram analysis.

    [0383] Mutation confirmation was also accomplished through examination of tumor RNA. Tumor gene and exon expression values were generated from RNA-Seq (NGS of RNA), which generates nucleotide sequences that were mapped to transcripts and counted. We examined sequence data itself to identify mutations in the tumor sample [Berger M F. et al. Integrative analysis of the melanoma transcriptome. Genome Res. 2010 April; 20(4):413-27. Epub 2010 Feb. 23], providing an independent confirmation of the DNA-derived identified somatic mutations.

    TABLE-US-00002 TABLE 1 List of genes containing the 50 validated mutations Genes containing the 50 identified and confirmed somatic mutations, with annotation regarding gene symbol, gene name, and predicted localization and function. ID Symbol Entrez Gene Name Location NM_021895 ACTN4 actinin, alpha 4 Cytoplasm NM_028840 ARMC1 armadillo repeat containing 1 unknown NM_029291 ASCC2 activating signal cointegrator 1 complex subunit 2 unknown NM_024184 ASF1B ASF1 anti-silencing function 1 homolog B (S. cerevisiae) Nucleus NM_138679 ASH1L ash1 (absent, small, or homeotic)-like (Drosophila) Nucleus NM_015804 ATP11A ATPase, class VI, type 11A Plasma Membrane NM_009730 ATRN attractin Extracellular Space NM_028020 CPSF3L cleavage and polyadenylation specific factor 3-like Nucleus NM_010017 DAG1 dystroglycan 1 (dystrophin-associated glycoprotein 1) Plasma Membrane NM_015735 DDB1 damage-specific DNA binding protein 1, 127 kDa Nucleus NM_001080981 DDX23 DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 Nucleus NM_054046 DEF8 differentially expressed in FDCP 8 homolog (mouse) unknown NM_019965 DNAJB12 DnaJ (Hsp40) homolog, subfamily B, member 12 Cytoplasm NM_011262 DPF2 D4, zinc and double PHD fingers family 2 Nucleus NM_007907 EEF2 eukaryotic translation elongation factor 2 Cytoplasm NM_001081286 FAT1 FAT tumor suppressor homolog 1 (Drosophila) Plasma Membrane NM_173182 FNDC3B fibronectin type III domain containing 3B unknown NM_008057 FZD7 frizzled homolog 7 (Drosophila) Plasma Membrane NM_201617 GNAS GNAS complex locus Plasma Membrane NM_030035 GOLGB1 golgin B1 Cytoplasm NM_011365 ITSN2 intersectin 2 Cytoplasm NM_029841 KIAA2013 KIAA2013 unknown NM_197959 KIF18B kinesin family member 18B unknown NM_145479 KLHL22 kelch-like 22 (Drosophila) unknown NM_018810 MKRN1 makorin ring finger protein 1 unknown NM_001170785 MTHFD1L methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like Cytoplasm NM_133947 NUMA1 nuclear mitotic apparatus protein 1 Nucleus NM_178884 OBSL1 obscurin-like 1 unknown NM_008765 ORC2 origin recognition complex, subunit 2 Nucleus NM_023209 PBK PDZ binding kinase Cytoplasm NM_033594 PCDHGA11 protocadherin gamma subfamily A, 11 Plasma Membrane NM_025951 PI4K2B phosphatidylinositol 4-kinase type 2 beta Cytoplasm NM_011961 PLOD2 procollagen-lysine, 2-oxoglutarate 5-dioxygenase 2 Cytoplasm NM_023200 PPP1R7 protein phosphatase 1, regulatory (inhibitor) subunit 7 Nucleus NM_008986 PTRF polymerase I and transcript release factor Nucleus NM_011240 RANBP2 RAN binding protein 2 Nucleus NM_009438 RPL13A ribosomal protein L13a Cytoplasm NM_009113 S100A13 S100 calcium binding protein A13 Cytoplasm NM_001081203 SBNO1 strawberry notch homolog 1 (Drosophila) unknown NM_009153 SEMA3B sema domain, immunoglobulin domain (Ig), short basic domain, secreted, Extracellular Space (semaphorin) 3B NM_026912 SNX15 sorting nexin 15 Cytoplasm NM_024225 SNX5 sorting nexin 5 Cytoplasm NM_008188 THUMPD3 THUMP domain containing 3 unknown NM_133352 TM9SF3 transmembrane 9 superfamily member 3 Cytoplasm NM_177296 TNPO3 transportin 3 Cytoplasm NM_011640 TP53 tumor protein p53 Nucleus NM_023279 TUBB3 tubulin, beta 3 Cytoplasm NM_029896 WDR82 WD repeat domain 82 unknown NM_025830 WWP2 WW domain containing E3 ubiquitin protein ligase 2 Cytoplasm NM_001081056 XPOT exportin, tRNA (nuclear export receptor for tRNAs) Nucleus

    Example 2: IVAC Selection Algorithm Enables the Detection of Immunogenic Mutations

    [0384] To investigate if specific T-cell responses could be induced against the confirmed mutations from B16F10 melanoma cells, naïve C57BL/6 mice (n=5/peptide) were immunized twice (d0, d7) subcutaneously with 100 μg peptide (±50 μg PolyI:C as adjuvant) comprising either the mutated or the wild type aa sequence (see Table 2). All peptides had a length of 27 aa with the mutated/wild type aa at the central position. At day 12 mice were sacrificed and the spleen cells were harvested. As read-out method IFNγ ELISpot was performed using 5×10.sup.5 spleen cells/well as effectors and 5×10.sup.4 bone marrow dendritic cells loaded with peptides (2 μg/ml) as target cells. The effector spleen cells were tested against the mutated peptide, the wild type peptide and a control peptide (vesiculostomatitis virus nucleoprotein, VSV-NP).

    [0385] With 44 sequences tested we observed that 6 of them induced a T-cell immunity directed against the mutated sequence only but not to the wild type peptide (FIG. 3).

    [0386] The data prove that the identified and prioritized mutations can be utilized to induce tumor specific T-cell immunity after being utilized as peptide vaccine in antigen naïve mice.

    TABLE-US-00003 TABLE 2 Listing of mutated sequences that induced a T-cell reactivity specific for the mutated versus the wild type peptide. The amino acid exchange is marked underlined. T-cell Sequence reactivity Number RefSeq ID Type Peptide Sequence (mice) 12 NM_00107750, Mutated TPPPEEAMPFEFNGPAQGDHSQPPLQV 5/5 NM_010309, NM_201618, NM_201617 16 NM_008188 Wild Type TPPPEEAMPFEFNEPAQGDHSQPPLQV 0/5 Mutated RVTCNRAGEKHCFSSNEAARDFGGAIQ 3/5 20 NM_023279 Wild Type RVTCNRAGEKHCFTSNEAARDFGGAIQ 0/5 Mutated FRRKAFLHWYTGEAMDEMEFTEAESNM 5/5 30 NM_197959 Wild Type FRRKAFLHWYTGEGMDEMEFTEAESNM 1/5 Mutated PSKPSFQEFVDWENVSPELNSTDQPFL 5/5 34 NM_145479 Wild Type PSKPSFQEFVDWEKVSPELNSTDQPFL 1/5 Mutated HLTQQLDTYILKNVVAFSRTDKYRQLP 3/5 36 NM_133352 Wild Type HLTQQLDTYILKNFVAFSRTDKYRQLP 0/5 Mutated CGTAFFINFIAIYHHASRAIPFGTMVA 5/5 Wild Type CGTAFFINFIAIYYHASRAIPFGTMVA 0/5

    Example 3: Identified Mutations can Provide Therapeutic Anti-Tumor Immunity

    [0387] In order to validate whether the identified mutations have the potential to confer anti-tumor immunity after vaccination to naïve mice we investigated this question with the peptide for mutation number 30 that was shown to induce a mutation selective T-cell reactivity. B16F10 cells (7,5×10.sup.4) were inoculated subcutaneously on d0. Mice were vaccinated with peptide 30 (see table 1; 100 μg peptide+50 μg PolyI:C s.c.) on day −4, day +2, and day +9. The control group received only Poly I:C (50 μg s.c.). Tumor growth was monitored every other day. At day +16 we observed that only 1 out of 5 mice in the peptide vaccine group had developed a tumor whereas in the control group 4 out of 5 mice showed tumor growth.

    [0388] The data prove that a peptide sequence incorporating a B16F10 specific mutation can confer anti tumor immunity that is efficiently able to destroy tumor cells (see FIG. 4). Since B16F10 is a highly aggressive tumor cell line the finding that the methodology applied to identify and prioritize mutations finally led to the selection of a mutation that by itself already is potent as a vaccine is an important proof of concept for the whole process.

    Example 4: Data Supporting Polyepitopic Antigen Presentation

    [0389] Validated mutations from protein-coding regions of a patient constitute the pool from which candidates can be selected for assembly of the poly-neo-epitope vaccine template to be used as precursor for GMP manufacturing of the RNA vaccine. Suitable vector cassettes as vaccine backbone has been already described (Holtkamp, S. et al., Blood, 108: 4009-4017, 2006; Kreiter, S. et al., Cancer Immunol. Immunother., 56: 1577-1587, 2007; Kreiter, S. et al., J. Immunol., 180: 309-318, 2008). The preferred vector cassettes are modified in their coding and untranslated regions (UTR) and ensure maximized translation of the encoded protein for extended periods (Holtkamp, S. et al., Blood, 108: 4009-4017, 2006; Kuhn, A. N. et al., Gene Ther., 17: 961-971, 2010). Furthermore, the vector backbone contains antigen routing modules for the simultaneous expansion of cytotoxic as well as helper T-cells (Kreiter, S. et al., Cancer Immunol. Immunother., 56: 1577-1587, 2007; Kreiter, S. et al., J. Immunol., 180: 309-318, 2008; Kreiter, S. et al., Cancer Research, 70 (22), 9031-9040, 2010 (FIG. 5). Importantly, we have proven that such RNA vaccine can be used to present multiple MHC class I and class II epitopes simultaneously.

    [0390] The IVAC poly-neo-epitope RNA vaccine sequences are built from stretches of up to 30 amino acids that include the mutation in the center. These sequences are connected head-to-tail via short linkers to form a poly-neo-epitope vaccine coding for up to 30 or more selected mutations and their flanking regions. These patient-specific individually tailored inserts are codon-optimized and cloned into the RNA backbone described above. Quality control of such constructs includes in vitro transcription and expression in cells for validation of functional transcription and translation. Analysis of translation will be performed with antibodies against the c-terminal targeting domain.

    Example 5: Scientific Proof of Concept for the RNA Poly-Neo Epitope Construct

    [0391] The RNA poly-neo epitope concept is based on a long in vitro transcribed mRNA which consists of sequentially arranged sequences coding for the mutated peptides connected by linker sequences (see FIG. 6). The coding sequences are chosen from the non synonymous mutations and are always built up of the codon for the mutated amino acid flanked by regions of 30 to 75 base-pairs from the original sequence context. The linker sequence codes for amino acids that are preferentially not processed by the cellular antigen processing machinery. In vitro transcription constructs are based on the pST1-A120 vector containing a T7 promotor, a tandem beta-globin 3′ UTR sequence and a 120-bp poly(A) tail, which have been shown to increase the stability and translational efficiency of the RNA thereby enhancing the T-cell stimulatory capacity of the encoded antigen (Holtkamp S. et al., Blood 2006; PMID: 16940422). In addition, an MHC class I signal peptide fragment and the transmembrane and cytosolic domains including the stop-codon (MHC class I trafficking signal or MITD) flanking a poly-linker sequence for cloning the epitopes were inserted (Kreiter S. et al., J. Immunol., 180: 309-318, 2008). The latter have been shown to increase the antigen presentation, thereby enhancing the expansion of antigen-specific CD8+ and CD4+ T cells and improving effector functions.

    [0392] For a first proof of concept, biepitopic vectors were used, i.e. encoding one polypeptide containing two mutated epitopes. Codon optimized sequences coding for (i) a mutated epitope of 20 to 50 amino acids, (ii) a glycine/serine-rich linker, (iii) a second mutated epitope of 20 to 50 amino acids, and (iv) an additional glycine/serine-rich linker—flanked by suitable recognition sites for restriction endonucleases to be cloned into the pST1-based construct as described above—were designed and synthesized by a commercial provider (Geneart, Regensburg, Germany). After verification of the sequence, these were cloned into the pST1-based vector backbone to obtain constructs as depicted in FIG. 6.

    [0393] The pST1-A120-based plasmids as described above were linearized with a class IIs restriction endonuclease. The linearized plasmid DNAs were purified by phenol chloroform extraction and ethanol precipitation. Linearized vector DNAs were quantified spectrophotometrically and subjected to in vitro transcription essentially as described by Pokrovskaya and Gurevich (1994, Anal. Biochem. 220: 420-423). A cap analog has been added to the transcription reaction to obtain RNAs with the correspondingly modified 5′-cap structures. In the reactions, GTP was present at 1.5 mM, while the cap-analog was present at 6.0 mM. All other NTPs were present at 7.5 mM. At the end of the transcription reaction, linearized vector DNA was digested with 0.1 U/μl TURBO DNase (Ambion, Austin/TX, USA) for 15 minutes at 37° C. RNAs were purified from these reactions using the MEGAclear Kit (Ambion, Austin/TX, USA) as per manufacturer's protocol. RNA concentration and quality were assessed by spectrophotometry and analysis on a 2100 Bioanalyzer (Agilent, Santa Clara, Calif., USA).

    [0394] In order to proof that a sequence incorporating a mutated amino acid and being 5′—as well as 3′-flanked by the linker sequence can be processed, presented and recognized by antigen specific T-cells we used T-cells from peptide vaccinated mice as effector cells. In an IFNγ ELISpot we tested whether the T-cells induced by peptide vaccination as described above are capable of recognizing the target cells (bone marrow dendritic cells, BMDC) either pulsed with peptide (2 μg/ml for 2 h at 37° C. and 5% CO.sub.2) or transfected with RNA (20 μg produced as described above) by electroporation. As exemplified in FIG. 7 for mutation 12 and 30 (see table 2) we could observe that the RNA construct is able to give rise to the epitope recognized by mutation specific T-cells.

    [0395] With the data provided we could demonstrate that an RNA encoded poly-neo epitope including glycine/serine rich linker can be translated and processed in antigen presenting cells leading to presentation of the correct epitope that is recognized by the antigen specific T-cells.

    Example 6: Poly-Neo-Epitope Vaccine Design—the Relevance of the Linker

    [0396] The poly-neo-epitope RNA construct contains a backbone construct into which multiple somatic mutation-encoding peptides connected with a linker peptide sequence are placed. In addition to codon optimization and increased RNA stability and translational efficiency due to the backbone, one embodiment of the RNA poly-neo-epitope vaccine contains linkers designed to increase MHC Class I and II presentation of antigenic peptides and decrease presentation of deleterious epitopes.

    [0397] Linker: the linker sequence was designed to connect multiple mutation-containing peptides. The linker should enable creation and presentation of the mutation epitope while hinder creation of deleterious epitopes, such as those created at the junction suture between adjacent peptides or between linker sequence and endogenous peptides. These “junction” epitopes may not only compete with the intended epitopes to be presented on the cell surface, decreasing vaccine efficacy, but could generate an unwanted auto-immune reaction. Thus, we designed the linker sequence to a) avoid creating “junction” peptides that bind to MHC molecules, b) avoid proteasomal processing to create “junction” peptides, c) be efficiently translated and processed by the proteasome.

    [0398] To avoid creation of “junction” peptides that bind MHC molecules, we compared different linker sequences. Glycine, for example, inhibits strong binding in MHC binding groove positions [Abastado J P. et al., J Immunol. 1993 Oct. 1; 151(7): 3569-75]. We examined multiple linker sequences and multiple linker lengths and calculated the number of “junction” peptides that bind MHC molecules. We used software tools from the Immune Epitope Database (IEDB, http://www.immuneepitope.org/) to calculate the likelihood that a given peptide sequence contains a ligand that will bind MHC Class I molecules.

    [0399] In the B16 model, we identified 102 expressed, non-synonymous somatic mutations predicted to be presented on MHC Class I molecules. Using the 50 confirmed mutations, we computationally designed different vaccine constructs, including either the use of no linkers or the use of different linker sequences, and computed the number of deleterious “junction” peptides using the IEDB algorithm (FIG. 8).

    [0400] Table 5 shows the results of several different linkers, different linker lengths, and the use of no linker and five linkers. The number of MHC-binding junction peptides ranges from 2 to 91 for the 9 aa and 10 aa epitope predictions (top and middle). The size of the linker influences the number of junction peptides (bottom). For this sequence, the fewest 9 aa epitopes are predicted for the 7 aa linker sequence GGSGGGG.

    [0401] The Linker 1 and Linker 2 used in the RNA poly-neo epitope vaccine constructs tested experimentally (see below) also had a favorably low number of predicted junctional neoepitopes. This holds true for predictions of 9-mers and 10-mers.

    [0402] This demonstrates that the sequence of the linker is critically important for the creation of bad MHC binding epitopes. Furthermore, the length of the linker sequence impacts the number of bad MHC binding epitopes. We find that sequences that are G-rich hinder the creation of MHC-binding ligands.

    TABLE-US-00004 TABLE 3 Impact of Linker (10 aa epitopes). The predicted number of bad epitopes defined as MHC Class I binding epitopes that contain junction sequences, for each peptide linker. Here, 10 amino acid epitopes are considered. Glycine-rich linkers have the fewest junction epitopes. Linker # bad epitopes (10 aa) none 14 TSLNALLNAH 54 SIINFEKL 65 SSSSSSSSSS 85 GGGGGGGGGG 6 GGSGGGGSGG (Linker 1) 8 GGSGGGSGGG (Linker 2) 9

    TABLE-US-00005 TABLE 4 Impact of Linker Part (9 aa epitopes). The predicted number of bad epitopes, defined as MHC Class I binding epitopes that contain junction sequences, for each peptide linker. Here, 9 amino acid epitopes are considered. Glycine-rich linkers have the fewest junction epitopes. Linker # bad epitopes (9 aa) none 17 TSLNALLNAH 83 SIINFEKL 64 SSSSSSSSSS 33 GGGGGGGGGG 2 GGSGGGGSGG (Linker 1) 4 GGSGGGSGGG (Linker 2) 3

    TABLE-US-00006 TABLE 5 Impact of Linker Part. The predicted number of bad epitopes, defined as MHC Class I binding epitopes that contain junction sequences, for each peptide linker. Here, 9 amino acid epitopes are considered. Top: the number of 9 aa junction epitopes for no linker and 5 diverse linkers. Middle: the number of 10 aa junction epitopes for no linker and 5 diverse linkers. Lower: the number of 99 aa junction epitopes for similar linkers of different lengths. Glycine-rich linkers have the fewest junction epitopes. Linker sequence # junction epitopes (9aa) none 17 TSLNALLNA 91 SIINFEKL 64 SSSSSSSSS 33 GGGGGGGGG 2 GGSGGGGSG 4 Linker sequence # junction epitopes (10aa) none 14 TSLNALLNA 63 SIINFEKL 65 SSSSSSSSS 85 GGGGGGGGG 6 GGSGGGSGG 9 Linker sequence # junction epitopes (9aa) GGSGG 5 GGSGGG 4 GGSGGGG 2 GGSGGGGS 7 GGSGGGGSG 4 GGSGGGGSGG 4

    [0403] To avoid proteasomal processing that may create “junction” peptides, we explored usage of different amino acids in the linker. Glycine rich sequences impair proteasomal processing [Hoyt M A et al. (2006). EMBO J 25 (8): 1720-9; Zhang M. and Coffino P. (2004) J Biol Chem 279 (10): 8635-41]. Thus glycine rich linker sequences act to minimize the number of linker-containing peptides that can be processed by the proteasome.

    [0404] The linker should allow the mutation-containing peptides to be efficiently translated and processed by the proteasome. Amino acids glycine and serine are flexible [Schlessinger A and Rost B., Proteins. 2005 Oct. 1; 61(1):115-26]; including them in a linker results in a more flexible protein. We incorporate glycine and serine into the linker to increase protein flexibility which should allow more efficient translation and processing by the proteasome, in turn enabling better access to the encoded antigenic peptides.

    [0405] Thus, the linker should be glycine rich to hinder the creation of MHC binding bad epitopes; should hinder the ability of the proteasome to process linker peptides, which can be accomplished through inclusion of glycine; and should be flexible to increase access to mutation containing peptides, which can be accomplished through the combination of glycine and serine amino acids. Therefore, in one embodiment of the vaccine construct of the invention, the sequences GGSGGGGSGG and GGSGGGSGGS are preferably included as linker sequences.

    Example 7: RNA Poly-Neo Epitope Vaccine

    [0406] The RNA poly-neo epitope vaccine constructs are based on the pST1-A120 vector containing a T7 promotor, a tandem beta-globin 3′ UTR sequence and a 120-bp poly(A) tail, which have been shown to increase the stability and translational efficiency of the RNA thereby enhancing the T-cell stimulatory capacity of the encoded antigen ((Holtkamp S. et al., Blood 2006; PMID: 16940422). In addition, an MHC class I signal peptide fragment and the transmembrane and cytosolic domains including the stop-codon (MHC class I trafficking signal or MITD) flanking a poly-linker sequence for cloning the epitopes were inserted (Kreiter S. et al., J. Immunol., 180: 309-318, 2008). The latter have been shown to increase the antigen presentation, thereby enhancing the expansion of antigen-specific CD8+ and CD4+ T cells and improving effector functions.

    [0407] To provide RNA poly-neo epitope constructs for the 50 identified and validated mutations of B16F10 3 RNA constructs were generated. The construct consists of codon optimized sequences coding for (i) a mutated epitope of 25 amino acids, (ii) a glycine/serine-rich linker, (iii) repetitions of mutated epitope sequence followed by a glycine/serine-rich linker. The chain of mutated epitope containing sequences and linkers is flanked by suitable recognition sites for restriction endonucleases to be cloned into the pST1-based construct as described above. The vaccine constructs were designed and synthesized by GENEART. After verification of the sequence, these were cloned into the pST1-based vector backbone to obtain the RNA poly-neo epitope vaccine constructs.

    Description of the Clinical Approach

    [0408] The Clinical Application will cover following steps: [0409] Eligible patients must consent to DNA analysis by next generation sequencing. [0410] Tumor specimen obtained from routine diagnostic procedures (paraffin embedded formalin fixed tissue) and peripheral blood cells will be obtained and used for mutation analysis as described. [0411] Discovered mutations will be confirmed [0412] Based on Prioritization vaccine will be designed. For RNA vaccines a master plasmid template will be generated by gene synthesis and cloning [0413] Plasmids will be used for clinical grade RNA production, quality control and release of the RNA vaccine. [0414] The vaccine drug product will be sent to the respective trial center for clinical application. [0415] The RNA vaccine can be used as a naked vaccine in formulation buffer or encapsulated into nanoparticles or liposomes for direct injection into e.g. lymph nodes, s.c., i.v., i.m. Alternatively, the RNA vaccine can be used for in vitro transfection e.g of dendritic cells for adoptive transfer.

    [0416] The whole clinical process takes less than 6 weeks. The “lag phase” between patient informed consent and availability of the drug will be carefully addressed by the clinical trial protocol, including allowing the standard treatment regimen to be continued until the investigational drug product is available.

    Example 8: Identification of Tumor Mutations and Exploiting them for Tumor Vaccination

    [0417] We applied NGS exome resequencing for mutation discovery in the B16F10 murine melanoma cell line and identified 962 non-synonymous somatic point mutations, 563 in expressed genes. Potential driver mutations occur in classical tumor suppressor genes (Pten, Trp53, Tp63, Pml) and genes involved in proto-oncogenic signaling pathways that control cell proliferation (e.g. Mdm1, Pdgfra), cell adhesion and migration (e.g. Fdz7, Fat1) or apoptosis (Casp9). Moreover, B16F10 harbors mutations in Aim1 and Trrap that were previously described to be frequently altered in human melanoma.

    [0418] The immunogenicity and specificity of 50 validated mutations were assayed using C57BL/6 mice immunized with long peptides encoding the mutated epitopes. One third (16/50) of them were shown to be immunogenic. Of these, 60% elicited immune responses preferentially directed against the mutated sequence as compared to the wild type sequence.

    [0419] We tested the hypothesis in tumor transplant models. Immunization with peptides conferred in vivo tumor control in protective and therapeutic settings, qualifying mutated epitopes containing single amino acid substitutions as effective vaccines.

    Animals

    [0420] C57BL/6 mice (Jackson Laboratories) were kept in accordance with federal and state policies on animal research at the University of Mainz.

    Cells

    [0421] B16F10 melanoma cell line was purchased in 2010 from the American Type Culture Collection (Product: ATCC CRL-6475, Lot Number: 58078645). Early (3rd, 4th) passages of cells were used for tumor experiments. Cells were routinely tested for Mycoplasma. Re-authentication of cells has not been performed since receipt.

    Next-Generation Sequencing

    [0422] Nucleic acid extraction and sample preparation: DNA and RNA from bulk B16F10 cells and DNA from C57BL/6 tail tissue were extracted in triplicate using Qiagen DNeasy Blood and Tissue kit (for DNA) and Qiagen RNeasy Micro kit (for RNA).

    [0423] DNA exome sequencing: Exome capture for DNA resequencing was performed in triplicate using the Agilent Sure-Select mouse solution-based capture assay (Gnirke A et al., Nat Biotechnol 2009; 27:182-9), designed to capture all mouse protein coding regions. 3 μg purified genomic DNA (gDNA) was fragmented to 150-200 bp using a Covaris S2 ultrasound device. Fragments were end repaired and 5′ phosphorylated and 3′ adenylated according to the manufacturer's instructions. Illumina paired end adapters were ligated to the gDNA fragments using a 10:1 molar ratio of adapter to gDNA. Enriched pre capture and flow cell specific sequences were added using Illumina PE PCR primers 1.0 and 2.0 for 4 PCR cycles. 500 ng of adapter ligated, PCR enriched gDNA fragments were hybridized to Agilent's SureSelect biotinylated mouse whole exome RNA library baits for 24 his at 65° C. Hybridized gDNA/RNA bait complexes where removed using streptavidin coated magnetic beads, washed and the RNA baits cleaved off during elution in SureSelect elution buffer. These eluted gDNA fragments were PCR amplified post capture 10 cycles. Exome enriched gDNA libraries were clustered on the cBot using Truseq SR cluster kit v2.5 using 7 pM and 50 bps were sequenced on the Illumina HiSeq2000 using Truseq SBS kit-HS 50 bp.

    [0424] RNA gene expression “transcriptome” profiling (RNA-Seq): Barcoded mRNA-seq cDNA libraries were prepared in triplicate, from 5 μg of total RNA (modified Illumina mRNA-seq protocol). mRNA was isolated using Seramag Oligo(dT) magnetic beads (Thermo Scientific) and fragmented using divalent cations and heat. Resulting fragments (160-220 bp) were converted to cDNA using random primers and SuperScriptII (Invitrogen) followed by second strand synthesis using DNA polymerase I and RNaseH. cDNA was end repaired, 5′ phosphorylated and 3′ adenylated according to the manufacturer's instructions. 3′ single T-overhang Illumina multiplex specific adapters were ligated with T4 DNA ligase using a 10:1 molar ratio of adapter to cDNA insert. cDNA libraries were purified and size selected at 200-220 bp (E-Gel 2% SizeSelect gel, Invitrogen). Enrichment, adding of Illumina six base index and flow cell specific sequences was done by PCR using Phusion DNA polymerase (Finnzymes). All cleanups up to this step were done with 1.8× volume of AgencourtAMPure XP magnetic beads. All quality controls were done using Invitrogen's Qubit HS assay and fragment size was determined using Agilent's 2100 Bioanalyzer HS DNA assay. Barcoded RNA-Seq libraries were clustered and sequenced as described above.

    [0425] NGS data analysis, gene expression: The output sequence reads from RNA samples were preprocessed according to the Illumina standard protocol, including filtering for low quality reads. Sequence reads were aligned to the mm9 reference genomic sequence (Waterston R H et al., Nature 2002; 420:520-62) with bowtie (version 0.12.5) (Langmead B et al., Genome Biol 2009; 10:R25). For genome alignments, two mismatches were allowed and only the best alignment (“−v2—best”) was recorded; for transcriptome alignments the default parameters were used. Reads not alignable to the genomic sequence were aligned to a database of all possible exon-exon junction sequences of RefSeq transcripts (Pruitt K D et al., Nucleic Acids Res 2007; 35:D61-D65). Expression values were determined by intersecting read coordinates with those of RefSeq transcripts, counting overlapping exon and junction reads, and normalizing to RPKM expression units (Reads which map per Kilobase of exon model per million mapped reads) (Mortazavi A et al., Nat Methods 2008; 5:621-8).

    [0426] NGS data analysis, somatic mutation discovery: Somatic mutations were identified as described in Example 9. 50 nucleotide (nt), single-end reads were aligned to the mm9 reference mouse genome using bwa (default options, version 0.5.8c) (Li H and Durbin R, Bioinformatics 2009; 25:1754-60). Ambiguous reads mapping to multiple locations of the genome were removed. Mutations were identified using three software programs: samtools (version 0.1.8) (Li H, Bioinformatics 2011; 27:1157-8), GATK (version 1.0.4418) (McKenna A et al, Genome Res 2010; 20:1297-303), and SomaticSniper (http://genome.wustl.edu/software/somaticsniper) (Ding L et al., Hum Mol Genet 2010; 19:R188-R196). Potential variations identified in all B16F10 triplicates were assigned a “false discovery rate” (FDR) confidence value (cf. Example 9).

    Mutation Selection, Validation, and Function

    [0427] Selection: Mutations had to fulfill following criteria to be selected: (i) present in all B16F10 and absent in all C57BL/6 triplicates, (ii) FDR≤0.05, (iii) homogeneous in C57BL/6, (iv) occur in a RefSeq transcript, and (v) cause non-synonymous changes to be scored as an authentic mutation. Selection for validation and immunogenicity testing required that mutations are expressed genes (median RPKM across replicates >10).

    [0428] Validation: DNA-derived mutations were classified as validated if confirmed by either Sanger sequencing or the B16F10 RNA-Seq reads. All selected variants were amplified from 50 ng of DNA from B16F10 cells and C57BL/6 tail tissue using flanking primers, products visualized (QIAxcel system, Qiagen) and purified (QIAquick PCR Purification Kit, Qiagen). The amplicon of the expected size was excised from the gel, purified (QIAquick Gel Extraction Kit, Qiagen) and subjected to Sanger sequencing (Eurofins MWG Operon, Ebersberg, Germany) with the forward primer used for PCR amplification.

    [0429] Functional impact: The programs SIFT (Kumar P et al., Nat Protoc 2009; 4:1073-81) and POLYPHEN-2 (Adzhubei I A et al., Nat Methods 2010; 7:248-9), which predict the functional significance of an amino acid on protein function based on the location of protein domains and cross-species sequence conservation, were employed to assess the impact of selected mutations. Ingenuity IPA tools were used to infer gene function.

    Synthetic Peptides and Adjuvants

    [0430] All peptides including ovalbumin class I (OVA.sub.258-265), class II (OVA class II.sub.330-338), influenza nucleoprotein (Inf-NP.sub.366-374), vesiculo-stomatitis virus nucleoprotein (VSV-NP.sub.52-59) and tyrosinase-related protein 2 (Trp2.sub.180-188) were purchased from Jerini Peptide Technologies (Berlin, Germany). Synthetic peptides were 27 amino acids long with the mutated (MUT) or wild type (WT) amino acid on position 14. Polyinosinic:polycytidylic acid (poly(I:C), InvivoGen) was used as subcutaneously injected adjuvant. MHC-Pentamer specific for the Inf-NP.sub.366-374 peptide was purchased from ProImmune Ltd.

    Immunization of Mice

    [0431] Age-matched female mice C57BL/6 mice were injected subcutaneously with 100 μg peptide and 50 μg poly(I:C) formulated in PBS (200 μl total volume) into the lateral flank (5 mice per group). Every group was immunized on day 0 and day 7 with two different mutation coding peptides, one peptide per flank. Twelve days after the initial injection mice were sacrificed and splenocytes were isolated for immunological testing.

    [0432] Alternatively, age-matched female mice C57BL/6 mice were injected intravenously with 20 μg in vitro transcribed RNA formulated with 20 μl Lipofectamine™ RNAiMAX (Invitrogen) in PBS in a total injection volume of 200 μl (3 mice per group). Every group was immunized on day 0, 3, 7, 14 and 18. Twenty-three days after the initial injection mice were sacrificed and splenocytes were isolated for immunological testing. DNA-sequences representing one (Monoepitope), two (Biepitope), or 16 mutations (Polyepitope) were constructed using 50 amino acids (aa) with the mutation on position 25 (Biepitope) or 27 aa with the mutation on position 14 (Mono- and Polyepitope), were separated by a glycin/serine linker of 9aa and cloned into the pST1-2BgUTR-A120 backbone (Holtkamp et al., Blood 2006; 108:4009-17). In vitro transcription from this template and purification were previously described (Kreiter et al., Cancer Immunol Immunother 2007; 56:1577-87).

    Enzyme-Linked Immunospot Assay

    [0433] Enzyme-linked immunospot (ELISPOT) assay (Kreiter S et al., Cancer Res 2010; 70:9031-40) and generation of syngeneic bone marrow derived dendritic cells (BMDCs) as stimulators were previously described (Lutz M B et al., J Immunol Methods 1999; 223:77-92). BMDCs were either peptide pulsed (2 μg/ml), or transfected with in vitro transcribed (IVT) RNA coding for the indicated mutation or for control RNA (eGFP-RNA). Sequences representing two mutations, each comprising 50 amino acids with the mutation on position 25 and separated by a glycin/serine linker of 9aa were cloned into the pST1-2BgUTR-A120 backbone (Holtkamp S et al., Blood 2006; 108:4009-17). In vitro transcription from this template and purification were previously described (Kreiter S et al., Cancer Immunol Immunother 2007; 56:1577-87). For the assay, 5×10.sup.4 peptide or RNA engineered BMDCs were coincubated with 5×10.sup.5 freshly isolated splenocytes in a microtiter plate coated with anti-IFN-γ antibody (10 μg/mL, clone AN18; Mabtech). After 18 hours at 37° C., cytokine secretion was detected with an anti-IFN-γ antibody (clone R4-6A2; Mabtech). Spot numbers were counted and analyzed with the ImmunoSpot® S5 Versa ELISPOT Analyzer, the ImmunoCapture™ Image Acquisition software and the ImmunoSpot® Analysis software Version 5. Statistical analysis was done by student's t-test and Mann-Whitney test (non-parametric test). Responses were considered significant, when either the test gave a p-value <0.05 and the mean spot numbers were >30 spots/5×10.sup.5 effector cells. Reactivities were rated by mean spot numbers (−: <30; +: >30; ++: >50; +++>200 spots/well).

    Intracellular Cytokine Assay

    [0434] Aliquots of the splenocytes prepared for the ELISPOT assay were subjected to analysis of cytokine production by intracellular flow cytometry. To this end 2×10.sup.6 splenocytes per sample were plated in culture medium (RPMI 10% FCS) supplemented with the Golgi inhibitor Brefeldin A (10 μg/mL) in a 96-well plate. Cells from each animal were restimulated for 5 h at 37° C. with 2×10.sup.5 peptide pulsed BMDCs. After incubation the cells were washed with PBS, resuspended in 50 μl PBS and extracellularly stained with the following anti-mouse antibodies for 20 min at 4° C.: anti-CD4 FITC, anti-CD8 APC-Cy7 (BD Pharmingen). After incubation the cells were washed with PBS and subsequently resuspended in 100 μL Cytofix/Cytoperm (BD Bioscience) solution for 20 min at 4° C. for permeabilization of the outer membrane. After permeabilization the cells were washed with Perm/Wash-Buffer (BD Bioscience), resuspended in 50 μL/sample in Perm/Wash-Buffer and intracellularly stained with the following anti-mouse antibodies for 30 min at 4° C.: anti-IFN-γ PE, anti-TNF-α PE-Cy7, anti-IL2 APC (BD Pharmingen). After washing with Perm/Wash-Buffer the cells were resuspended in PBS containing 1% paraformyldehyde for flow cytometry analysis. The samples were analyzed using a BD FACSCanto™ II cytometer and FlowJo (Version 7.6.3).

    B16 Melanoma Tumor Model

    [0435] For tumor vaccination experiments 7.5×10.sup.4 B16F10 melanoma cells were inoculated s.c. into the flanks of C57BL/6 mice. In the prophylactic setting, immunization with mutation-specific peptide was performed 4 days before and on days 2 and 9 after tumor inoculation. For the therapeutic experiment the peptide vaccine was administered on days 3 and 10 after tumor injection. The tumor sizes were measured every three days and mice were sacrificed when tumor diameter reached 15 mm.

    [0436] Alternatively, for tumor vaccination experiments 1×10.sup.5 B16F10 melanoma cells were inoculated s.c. into the flanks of age-matched female C57BL/6 mice. Peptide vaccination was performed on days 3, 10 and 17 after tumor inoculation with 100 μg peptide and 50 μg poly(LC) formulated in PBS (200 μl total volume) injected subcutaneously into the lateral flank. RNA immunizations were performed using 20 μg in vitro transcribed mutation-encoding RNA formulated with 20 μl Lipofectamine™ RNAiMAX (Invitrogen) in PBS in a total injection volume of 200 μl. As control one group of animals was injected with RNAiMAX (Invitrogen) in PBS. The animals were immunized on days 3, 6, 10, 17 and 21 after tumor inoculation. The tumor sizes were measured every three days using a caliper and mice were sacrificed when tumor diameter reached 15 mm.

    Identification of Non-Synonymous Mutations in B16F10 Mouse Melanoma

    [0437] Our objective was to identify potentially immunogenic somatic point mutations in B16F10 mouse melanoma by NGS and to test these for in vivo immunogenicity by peptide vaccination of mice measuring elicited T-cell responses by ELISPOT assay (FIG. 9A). We sequenced the exomes of the C57BL/6 wild type background genome and of B16F10 cells, each with triplicate extractions and captures. For each sample, more than 100 million single-end 50 nt reads were generated. Of these 80%, align uniquely to the mouse mm9 genome and 49% align on target, demonstrating successful target enrichment and resulting in over 20-fold coverage for 70% of the target nucleotides in each of the triplicate samples. RNA-Seq of B16F10 cells, also profiled in triplicate, generated a median of 30 million single-end 50 nt reads, of which 80% align to the mouse transcriptome.

    [0438] DNA reads (exome-capture) from B16F10 and C57BL/6 were analyzed to identify somatic mutations. Copy number variation analysis (Sathirapongsasuti J F et al., Bioinformatics 2011; 27:2648-54) demonstrated DNA amplifications and deletions in B16F10, including the homozygous deletion of tumor suppressor Cdkn2a (Cyclin-dependent kinase inhibitor 2A, p16Ink4A). Focusing on point mutations to identify possible immunogenic mutations, we identified 3570 somatic point mutations at FDR<0.05 (FIG. 9B). The most frequent class of mutations were C>T/G>A transitions, typically resulting from ultraviolet light (Pfeifer G P et al., Mutat Res 2005; 571:19-31). Of these somatic mutations, 1392 occur in transcripts, with 126 mutations in untranslated regions. Of the 1266 mutations in coding regions, 962 cause non-synonymous protein changes and 563 of these occur in expressed genes (FIG. 9B).

    Assignment of Identified Mutations to Carrier Genes and Validation

    [0439] Noteworthy, many of the mutated genes (962 genes containing non-synonymous somatic point mutations) have been previously associated with the cancer phenotypes. Mutations were found in established tumor suppressor genes, including Pten, Trp53 (also called p53), and Tp63. In Trp53, the best established tumor suppressor (Zilfou J T et al., Cold Spring Harb Perspect Biol 2009; 1:a001883), the asparagine to aspartic acid mutation at protein position 127 (p.N127D) is localized in the DNA binding domain and is predicted by SIFT to alter function. Pten contained two mutations (p.A39V, p.T131P), both of which are predicted to have deleterious impact on protein function. The p.T131P mutation is adjacent to a mutation (p.R130M) shown to diminish phosphatase activity (Dey N et al., Cancer Res 2008; 68:1862-71). Moreover, mutations were found in genes associated with DNA repair pathways, such as Brca2 (breast cancer 2, early onset), Atm (ataxia telangiectasia mutated), Ddb1 (damage-specific DNA binding protein 1) and Rad9b (RAD9 homolog B). Furthermore, mutations occur in other tumor associated genes, including Aim1 (tumor suppressor “Absent In Melanoma 1”), Flt1 (oncogene Vegr1, fins-related tyrosine kinase 1), Pml (tumor suppressor “promyelocytic leukemia”), Fat1 (“FAT tumor suppressor homolog 1”), Mdm1 (TP53 binding nuclear protein), Mta3 (metastasis associated 1 family, member 3), and Alk (anaplastic lymphoma receptor tyrosine kinase). We found a mutation at p.S144F in Pdgfra (platelet-derived growth factor receptor, alpha polypeptide), a cell-membrane-bound receptor tyrosine kinase of the MAPK/ERK pathway, previously identified in tumors (Verhaak R G et al., Cancer Cell 2010; 17:98-110). A mutation occurs at p.L222V in Casp9 (caspase 9, apoptosis-related cysteine peptidase). CASP9 proteolytically cleaves poly(ADP-ribose) polymerase (PARP), regulates apoptosis, and has been linked to several cancers (Hajra K M et al., Apoptosis 2004; 9:691-704). The mutation we found may potentially impact PARP and apoptosis signaling. Most interestingly, no mutations were found in Braf, c-Kit, Kras or Nras. However, mutations were identified in Rassf7 (RAS-associated protein) (p.S90R), Ksr1 (kinase suppressor of ras 1) (p.L301V), and Atm (PI3K pathway) (p.K91T), all of which are predicted to have significant impact on protein function. Trrap (transformation/transcription domain-associated protein) was identified earlier this year in human melanoma specimens as a novel potential melanoma target (Wei X et al., Nat Genet 2011; 43:442-6). In B16F10, a Trrap mutation occurs at p.K2783R and is predicted to disturb the overlapping phosphatidylinositol kinase (PIK)-related kinase FAT domain.

    [0440] From the 962 non-synonymous mutations identified using NGS, we selected 50 mutations, including 41 with FDR<0.05, for PCR-based validation and immunogenicity testing. Selection criteria were location in an expressed gene (RPKM>10) and predicted immunogenicity. Noteworthy, we were able to validate all 50 mutations (Table 6, FIG. 9B).

    TABLE-US-00007 TABLE 6 Mutations selected for validation. From left: assigned ID, gene symbol, amino acid substitution and position, gene name, predicted subcellular localization and type (Ingenuity). Subcellular ID Symbol Change Entrez Gene Name localization Type MUT1 Fzd7 p.G304A frizzled family receptor 7 Plasma Membrane G-protein coupled receptor MUT2 Xpot p.I830S exportin, tRNA (nuclear export receptor for tRNAs) Nucleus other MUT3 Ranbp2 p.Q2S71H RAN binding protein 2 Nucleus enzyme MUT4 Dnajb12 p.P54T DnaJ (Hsp40) homolog, subfamily B, member 12 Cytoplasm other MUT5 Eef2 p.G795A eukaryotic translation elongation factor 2 Cytoplasm translation regulator MUT6 Ptrf p.D382G polymerase I and transcript release factor Nucleus transcription regulator MUT7 Trp53 p.N128D tumor protein p53 Nucleus transcription regulator MUT8 Ddx23 p.V602A DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 Nucleus enzyme MUT9 Golgb1 p.E2855D golgin B1 Cytoplasm other MUT10 Pcdhga11 p.G82R protocadherin gamma subfamily A, 11 Plasma Membrane other MUT11 Snx15 p.E211G sorting nexin 15 Cytoplasm transporter MUT12 Gnas p.S112G GNAS (guanine nucleotide binding protein, alpha Plasma Membrane enzyme stimulating) complex locus MUT13 Fndc3b p.C561W fibronectin type III domain containing 3B Cytoplasm other MUT14 Sbno1 p.P309T strawberry notch homolog 1 (Drosophila) unknown enzyme MUT15 Pi4k2b p.R344Q phosphatidylinositol 4-kinase type 2 beta Cytoplasm kinase MUT16 Thumpd3 p.T243S THUMP domain containing 3 unknown other MUT17 Tnpo3 p.G504A transportin 3 Cytoplasm other MUT18 Numa1 p.Q447K nuclear mitotic apparatus protein 1 Nucleus other MUT19 Wwp2 p.E742K WW domain containing E3 ubiquitin protein ligase 2 Cytoplasm enzyme MUT20 Tubb3 p.G402A tubulin, beta 3 Cytoplasm other MUT21 Atp11a p.R522S ATPase, class VI, type 11A Plasma Membrane transporter MUT22 Asf1b p.A141P ASF1 anti-silencing function 1 homolog B Nucleus other (S. cerevisiae) MUT23 Wdr82 p.I221L WD repeat domain 82 Nucleus other MUT24 Dag1 p.P425A dystroglycan 1 (dystrophin-associated glycoprotein 1) Plasma Membrane transmembrane receptor MUT25 Plod2 p.F530V procollagen-lysine, 2-oxoglutarate 5-dioxygenase 2 Cytoplasm enzyme MUT26 Orc2 p.F278V origin recognition complex, subunit 2 Nucleus other MUT27 Obsl1 p.T1764M obscurin-like 1 unknown other MUT28 Ppplr7 p.L170P protein phosphatase 1, regulatory (inhibitor) subunit 7 Nucleus phosphatase MUT29 Mthfd1l p.F294V methylenetetrahydrofolate dehydrogenase (NADP+ Cytoplasm enzyme dependent) 1-like MUT30 Kif18b p.K739N kinesin family member 18B unknown other MUT31 Ascc2 p.A59G activating signal cointegrator 1 complex subunit 2 unknown other MUT32 Itsn2 p.S1551R intersectin 2 Cytoplasm other MUT33 Pbk p.V145D PDZ binding kinase Cytoplasm kinase MUT34 Klhl22 p.F179V kelch-like 22 (Drosophila) unknown other MUT35 Ddb1 p.L438I damage-specific DNA binding protein 1, 127 kDa Nucleus other MUT36 Tm9sf3 p.Y382H transmembrane 9 superfamily member 3 Cytoplasm transporter MUT37 Dpf2 p.F275V D4, zinc and double PHD fingers family 2 Nucleus other MUT38 Atrn p.S745N attractin Extracellular Space other MUT39 Snx5 p.R373Q sorting nexin 5 Cytoplasm transporter MUT40 Armc1 p.S85I armadillo repeat containing 1 Cytoplasm other MUT41 Ash1l p.L632I ash1 (absent, small, or homeotic)-like (Drosophila) Nucleus transcription regulator MUT42 S100a132510039O18 p.S18C S100 calcium binding protein A13 Cytoplasm other MUT43 Rik p.E391K KIAA2013 unknown other MUT44 Cpsf31 p.D314N cleavage and polyadenylation specific factor 3-like Nucleus other MUT45 Mkrn1 p.N346Y makorin ring finger protein 1 unknown other MUT46 Actn4 p.F835V actinin, alpha 4 Cytoplasm other MUT47 Rpl13a p.A24G ribosomal protein L13a Cytoplasm other MUT48 Def8 p.R255G differentially expressed in FDCP 8 homolog (mouse) unknown other MUT49 Fat1 p.I1940M FAT tumor suppressor homolog 1 (Drosophila) Plasma Membrane other MUT50 Sema3b p.L663V sema domain, immunoglobulin domain (Ig), Extracellular Space other short basic domain, secreted, (semaphorin) 3B

    [0441] FIG. 9C shows the locations of the B16F10 chromosomes, genes density, gene expression, mutations, and filtered mutations (inner rings).

    In Vivo Testing of Immunogenicity Testing with Mutation-Representing Long Peptides

    [0442] To provide antigens for immunogenicity testing of these mutations, we employed long peptides which have many advantages over other peptides for immunization (Melief C J and van der Burg S H, Nat Rev Cancer 2008; 8:351-60). Long peptides are capable of inducing antigen-specific CD8+ as well as CD4+ T-cells (Zwaveling S et al., Cancer Res 2002; 62:6187-93; Bijker M S et al., J Immunol 2007; 179:5033-40). Moreover, long peptides require processing to be presented on MHC molecules. Such uptake is most efficiently done by dendritic cells, which are optimal for priming a potent T-cell response. Fitting peptides, in contrast, do not require trimming and are loaded exogenously on all cells expressing MHC molecules, including non-activated B and T-cells, leading to induction of tolerance and fratricide (Toes R E et al., J Immunol 1996; 156:3911-8; Su M W et al., J Immunol 1993; 151:658-67). For each of the 50 validated mutations, we designed peptides of 27 amino acids length with the mutated or wild type amino acid positioned centrally. Thus, any potential MHC class I and class II epitope of 8 to 14 amino acid length carrying the mutation could be processed from this precursor peptide. As adjuvant for peptide vaccination we used poly(I:C) which is known to promote cross presentation and increase vaccine efficacy (Datta S K et al., J Immunol 2003; 170:4102-10; Schulz O et al., Nature 2005; 433:887-92). The 50 mutations were tested in vivo in mice for induction of T-cells. Impressively, 16 out of 50 mutation-coding peptides were found to elicit immune responses in immunized mice. The induced T-cells displayed different reactivity patterns (Table 7).

    TABLE-US-00008 TABLE 7 Summary of T-cell reactivities determined consecutive to vaccination with mutation encoding peptide. Statistical analysis was done by student's t-test and Mann-Whitney test (non-parametric test). Responses were considered significant, when either test gave a p-value < 0.05 and the mean spot numbers were >30 spots/5 × 10.sup.5 effector cells. Reactivities were rated by mean spot numbers −: <30; +: >30; ++: >50; +++ >200 spots/well. Reactivity Reactivity Gene against against Mutation Symbol mutation WT MUT01 Fzd7 − − MUT02 Xpot − − MUT03 Ranbp2 − − MUT04 Dnajb12 − − MUT05 Eef2 +++ +++ MUT06 Ptrf − − MUT07 Trp53 − − MUT08 Ddx23 − − MUT09 Golgb1 − − MUT10 Pcdhga11 − − MUT11 Snx15 − − MUT12 Gnas + − MUT13 Fndc3b − − MUT14 Sbno1 − − MUT15 Pi4k2b − − MUT16 Thumpd3 − − MUT17 Tnpo3 +++ ++ MUT18 Numa1 − − MUT19 Wwp2 − − MUT20 Tubb3 +++ − MUT21 Atp11a − − MUT22 Asf1b ++ ++ MUT23 Wdr82 − − MUT24 Dag1 ++ + MUT25 Plod2 +++ ++ MUT26 Orc2 − − MUT27 Obsl1 − − MUT28 Ppp1r7 − − MUT29 Mthfd1l − − MUT30 Kif18b +++ − MUT31 Ascc2 − − MUT32 Itsn2 − − MUT33 Pbk − − MUT34 Klhl22 − − MUT35 Ddb1 − − MUT36 Tm9sf3 + − MUT37 Dpf2 − − MUT38 Atrn − − MUT39 Snx5 − − MUT40 Armc1 − − MUT41 Ash1l − − MUT42 S100a13 − − MUT43 Rik − − MUT44 Cpsf3l +++ ++ MUT45 Mkrn1 ++ ++ MUT46 Actn4 ++ + MUT47 Rpl13a − − MUT48 Def8 ++ ++ MUT49 Fat1 − − MUT50 Sema3b +++ ++

    [0443] Eleven peptides induced an immune response preferentially recognizing the mutated epitope. This is exemplified for mice immunized with mutations 30 (MUT30, Kif18b) and 36 (MUT36, Plod2) (FIG. 10A). ELISPOT testing revealed strong mutation-specific immune responses without cross reactivity against the wild-type peptide or an unrelated control peptide (VSV-NP). With five peptides, including mutations 05 (MUT05, Eef2) and 25 (MUT25, Plod2) (FIG. 10A), immune responses with comparable recognition of both the mutated as well as the wild-type peptide were obtained. The majority of mutated peptides were not capable of inducing significant T-cell responses as exemplified by mutations 01 (MUT01, Fzd7), 02 (MUT02, Xpot), and 07 (MUT07, Trp53). Immune responses induced by several of the discovered mutations were well in the range of immunogenicity (500 spots/5×10.sup.5 cells) generated by immunizing mice as a positive control with a described MHC-class I epitope from the murine melanoma tumor antigen tyrosinase related protein 2 (Trp2180-188, FIG. 10A) (Bloom M B et al., Exp Med 1997; 185:453-9; Schreurs M W et al. Cancer Res 2000; 60:6995-7001). For selected peptides that induce a strong mutation-specific T-cell response, we confirmed immune recognition by an independent approach. Instead of long peptides, in vitro transcribed RNA (IVT RNA) coding for the mutated peptide fragments MUT17, MUT30 and MUT44 was used for the immunological read-out. BMDCs transfected with mutation-coding RNA or irrelevant RNA served as antigen presenting cells (APCs) in an ELISPOT assay, whereas spleen cells of immunized mice served as effector cell population. BMDCs transfected with MUT17, MUT30 and MUT44 encoding mRNA were specifically and strongly recognized by splenocytes of mice immunized with the respective long peptides (FIG. 10B). Significantly lower reactivity against control RNA-transfected BMDCs was recorded, which is likely due to the unspecific activation of the BMDCs by the single stranded RNA (student's t-test; MUT17: p=0.0024, MUT30: p=0.0122, MUT44: p=0.0075). These data confirm that the induced mutation-specific T-cells in effect recognize endogenously processed epitopes. Two mutations that induce a preferred recognition of mutated epitopes are in genes Actn4 and Kif18b. The somatic mutation in ACTN4 (actinin, alpha 4) is at p.F835V in the calcium binding “EF-hand” protein domain. While both SIFT and POLYPHEN predict a significant impact of this mutation on protein function, the gene is not an established oncogene. However, mutation-specific T-cells against ACTN4 have been recently associated with a positive patient outcome (Echchakir H et al., Cancer Res 2001; 61:4078-83). KIF18B (kinesin family member 18B) is a kinesin with microtubule motor activity and ATP and nucleotide binding that is involved in regulation of cell division (Lee Y M et al., Gene 2010; 466:16-25) (FIG. 10C). The DNA sequence at the position encoding p.K739 is homogeneous in the reference C57BL/6, whereas B 16F10 DNA reads reveal a heterozygous somatic mutation. Both nucleotides were detected in the B16F10 RNA-Seq reads and validated by Sanger sequencing. KIF18B has not been previously associated with a cancer phenotype. The mutation p.K739N is not localized in a known functional or conserved protein domain (FIG. 10C, bottom) and thus most likely is a passenger rather than a driver mutation. These examples suggest a lack of correlation between the capability of inducing mutation-recognizing immune response and a functional or immunological relevance.

    In Vivo Assessment of Antitumoral Activity of Vaccine Candidates

    [0444] To assess whether immune responses elicited in vivo translate in anti-tumoral effects in tumor bearing mice, we chose MUT30 (mutation in Kif18b) and MUT44 as examples. These mutations had been shown to induce a strong immune reaction preferentially against the mutated peptide and to be endogenously processed (FIG. 10A, B). The therapeutical potential of vaccinating with mutated peptides was explored by immunizing mice with either MUT30 or MUT44 and adjuvant 3 and 10 days after grafting with 7.5×10.sup.5 B16F10. Growth of tumors was inhibited by both peptide vaccinations as compared to the control group (FIG. 11A). As B16F10 is a very aggressively growing tumor, we also tested protective immune responses. Mice were immunized with MUT30 peptide, inoculated s.c. with 7.5×10.sup.5 B16F10 cells 4 days later and boosted with MUT30 2 and 9 days after tumor challenge. Complete tumor protection and survival of 40% of the mice treated with MUT30 were observed, whereas all mice in the control treated group died within 44 days (FIG. 11B left). In those mice, developing tumors despite immunization with MUT30, growth of tumors was slower resulting in an elongation of the median survival by 6 days as compared to the control group (FIG. 11B right). These data imply that already vaccination against a single mutation is able to confer anti-tumoral effects.

    Immunization with Mutation-Coding RNAs

    [0445] The 50 validated mutations from the B16F10 melanoma cell line were used to construct different RNA vaccines. DNA-sequences representing one (Monoepitope), two (Biepitope), or 16 different mutations (Polyepitope), were constructed using 50 amino acids (aa) with the mutation on position 25 (Biepitope) or 27 aa with the mutation on position 14 (Mono- and Polyepitope) and were separated by a glycine/serine linker of 9aa. These constructs were cloned into the pST1-2BgUTR-A120 backbone for in vitro transcription of mRNA (Holtkamp et al., Blood 2006; 108:4009-17).

    [0446] To test the in vivo ability to induce T-cell responses against the different RNA-vaccines groups of three C57BL/6 mice were immunized by formulation of the RNA with RNAiMAX lipofectamine and subsequent intravenous injection. After 5 immunizations the mice were sacrificed and splenocytes were analyzed for mutation-specific T-cell responses using intracellular cytokine staining and IFN-γ ELISPOT analysis after restimulation with the corresponding mutation coding peptide or control peptide (VSV-NP).

    [0447] FIG. 12 shows one example for each vaccine design. In the upper row the mice were vaccinated with the Monoepitope-RNA coding for MUT30 (mutation in Kif78b), which induces MUT30-specific CD4.sup.+ T-cells (see exemplary FACS-plot). In the middle row the graph and FACS-plot show induction of MUT08-specific (mutation in Ddx23) CD4.sup.+ T-cells after immunization with the Biepitope coding for MUT33 and MUT08. In the lower row mice were immunized with a Polyepitope encoding 16 different mutations including MUT08, MUT33 and MUT27 (see Table 8). The graph and FACS-plot illustrate that MUT27 reactive T-cells are of a CD8 phenotype.

    TABLE-US-00009 TABLE 8 Overview of mutations and gene names encoded by Mono-, Bi- and Polyepitope RNA-vaccines. Construct Encoded mutation Gene annotation Monoepitope MUT30 Kif18b Biepitope MUT33 Pbk MUT08 Ddx23 Polyepitope MUT01 Fzd7 MUT02 Xpot MUT03 Ranbp2 MUT04 Dnajb12 MUT05 Eef2 MUT06 Ptrf MUT07 Trp53 MUT08 Ddx23 MUT26 Orc2 MUT27 Obsl1 MUT28 Ppp1r7 MUT29 Mthfd1l MUT30 Kif18b MUT31 Ascc2 MUT32 Itsn2 MUT33 Pbk

    [0448] The same Polyepitope was used to generate the data shown in FIG. 13. The graph shows ELISPOT data after restimulation of splenocytes with control (VSV-NP), MUT08, MUT27 and MUT33 peptides, proving that the Polyepitope vaccine can induce specific T-cell responses against several different mutations.

    [0449] Taken together the data show the possibility to induce mutation-specific T-cells using RNA-encoded Mono-, Bi- and Polyepitopes. Furthermore, the data show induction of CD4.sup.+ and CD8.sup.+ T cells and the induction of several different specificities from one construct.

    Immunization with Model Epitopes

    [0450] To further characterize the polyepitopic RNA-vaccine design a DNA-sequence was constructed, which included five different known model epitopes including one MHC class II epitope (ovalbumin class I (SIINFEKL), class II (OVA class II), influenza nucleoprotein (Inf-NP), vesiculo-stomatitis virus nucleoprotein (VSV-NP) and tyrosinase-related protein 2 (Trp2)). The epitopes were separated with the same glycine/serine linker of 9aa used for the mutation Polyepitope. This constructs was cloned into the pST1-2BgUTR-A120 backbone for in vitro transcription of mRNA.

    [0451] The in vitro transcribed RNA was used to vaccinate five C57BL/6 mice by intranodal immunization (four immunizations with 20 μg of RNA into the inguinal lymphnodes). Five days after the last immunization blood samples and splenocytes were taken from the mice for analysis. FIG. 14A shows IFN-γ ELISPOT analysis of the splenocytes restimulated with the indicated peptides. It can be clearly seen that all three MHC-class I epitope (SIINFEKL, Trp2 and VSV-NP) induce a very high number of antigen-specific CD8.sup.+ T cells. Also the MHC-class II epitope OVA class II induces a strong CD4.sup.+ T-cell response. The fourth MHC class I epitope was analyzed by staining of Inf-NP-specific CD8.sup.+ T-cells with a fluorescence-labeled pentameric MHC-peptide complex (Pentamer) (FIG. 14B).

    [0452] These data prove that the polyepitope design using the glycine/serine linker to separate different immunogenic MHC-class I and -class II epitopes is able to induce specific T-cells against every encoded epitope, regardless of its immunodominance.

    Anti-Tumoral Response after Therapy with a Mutation-Encoding Polyepitopic RNA Vaccine

    [0453] The same Polyepitope which was analyzed in FIG. 13 for immunogenicity was used to investigate the anti-tumoral activity of the mutation-encoding RNAs against the B16F10 tumor cells. In detail, groups of C57BL/6 mice (n=10) were subcutaneously inoculated with 1×10.sup.5 B16F10 melanoma cells into the flank. On days 3, 6, 10, 17 and 21 the mice were immunized with the polytopic RNA using a liposomal transfection reagent. The control group was injected with liposomes alone.

    [0454] FIG. 21 shows the survival curves of the groups, revealing a strongly improved median survival of 27 days with 1 of 10 mice surviving without tumor compared to 18.5 days median survival in the control group.

    Anti-Tumoral Response after Therapy with a Combination of Mutated and Normal Peptide

    [0455] Anti-tumoral activity of the validated mutations was evaluated by a therapeutic in vivo tumor experiment by using the MUT30 as a peptide vaccine. In detail, groups of C57BL/6 mice (n=8) were subcutaneously inoculated with 1×10.sup.5 B16F10 melanoma cells into the flank. On day 3, 10 and 17 the mice were immunized using polyI:C as adjuvant with MUT30, tyrosinase-related protein 2 (Trp2.sub.180-188) or a combination of both peptides. Trp2 is a known CD8.sup.+ epitope expressed by the B16F10 melanoma cells.

    [0456] FIG. 15A shows the mean tumor growth of the groups. It can be clearly seen that until day 28 the tumor growth is almost completely inhibited in the group which was immunized with the combination of the known CD8.sup.+ T-cell epitope and the CD4.sup.+ T-cell inducing MUT30. The known Trp2 epitope alone is not sufficient to provide a good anti-tumoral effect in this setting, but both single therapy groups (MUT30 and Trp2) still provide a tumor growth inhibition in comparison to the untreated group in the beginning of the experiment up to day 25. These data are strengthened by the survival curves shown in FIG. 15 B. Clearly the median survival is increased by the mice injected with the single peptides, with 1/8 mice surviving in the group with Trp2 vaccination. In addition the group treated with both peptides shows an even better median survival with 2/8 mice surviving.

    [0457] Taken together both epitopes act in a synergistic manner to provide a strong anti-tumoral effect.

    Example 9: Framework for Confidence-Based Somatic Mutation Detection and Application to B16-F10 Melanoma Cells

    [0458] NGS is unbiased in that it enables a high throughput discovery of variations within an entire genome or targeted regions, such as protein coding exons.

    [0459] However, while revolutionary, the NGS platform is still prone to errors leading to erroneous variation calls. Furthermore, the quality of results is dependent on experimental design parameters and analysis methodologies. While variation calls typically include scores designed to differentiate true variations from errors, the utility of these scores is not fully understood, nor is their interpretation with regard to optimization of experiments. This is particularly true when comparing tissue states, such comparing tumor and normal for somatic mutations. As a consequence, researchers are forced to rely on personal experience to determine experimental parameters and arbitrary filtering thresholds for selecting mutations.

    [0460] Our study aims a) to establish a framework for comparing parameters and methods to identify somatic mutations and b) to assign a confidence value to identified mutations. We sequence triplicate samples from C57BL/6 mice and the B16-F10 melanoma cell line. Using these data, we formulate the false discovery rate of detected somatic mutations, a measure that we then use to evaluate existing mutation discovery software and lab protocols.

    [0461] Various experimental and algorithmic factors contribute to the false positive rate for variations found by NGS [Nothnagel, M. et al., Hum. Genet. 2011 Feb. 23 [Epub ahead of print]]. The error sources include PCR artifacts, biases in priming [Hansen, K. D., et al., Nucleic. Acids. Res. 38, e131 (2010); Taub, M. A. et al., Genome Med. 2, 87 (2010)] and targeted enrichment [Bainbridge, M. N. et al., Genome Biol. 11, R62 (2010)], sequence effects [Nakamura, K. et al., Acids Res. (2011) first published online May 16, 2011 doi:10.1093/nar/gkr344], base calling causing sequence errors [Kircher, M. et al., Genome Biol. 10, R83 (2009). Epub 2009 Aug. 14] and read alignment [Lassmann, T. et al., Bioinformatics 27, 130-131 (2011)], causing variation in coverage and sequencing errors which influence the further downstream analysis, e.g. variant calling around indels [Li, H., Bioinformatics 27, 1157-1158 (2011)].

    [0462] No general statistical model has been described to describe the impact of different error sources on somatic mutation calls; only individual aspects are covered without removing all bias. Recent computational methods to measure the expected amount of false positive mutation calls include utilization of the transition/transversion ratio of a set of variations [Zhang, Z., Gerstein, M., Nucleic Acids Res 31, 5338-5348 (2003); DePristo, M. A. et al., Nature Genetics 43, 491-498 (2011)], machine learning [DePristo, M. A. et al., Nature Genetics 43, 491-498 (2011)] and inheritance errors when working with family genomes [Ewen, K. R. et al., Am. J. Hum. Genet. 67, 727-736 (2000)] or pooled samples [Druley, T. E. et al., Nature Methods 6, 263-265 (2009); Bansal, V., Bioinformatics 26, 318-324 (2010)]. For optimization purposes, Druley et al. [Druley, T. E. et al., Nature Methods 6, 263-265 (2009)] relied on short plasmid sequence fragments, which however might not be representative for the sample. For a set of single nucleotide variations (SNVs) and selected experiments, a comparison to SNVs identified by other techniques is feasible [Van Tassell, C. P. et al., Nature Methods 5, 247-252 (2008)] but is difficult to evaluate in terms of novel somatic mutations.

    [0463] Using an exome sequencing project as an example, we propose the calculation of a false discovery rate (FDR) based on NGS data alone. The method is not only applicable to the selection and prioritization of diagnostic and therapeutic targets, but also supports algorithm and method development by allowing us to define confidence-driven recommendations for similar experiments.

    [0464] To discover mutations, DNA from tail tissue of three C57BL/6 (black6) mice (litter mates) and DNA from B16-F10 (B16) melanoma cells, in triplicate, were individually enriched for protein coding exons (Agilent Sure Select Whole Mouse Exome), resulting in 6 samples. RNA was extracted from B16 cells in triplicate. Single end 50 nt (1×50 nt) and paired end 100 nt (2×100 nt) reads were generated on an Illumina HiSeq 2000. Each sample was loaded into an individual lane, resulting in an average of 104 million reads per lane. DNA reads were aligned to the mouse reference genome using bwa [Li, H. Durbin, R., Bioinformatics 25, 1754-1760 (2009)] and RNA reads were aligned with bowtie [Langmead, B. et al., Genome Biol. 10, R25 (2009)]. A mean coverage of 38 fold of 97% of the targeted regions was achieved for the 1×50 nt libraries, while the 2×100 nt experiment yielded an average coverage of 165 fold for 98% of the targeted regions.

    [0465] Somatic variations were independently identified using the software packages SAMtools [Li, H. et al., Bioinformatics 25, 2078-2079 (2009)], GATK [DePristo, M. A. et al., Nature Genetics 43, 491-498 (2011)] and SomaticSNiPer [Ding, L. et al., Hum. Mol. Genet (2010) first published online Sep. 15, 2010] (FIG. 16) by comparing the single nucleotide variations found in B16 samples to the corresponding loci in the black6 samples (B16 cells were originally derived from a black6 mouse). The potential mutations were filtered according to recommendations by the respective software authors (SAMtools and GATK) or by selecting an appropriate lower threshold for the somatic score of SomaticSNiPer, respectively.

    [0466] To create a false discovery rate (FDR) for mutation discovery, we first intersected the mutation sites and obtained 1,355 high quality somatic mutations as consensus among all three programs (FIG. 17). However, the observed differences in the results of the applied software tools are substantial. To avoid erroneous conclusions, we developed a method to assign a FDR to each mutation using the replicates. Technical repeats of a sample should generate identical results and any detected mutation in this “same vs. same comparison” is a false positive. Thus, to determine the false discovery rate for somatic mutation detection in a tumor sample relative to a normal sample (“tumor comparison”), we can use a technical repeat of the normal sample as a reference to estimate the number of false positives.

    [0467] FIG. 18A shows examples of variations found in the black6/B16 data, including a somatic mutation (left), non-somatic variation to the reference (middle), and possible false positive (right). Each somatic mutation can be associated with a quality score Q. The number of false positives in the tumor comparison indicates a number of false positives in the same vs. same comparison. Thus, for a given mutation with quality score Q detected in the tumor comparison, we estimate the false discovery rate by computing the ratio of same vs. same mutations with a score of Q or better to the overall number of mutations found in the tumor comparison with a score of Q or better.

    [0468] A challenge arises in defining Q since most mutation detection frameworks compute multiple quality scores. Here, we apply a random forest classifier [Breiman, L., Statist. Sci. 16, 199-231 (2001)] to combine multiple scores into a single quality score Q. We refer to the methods section for details regarding details of the quality score and FDR computation.

    [0469] A potential bias in comparing methods is differential coverage; we thus normalize the false discovery rate for the coverage:

    [00001] FDR ( Q ) = # Same vs . Same SNVs with score Q # Tumor SNV with score Q × # common coverage tumor comparison # common coverage same vs . same comparison

    [0470] We calculate the common coverage by counting all bases of the reference genome which are covered by both the tumor and normal sample or by both “same vs. same” samples, respectively.

    [0471] By estimating the number of false positives and positives at each FDR (see Methods), we generate receiver operating characteristic (ROC) curves and calculate the AUC (area under the curve) for each mutation discovery method, thus enabling a comparison of strategies for mutation discovery (FIG. 18B).

    [0472] Furthermore, the selection of the reference data might influence the calculation of the FDRs. Using the available black6/B16 data it is possible to create 18 triplets (combinations of black6 vs. black6 and black6 vs. b16). When comparing the resulting FDR distributions for the sets of somatic mutations, the results are consistent (FIG. 18B).

    [0473] Using this definition of a false discovery rate, we have established a generic framework for evaluating the influence of numerous experimental and algorithmic parameters on the resulting set of somatic mutations. Next, we apply this framework to study the influence of software tools, coverage, paired end sequencing and the number of technical replicates on somatic mutation identification.

    [0474] First, the choice of the software tool has a clear impact on the identified somatic mutations (FIG. 19A). On the tested data, SAMtools produces the highest enrichment of true positives in a set of somatic mutations ranked by the FDR. However, we note that all tools offer many parameters and quality scores for the individual mutations. Here, we have used the default settings as specified by the algorithm developers; we expect that the parameters could be optimized and emphasize that the FDR framework defined here is designed for running and evaluating such an optimization.

    [0475] For the described B16 sequencing experiment, we sequenced each sample in an individual flowcell lane and achieved a target region mean base coverage of 38 fold for the individual samples. However, this coverage might not be needed to obtain an equally good set of somatic mutations, possibly reducing costs. Also, the impact of the depth of caverage on whole genome SNV detection has been discussed recently [Ajay, S. S. et al., Genome Res. 21, 1498-1505 (2011)]. In order to study the effect of the coverage on exon capture data, we downsampled the number of aligned sequence reads for every 1×50 nt library to generate an approximate coverage of 5, 10 and 20 fold, respectively, and then reapplied the mutation call algorithms. As expected, a higher coverage results in a better (i.e. fewer false positives) somatic mutation set, although the improvement from the 20 fold coverage to the maximum is marginal (FIG. 19B).

    [0476] It is straightforward to simulate and rank different experimental settings using the available data and framework. Comparing duplicates to triplicates, triplicates do not offer a benefit compared to the duplicates (FIG. 19C), while duplicates offer a clear improvement compared to a study without any replicates. In terms of the ratio of somatic mutations in the given sets, we see enrichment at a FDR of 5% from 24.2% for a run without replicates to 71.2% for duplicates and 85.8% for triplicates. Despite the enrichment, using the intersection of triplicates removes more mutations with a low FDR than ones with a high FDR, as indicated by the lower ROC AUC and the shift of the curve to the left (FIG. 19C): the specificity is slightly increased at the cost of a lower sensitivity.

    [0477] The additionally sequenced 2×100 nt library was used to simulate a 1×100, two 2×50 and two 1×50 nt libraries, respectively, by in silicio removal of the second read and/or the 3′ and 5′ ends of the reads, resulting in a total of 5 simulated libraries. These libraries were compared using the calculated FDRs of predicted mutations (FIG. 19D). Despite the much higher mean coverage (more than 77 vs. 38), the somatic mutations found using the 2×50 5′ and 1×100 nt libraries have a lower ROC AUC and thus a worse FDR distribution than the 1×50 nt library. This phenomenon results from the accumulation of high FDR mutations in low coverage regions as the sets of low FDR mutations found are highly similar. The consequence is that the optimal sequencing length is either small so that the sequenced bases are concentrated around the capture probe sequences (potentially losing information on the somatic status of mutations in non-covered regions, though) or should be close to the fragment length (2×100 nt=200 nt total length for ˜250 nt fragments in our case), effectively filling up the coverage gaps. This is also supported by the ROC AUC of the 2×50 nt 3′ library (simulated by using only the 3′ ends of the 2×100 nt library) which is higher than the one of the 2×50 nt 5′ library (simulated by using only the 5′ ends of the 2×100 nt library) despite the lower base quality of the 3′ read ends.

    [0478] These observations allow us to define best practice procedures for the discovery of somatic mutations. Across all evaluated parameters, 20 fold coverage in both samples and using a technical duplicate achieves close to the optimum results in these relatively homogeneous samples, while also considering costs. A 1×50 nt library resulting in approximately 100 million reads seems to be the most pragmatic choice to achieve this coverage. This remains true across all possible dataset pairings. We retrospectively applied those parameter settings, used no additional filtering of the raw variant calls, and calculated the FDRs for 50 selected mutations from the intersection of all three methods as shown in FIG. 17. All mutations were confirmed by a combination of Sanger resequencing and the B16 RNA-Seq sequence reads. 44 of those mutations would have been found using a FDR cutoff of 5% (FIG. 20). As a negative control, we re-sequenced the loci of 44 predicted mutations with high FDRs (>50%) and examined the respective sequences in the RNA-Seq data. We found 37 of these mutations to be not validated while the remaining seven loci of potential mutations were both not covered by RNA-Seq reads and yielded in not sequencing reaction.

    [0479] While we show application of the framework to four specific questions, it is by no means limited to these parameters, but can be applied to study the influence of all experimental or algorithmic parameters, e.g. the influence of the alignment software, the choice of a mutation metric, or the choice of vendor for exome selection.

    [0480] We performed all experiments on a set of B16 melanoma cell experiments; however, the method is not restricted to these data. The only requirement is the availability of a ‘same-vs-same’ reference data set, meaning at least a single technical repeat of a non-tumorous sample should be performed for each new protocol. While our experiments indicate that the method is robust with regard to the choice of the technical repeat within certain limits, so that a repeat is not necessarily required in every single experiment. However, the method does require that the various quality measures are comparable between the reference data set and remaining datasets.

    [0481] Within this contribution, we have pioneered a statistical framework for a false-discovery-rate driven detection of somatic mutations. This framework is not only applicable for the diagnostic or therapeutic target selection, but also allows a generic comparison of experimental and computational protocol steps on a generated quasi ground truth data. Here, we applied this idea to make protocol decisions with regard to software tools, coverage, replicates as well as paired end sequencing.

    Methods

    Library Capture and Sequencing

    [0482] Next-generation sequencing, DNA sequencing: Exome capture for DNA resequencing was performed using the Agilent Sure-Select solution-based capture assay [Gnirke, A., et al., Nat. Biotechnol. 27, 182-189 (2009)], in this case designed to capture all known mouse exons.

    [0483] 3 μg purified genomic DNA was fragmented to 150-200 nt using a Covaris S2 ultrasound device. gDNA fragments were end repaired using T4 DNA polymerase, Klenow DNA polymerase and 5′ phosphorylated using T4 polynucleotide kinase. Blunt ended gDNA fragments were 3′ adenylated using Klenow fragment (3′ to 5′ exo minus). 3′ single T-overhang Illumina paired end adapters were ligated to the gDNA fragments using a 10:1 molar ratio of adapter to genomic DNA insert using T4 DNA ligase. Adapter ligated gDNA fragments were enriched pre capture and flow cell specific sequences were added using Illumina PE PCR primers 1.0 and 2.0 and Herculase II polymerase (Agilent) using 4 PCR cycles.

    [0484] 500 ng of adapter ligated, PCR enriched gDNA fragments were hybridized to Agilent's SureSelect biotinylated mouse whole exome RNA library baits for 24 hrs at 65° C. Hybridized gDNA/RNA bait complexes where removed using streptavidin coated magnetic beads. gDNA/RNA bait complexes were washed and the RNA baits cleaved off during elution in SureSelect elution buffer leaving the captured adapter ligated, PCR enriched gDNA fragments. gDNA fragments were PCR amplified post capture using Herculase II DNA polymerase (Agilent) and SureSelect GA PCR Primers for 10 cycles.

    [0485] Cleanups were performed using 1.8× volume of AMPure XP magnetic beads (Agencourt). For quality controls we used Invitrogen's Qubit HS assay and fragment size was determined using Agilent's 2100 Bioanalyzer HS DNA assay.

    [0486] Exome enriched gDNA libraries were clustered on the cBot using Truseq SR cluster kit v2.5 using 7 pM and sequenced on the Illumina HiSeq2000 using Truseq SBS kit.

    Exome Data Analysis

    [0487] Sequence reads were aligned using bwa (version 0.5.8c) [Li, H. Durbin, R., Bioinformatics 25, 1754-1760 (2009)] using default options to the reference mouse genome assembly mm9 [Mouse Genome Sequencing Consortium, Nature 420, 520-562 (2002)]. Ambiguous reads—those reads mapping to multiple locations of the genome as provided by the bwa output—were removed. The remaining alignments were sorted, indexed and converted to a binary and compressed format (BAM) and the read quality scores converted from the Illumina standard phred+64 to standard Sanger quality scores using shell scripts.

    [0488] For each sequencing lane, mutations were identified using three software programs: SAMtools pileup (version 0.1.8) [Li, H. et al., Bioinformatics 25, 2078-2079 (2009)], GATK (version 1.0.4418) [DePristo, M. A. et al., Nature Genetics 43, 491-498 (2011)], and SomaticSniper [Ding, L. et al., Hum. Mol. Genet (2010) first published online Sep. 15, 2010]. For SAMtools, the author-recommend options and filter criteria were used (http://sourceforge.net/apps/mediawiki/SAMtools/index.php?title=SAM_FAQ; accessed September 2011), including first round filtering, maximum coverage 200. For SAMtools second round filtering, the minimum indel quality score was 50, the point mutation minimum quality was 30. For GATK mutation calling, we followed the author-designed best practice guidelines presented on the GATK user manual (http://www.broadinstitute.org/gsa/wiki/index.php/The_Genome Analvsis_Toolkit; accessed October 2010). For each sample a local realignment around indel sites followed by a base quality recalibration was performed. The UnifiedGenotyper module was applied to the resultant alignment data files. When needed, the known polymorphisms of the dbSNP [Sherry, S. T. et al., Nucleic Acids Res. 29, 308-311 (2009)] (version 128 for mm9) were supplied to the individual steps. The variant score recalibration step was omitted and replaced by the hard-filtering option. For SomaticSniper mutation calling, the default options were used and only predicted mutations with a “somatic score” of 30 or more were considered further. Additionally, for each potentially mutated locus we required a non-zero coverage in the normal tissue and removed all mutations located in repetitive sequences as defined by the RepeatMasker track of the UCSC Genome Browser for the mouse genome assembly mm9 [Fujita, P. A. et al., Nucleic Acids Res. 39, 876-882 (2011)].

    RNA-Seq

    [0489] Barcoded mRNA-seqcDNA libraries were prepared from 5 ug of total RNA using a modified version of the Illumina mRNA-seq protocol. mRNA was isolated using SeramagOligo(dT) magnetic beads (Thermo Scientific). Isolated mRNA was fragmented using divalent cations and heat resulting in fragments ranging from 160-200 bp. Fragmented mRNA was converted to cDNA using random primers and SuperScriptII (Invitrogen) followed by second strand synthesis using DNA polymerase I and RNaseH. cDNA was end repaired using T4 DNA polymerase, Klenow DNA polymerase and 5′ phosphorylated using T4 polynucleotide kinase. Blunt ended cDNA fragments were 3′ adenylated using Klenow fragment (3′ to 5′ exo minus). 3′ single T-overhang Illumina multiplex specific adapters were ligated on the cDNA fragments using T4 DNA ligase. cDNA libraries were purified and size selected at 300 bp using the E-Gel 2% SizeSelect gel (Invitrogen). Enrichment, adding of Illumina six base index and flow cell specific sequences was done by PCR using Phusion DNA polymerase (Finnzymes). All cleanups were performed using 1.8× volume of Agencourt AMPure XP magnetic beads.

    [0490] Barcoded RNA-seq libraries were clustered on the cBot using Truseq SR cluster kit v2.5 using 7 pM and sequenced on the Illumina HiSeq2000 using Truseq SBS kit.

    [0491] The raw output data of the HiSeq was processed according to the Illumina standard protocol, including removal of low quality reads and demultiplexing. Sequence reads were then aligned to the reference genome sequence [Mouse Genome Sequencing Consortium, Nature 420, 520-562 (2002)] using bowtie [Langmead, B. et al., Genome Biol. 10, R25 (2009)]. The alignment coordinates were compared to the exon coordinates of the RefSeq transcripts [Pruitt, K. D. et al., Nucleic Acids Res. 33, 501-504 (2005)] and for each transcript the counts of overlapping alignments were recorded. Sequence reads not aligning to the genomic sequence were aligned to a database of all possible exon-exon junction sequences of the RefSeq transcripts [Pruitt, K. D. et al., Nucleic Acids Res. 33, 501-504 (2005)]. The alignment coordinates were compared to RefSeq exon and junction coordinates, reads counted, and normalized to RPKM (number of reads which map per nucleotide kilobase of transcript per million mapped reads [Mortazavi, A. et al., Nat. Methods 5, 621-628 (2008)]) for each transcript.

    Validation of SNVs

    [0492] We selected SNVs for validation by Sanger re-sequencing and RNA. SNVs were identified which were predicted by all three programs, non-synonymous, and found in transcripts having a minimum 10 RPKM. Of these, we selected the 50 with the highest SNP quality scores as provided by the programs. As a negative control, 44 SNVs were selected which have a FDR of 50% or more, are present in only one cell line sample and are predicted by only one mutation calling program. Using DNA, the selected variants were validated by PCR amplification of the regions using 50 ng of DNA, followed by Sanger sequencing (Eurofins MWG Operon, Ebersberg, Germany). The reactions were successful for 50 and 32 loci of positive and negative controls, respectively. Validation was also done by examination of the tumor RNA-Seq reads.

    Calculation of FDRs and Machine Learning

    [0493] Random Forest Quality Score Computation: Commonly-used mutation calling algorithms (DePristo, M. A. et al., Nature Genetics 43, 491-498 (2011), Li, H. et al., Bioinformatics 25, 2078-2079 (2009), Ding, L. et al., Hum. Mol. Genet (2010) first published online Sep. 15, 2010) output multiple scores, which all are potentially influential for the quality of the mutation call. These include—but are not limited to—the quality of the base of interest as assigned by the instrument, the quality alignment for this position, the number of reads covering this position or a score for the difference between the two genomes compared at this position. For the computation of the false discovery rate we require an ordering of mutations, however this is not directly feasible for all mutations since we might have contradicting information from the various quality scores.

    [0494] We use the following strategy to achieve a complete ordering. In a first step, we apply a very rigorous definition of superiority by assuming that a mutation has better quality than another if and only if it is superior in all categories. So a set of quality properties S=(s.sub.1, . . . , s.sub.n) is preferable to T=(t.sub.1, . . . , t.sub.n), denoted by S>T, iff s.sub.i>t.sub.i for all i=1, . . . , n. We define an intermediate FDR (IFDR) as follows

    [00002] IFDR ( T ) = # Same vs . Same SNVs with score S > T # Tumor SNV with score S > T × # common coverage tumor comparison # common coverage same vs . same comparison

    [0495] However, we regard the IFDR only as an intermediate step since in many closely related cases, no comparison is feasible and we are thus not benefitting from the vast amount of data available. Thus, we take advantage of the good generalization property of random forest regression [Breiman, L., Statist. Sci. 16, 199-231 (2001)] and train a random forest as implemented in R (R Development Core Team. R: A language and environment for statistical computing. R Foundation for Statistical Computing, Vienna, Austria, 2010, Liaw, A., Wiener, M., R News 2, 18-22 (2002)).

    [0496] For m input mutations with n quality properties each, the value range for each property was determined and up to p values were sampled with uniform spacing out of this range; when the set of values for a quality property was smaller than p, this set was used instead of the sampled set. Then each possible combination of sampled or selected quality values is created, which results in a maximum of p.sup.n data points in the n-dimensional quality space. A random sample of 1% of these points and the corresponding IFDR values were used as predictor and response, respectively, for the random forest training.

    [0497] The resulting regression score is our generalized quality score Q; it can be regarded as a locally weighted combination of the individual quality scores. It allows direct, single value comparison of any two mutations and the computation of the actual false discovery rate:

    [00003] FDR ( Q ) = # Same vs . Same SNVs with score Q # Tumor SNV with score Q × # common coverage tumor comparison # common coverage same vs . same comparison

    [0498] For the training of the random forest model used to create the results for this study, we calculate the sample IFDR on the somatic mutations of all samples before selecting the random 1% subset. This ensures the mapping of the whole available quality space to FDR values. We used the quality properties “SNP quality”, “coverage depth”, “consensus quality” and “RMS mapping quality” (SAMtools, p=20); “SNP quality”, “coverage depth”, “Variant confidence/unfiltered depth” and “RMS mapping quality” (GATK, p=20); or SNP quality”, “coverage depth”, “consensus quality”, “RMS mapping quality” and “somatic score” (SomaticSNiPer, p=12), respectively. The different values of p ensure a set size of comparable magnitude.

    [0499] Common coverage computation: The number of possible mutation calls can introduce a major bias in the definition of a false discovery rate. Only if we have the same number of possible locations for mutations to occur for our tumor comparison and for our same vs. same comparison, the number of called mutations is comparable and can serve as a basis for a false discovery rate computation. To correct for this potential bias, we use the common coverage ratio. As common coverage we define the number of bases with coverage of at least one in both samples which are used for the mutation calling. We compute the common coverage individually for the tumor comparison as well as for the same vs. same comparison.

    ROC Estimation

    [0500] Receiver operating characteristic (ROC) curves and the corresponding area under curve (AUC) are useful for organizing classifiers and visualizing their performance [Fawcett, T., Pattern Recogn. Lett. 27, 861-874 (2006)]. We extend this concept for evaluating the performance of experimental and computational procedures. However, plotting ROC graphs requires knowledge of all true and false positive (TP and FP) examples in a dataset, information which is usually not given and hard to establish for high throughput data (such as NGS data). Thus, we use the calculated FDRs to estimate the respective TP and FP rates and plot a ROC graph and calculate an AUC. The central idea is that the FDR of a single mutation in the dataset gives the proportion how much this mutation contributes to the sum of TP/FP mutations, respectively. Also, for a list of random assignments to TP and FP, the resultant ROC AUC will be equal to 0.5 with our method, indicating a completely random prediction. We start with two conditions:

    [00004] F D R = F P R F P R + T P R [ 1 ] and FPR + TPR = 1 [ 2 ]

    with FPR and TPR being the needed false positive true positive ratios, respectively, for the given mutation, defining the corresponding point in ROC space. [1] and [2] can be rearranged to


    TPR=1−FPR  [3]


    and


    FPR=FDR  [4]

    [0501] To obtain an estimated ROC curve, the mutations in dataset are sorted by FDR and for each mutation a point is plotted at the cumulative TPR and FPR values up to this mutation, divided by the sum of all TPR and TPR values, respectively. The AUC is calculated by summing up the areas of all consecutive trapezoids between the curve and the x-axis.