Centromere/kinetochore protein genes for cancer diagnosis, prognosis and treatment selection

11434535 · 2022-09-06

Assignee

Inventors

Cpc classification

International classification

Abstract

The invention described in the application relates to a panel of gene expression markers for patient with a tumor. The invention thus provides methods and compositions, e.g., kits, for evaluating gene expression levels of the markers and methods of using such gene expression levels to evaluate the likelihood of disease progression or response to chemotherapy or radiation therapy. Such information can be used in determining prognosis and treatment options for cancer patients.

Claims

1. A microarray for detecting expression of a gene panel for predicting likelihood of cancer progression in a patient, wherein the microarray consists of: CENP-A, HJURP, M1S18B, CENP-N, CENP-M, CENP-W, CENP-U, CENP-L, CENP-K, ZWINT, NDC80, NUF2, SPC24, and SPC25; and wherein the probes are immobilized by covalent bonds to a solid support, and each probe is 15 to 80 nucleotides in length.

2. A hybridization assay composition comprising the microarray of claim 1 and an RNA sample obtained sample from a tumor from a patient that has cancer; or a cDNA obtained from RNA from the tumor.

3. The hybridization assay of claim 2, wherein the the tumor is from early stage breast cancer, an early stage non-small cell lung cancer, or an early stage ovarian cancer.

4. The hybridization assay of claim 3, wherein the breast cancer is luminal A.

5. The hybridization assay of claim 3, wherein the breast cancer is luminal B.

6. The hybridization assay of claim 3, wherein the breast cancer is breast cancer is ER positive breast cancer.

7. A kit comprising amplification primers and probes, wherein the amplification primers and probes consist of amplification primers and probes that are specific for amplifying and detecting expression of a gene panel consisting of: CENP-A, HJURP, M1S18B, CENP-N, CENP-M, CENP-W, CENP-U, CENP-L, CENP-K, ZWINT, NDC80, NUF2, SPC24, and SPC25; and wherein the amplification primers or probes, or both the amplification primers and probes, are attached to a detectable label that is a radioisotope, a fluorophore, a chemiluminescent agent, or an enzyme.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIGS. 1A-1C provides a CEN/KT gene list and their misregulation across cancers.

(2) FIG. 1A shows a schematic overview of the centromere and kinetochore structure on replicated mitotic sister chromatids. The blow-up shows CENP-A nucleosome as the structural basis for centromeric chromatin and kinetochore formation, and the CCAN network (CENP-C, CENP-N, CENP-I, CENP-H, CENP-T, CENP-W, CENP-S, CENP-X, CENP-M, CENP-U, CENP-L, CENP-K, CENP-O, CENP-P, CENP-Q, AND CENP-R) in the inner-kinetochore that connects CENP-A chromatin and the KMN network (KNL1, ZWINT, MIS12, NSL1, PMF1, KNL3, NDC80, SPC24, SPC25 AND NUF2) located in the outer kinetochore. HJURP chaperone (directly binds to CENP-A) and the Mis18 complex are CENP-A assembly factors. FIG. 1B shows the list of 31 CEN/KT genes. Regions are shown including Mis18 (grey) and HJURP (purple), which transiently localize to centromeres for CENP-A assembly. The Affymetrix probes for CENP-P did not pass our qualifier filter and were subsequently removed from all analysis. Fifteen out of thirty-one CEN/KT genes are misexpressed in >50% datasets (fold change >2 fold, FDR p<0.05) across various cancers compared to corresponding normal tissues (FIG. 1C).

(3) FIG. 2 shows a Venn diagram comparing three CEN/KT gene lists and identifies 14 CES genes as the core subset whose expression levels correlate with cancer progression. The lists include thirty-one CEN/KT genes; CEN/KT genes that are differentially expressed between various cancer and corresponding normal tissues as in FIG. 1C; CEN/KT genes for breast cancer prognosis using BC GenExMiner; and CEN/KT genes for lung cancer prognosis using K-M Plotter.

(4) FIGS. 3A-3F illustrates that the centromere and kinetochore gene expression score (CES) is prognostic for overall survival, disease-free survival and distant metastasis-free survival using breast and lung cancer datasets. Patients were divided into CES high, medium or low groups for each specified GEO dataset. GEO datasets and log-rank p-values are indicated. Kaplan-Meier survival curves show that the CES is prognostic for overall survival (OS) for breast and lung cancer patients (FIG. 3A). Kaplan-Meier survival curves show that the CES is prognostic for disease-free survival (DFS) for breast and lung cancer patients (FIG. 3B). Kaplan-Meier survival curve shows that the CES is prognostic for distant metastasis-free survival (DMFS) for ER.sup.+ breast cancer patients (FIG. 3C). FIG. 3D-3F are forest plots where squares denote HR, and left and right limits of the bars indicate 95% CI. Forest plot shows hazard ratios associated with high CES in various cancers with subtype or stage information (FIG. 3D). In particular, high CES predicts poor OS for early stage (stages I and II combined) ovarian cancers, non small cell lung cancers (NSCLCs), stage I lung adenocarcinomas (ADCs), gastric cancers and breast cancer luminal subtypes. Decreased HRs associated with more aggressive breast cancer HER2+ and basal-like. High CES is associated with increased risk for relapse or disease progression for various cancers and subtypes or stages (FIG. 3E). High CES is associated with increased hazard for DMFS for luminal A and B breast cancers (FIG. 3F). The trend is opposite for HER2+ and basal-like subtypes.

(5) FIGS. 4A-4D demonstrates that CES values predict sensitivity to Topo I inhibitors in CCLE cell lines, and are predictive for lung cancer patient outcome after adjuvant chemotherapy and for breast cancer patient response to radiotherapy. (FIG. 4A) Bar graphs of average IC.sub.50 values show that CCLE (Cancer Cell Line Encyclopedia) cell lines in the top CES quartile are significantly more sensitive to Topo I inhibitors topotecan (left) and irinotecan (right) than those in the bottom CES quartile. Two tailed student-t test p-values are shown. Error bars indicate standard errors. (FIG. 4B-4C) Adjuvant chemotherapy significantly reduces the hazard associated with high CES in early stage NSCLCs. JBR.10 clinical trial early stage NSCLC patients are divided into CES high (top tertile) and low (lower two tertiles) groups (FIG. 4B). Kaplan-Meier curve to the left is for CES high group showing significant improvement of patient overall survival (OS) after adjuvant chemotherapy (ACT) compared to no ACT (OBS). The right graph of FIG. 4B shows that ACT did not significantly improve overall survival for CES low group compared to OBS. (FIG. 4C) Meta-analysis combing JBR.10 and UT SPORE early stage NSCLC patients. Patients are divided into CES high (top tertile) and low (lower two tertiles) groups. Kaplan-Meier curve in FIG. 4C, left is for CES high group showing significant improvement of patient overall survival after adjuvant chemotherapy (ACT) compared to no ACT (OBS). The right graph of FIG. 4C shows that ACT did not improve overall survival for CES low group compared to OBS. (FIG. 4D) Radiotherapy reduces the hazards associated with high CES for breast cancer patients. Breast cancer patients are divided into CES high, intermediate or low groups. Kaplan-Meier survival curves are in FIG. 4D, left for overall survival (OS) and in FIG. 4D, right for disease-free survival (DFS). Patient numbers, Log-rank p-values and treatment information are indicated for each graph. High CES values are associated with significantly better survival after RT compared to no RT, for both disease-free survival and overall survival (FIG. 4D, top row). The benefits associated with RT are not statistically significant for patients with intermediate CES values (FIG. 4D, middle row). No significant benefit was detected between low CES patients, with or without RT, for disease-free survival or overall survival (FIG. 4D, bottom row).

(6) FIGS. 5A and 5B provide percentage frequency bar graphs of irinotecan (FIG. 5A) and topotecan (FIG. 5B) IC.sub.50 for CCLE cell lines in the top (75-100%) and bottom (0-25%) CES quartiles demonstrate inverse correlations between CES and drug IC.sub.50.

(7) FIGS. 6A and 6B provide survival analyses showing that ACT specifically improves OS for high CES NSCLC patients of JBR.10 trial. High CES is associated with poor OS for patients without adjuvant therapy (OBS) (FIG. 6A). High CES is not associated with poor OS for patients with chemotherapy (ACT) (FIG. 6B).

(8) FIGS. 7A-7E provide forest plots showing that high CES is associated with sensitivity to adjuvant therapies for several cancer types. Squares denote HR, and left and right limits of the bars indicate 95% CI. FIG. 7A shows that adjuvant chemotherapy (black bars) negates inferior OS associated with high CES for stage I ADCs and NSCLCs (black bars with an asterisk) by meta-analysis. In addition, adjuvant chemo and radiotherapy (RT) (black bars) improve inferior OS (black bars with an asterisk) associated with high CES for NSCLCs. Adjuvant chemo- and radio-therapies reduce risk of first progression (FP) associated with high CES in NSCLC (FIG. 7B). Adjuvant chemotherapy with or without hormone therapy negates inferior RFS associated with high CES for ER+ breast cancer patients compared to untreated or tamoxifen only treatment (FIG. 7C). Tamoxifen alone does not improve poor RFS associated with high CES ER+ breast cancer patients. Adjuvant chemotherapy including 5-FU does not significantly improve poor OS associated with high CES gastric cancer patients (FIG. 7D). Adjuvant therapy with either platin or topotecan improves overall survival in high CES late stage ovarian cancers and topotecan is superior to platin in reducing hazards. (FIG. 7E).

(9) FIGS. 8A-8D provides Kaplan-Meier survival curves of breast cancer patient survival with high and low CES values, with or without RT. DFS=Disease-free survival and OS=overall survival. High CES values associate with poor DFS and OS, respectively, without RT (p<0.05) (FIGS. 8A and 8C). After RT, patients with high CES values show hazard ratios that are not statistically distinguishable from those with low CES values for DFS and OS, respectively (p>0.05) (FIGS. 8B and 8D).

(10) FIG. 9 shows a block diagram of an example computer system 100 usable with system and methods according to embodiments of the present disclosure.

DETAILED DESCRIPTION OF THE INVENTION

I. Introduction

(11) Described herein are methods for predicting the risk of disease recurrence, disease relapse, disease progression, and/or metastatis of a cancer in a subject. The methods also include predicting a likelihood of response to a cancer therapy, such as radiation therapy and/or chemotherapy in a subject with cancer. The method includes determining the expression level, such as the RNA expression level or the protein expression level of 14 CEN/KT genes, transforming the levels into a centromere and kinetochore gene expression score (CES), and determining that the subject has a likelihood of a poor prognosis based having a high CES value compared to a reference range of CES values. In some instances, a high CES value represents any CES value in the top tertile of the reference range of CES values. A high CES value can also predict a likelihood of survival upon receiving adjuvant cancer therapy.

II. Definitions

(12) As used herein, the following terms have the meanings ascribed to them unless specified otherwise.

(13) The terms “a,” “an,” or “the” as used herein not only include aspects with one member, but also include aspects with more than one member. For instance, the singular forms “a,” “an,” and “the” include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to “a cell” includes a plurality of such cells and reference to “the agent” includes reference to one or more agents known to those skilled in the art, and so forth.

(14) The term “cancer” refers to any disease involving an abnormal growth of cells and includes all stages and all forms of the disease that affects any tissue, organ or cell in the body. The term includes all known cancers and neoplastic conditions, whether characterized as malignant, benign, soft tissue, or solid, and cancers of all stages and grades including pre- and post-metastatic cancers. Examples of different types of cancer include, but are not limited to, breast cancer, lung cancer (e.g., non-small cell lung cancer); digestive and gastrointestinal cancers such as colorectal cancer, gastrointestinal stromal tumors, gastrointestinal carcinoid tumors, colon cancer, rectal cancer, anal cancer, bile duct cancer, small intestine cancer, and stomach (gastric) cancer; esophageal cancer; gallbladder cancer; liver cancer; pancreatic cancer; appendix cancer; ovarian cancer; prostate cancer, renal cancer (e.g., renal cell carcinoma); cancer of the central nervous system; skin cancer; lymphomas; choriocarcinomas; head and neck cancers; osteogenic sarcomas; and blood cancers. As used herein, a “tumor” comprises one or more cancerous cells.

(15) The term “tumor sample” includes a biological sample or a sample from a biological source that contains one or more tumor cells. Biological samples include samples from body fluids, e.g., blood, plasma, serum, or urine, or samples derived, e.g., by biopsy, from cells, tissues or organs, preferably tumor tissue suspected to include or essentially consist of cancer cells.

(16) The terms “determining,” “assessing,” “assaying,” “measuring” and “detecting” can be used interchangeably and refer to both quantitative and semi-quantitative determinations. Where either a quantitative and semi-quantitative determination is intended, the phrase “determining a level” of a polynucleotide or polypeptide of interest or “detecting” a polynucleotide or polypeptide of interest can be used.

(17) The term “amount” or “lever” refers to the quantity of a polynucleotide of interest or a polypeptide of interest present in a sample. Such quantity may be expressed in the absolute terms, i.e., the total quantity of the polynucleotide or polypeptide in the sample, or in the relative terms, i.e., the concentration of the polynucleotide or polypeptide in the sample.

(18) The term “nucleic acid” or “polynucleotide” as used herein refers to a deoxyribonucleotide or ribonucleotide in either single- or double-stranded form. The term encompasses nucleic acids containing known analogues of natural nucleotides which have similar or improved binding properties, for the purposes desired, as the reference nucleic acid. The term also includes nucleic acids which are metabolized in a manner similar to naturally occurring nucleotides or at rates that are improved for the purposes desired. The term also encompasses nucleic-acid-like structures with synthetic backbones. DNA backbone analogues provided by the invention include phosphodiester, phosphorothioate, phosphorodithioate, methylphosphonate, phosphoramidate, alkyl phosphotriester, sulfamate, 3′-thioacetal, methylene(methylimino), 3′-N-carbamate, morpholino carbamate, and peptide nucleic acids (PNAs); see Oligonucleotides and Analogues, a Practical Approach, edited by F. Eckstein, IRL Press at Oxford University Press (1991); Antisense Strategies, Annals of the New York Academy of Sciences, Volume 600, Eds. Baserga and Denhardt (NYAS 1992); Milligan (1993) J. Med. Chem. 36:1923-1937; Antisense Research and Applications (1993, CRC Press). PNAs contain non-ionic backbones, such as N-(2-aminoethyl) glycine units. Phosphorothioate linkages are described in WO 97/03211; WO 96/39154; Mata (1997) Toxicol. Appl. Pharmacol. 144:189-197. Other synthetic backbones encompassed by the term include methyl-phosphonate linkages or alternating methylphosphonate and phosphodiester linkages (Strauss-Soukup (1997) Biochemistry 36: 8692-8698), and benzylphosphonate linkages (Samstag (1996) Antisense Nucleic Acid Drug Dev 6: 153-156).

(19) The term “protein,” “peptide” or “polypeptide” are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers. As used herein, the terms encompass amino acid chains of any length, including full-length proteins (i.e., antigens), wherein the amino acid residues are linked by covalent peptide bonds.

(20) The term “gene product” or “gene expression product” refers to an RNA or protein encoded by the gene.

(21) The term “hybridizing” refers to the binding, duplexing, or hybridizing of a nucleic acid molecule preferentially to a particular nucleotide sequence under stringent conditions. The term “stringent conditions” refers to conditions under which a probe will hybridize preferentially to its target subsequence, and to a lesser extent to, or not at all to, other sequences in a mixed population (e.g., a cell lysate or DNA preparation from a tissue biopsy). A “stringent hybridization” and “stringent hybridization wash conditions” in the context of nucleic acid hybridization (e.g., as in array, microarray, Southern or northern hybridizations) are sequence dependent, and are different under different environmental parameters. An extensive guide to the hybridization of nucleic acids is found in, e.g., Tijssen (1993) Laboratory Techniques in Biochemistry and Molecular Biology—Hybridization with Nucleic Acid Probes part I, Ch. 2, “Overview of principles of hybridization and the strategy of nucleic acid probe assays,” Elsevier, N.Y. Generally, highly stringent hybridization and wash conditions are selected to be about 5° C. lower than the thermal melting point (T.sub.m) for the specific sequence at a defined ionic strength and pH. The T.sub.m is the temperature (under defined ionic strength and pH) at which 50% of the target sequence hybridizes to a perfectly matched probe. Very stringent conditions are selected to be equal to the T.sub.m for a particular probe. An example of stringent hybridization conditions for hybridization of complementary nucleic acids which have more than 100 complementary residues on an array or on a filter in a Southern or northern blot is 42° C. using standard hybridization solutions (see, e.g., Sambrook and Russell (2001) Molecular Cloning: A Laboratory Manual (3rd ed.) Vol. 1-3, Cold Spring Harbor Laboratory, Cold Spring Harbor Press, NY). An example of highly stringent wash conditions is 0.15 M NaCl at 72° C. for about 15 minutes. An example of stringent wash conditions is a 0.2×SSC wash at 65° C. for 15 minutes. Often, a high stringency wash is preceded by a low stringency wash to remove background probe signal. An example medium stringency wash for a duplex of, e.g., more than 100 nucleotides, is 1×SSC at 45° C. for 15 minutes. An example of a low stringency wash for a duplex of, e.g., more than 100 nucleotides, is 4×SSC to 6×SSC at 40° C. for 15 minutes.

(22) The term “complementarity” refers to the ability of a nucleic acid to form hydrogen bond(s) with another nucleic acid sequence by either traditional Watson-Crick or other non-traditional types. A percent complementarity indicates the percentage of residues in a nucleic acid molecule which can form hydrogen bonds (e.g., Watson-Crick base pairing) with a second nucleic acid sequence (e.g., 5, 6, 7, 8, 9, 10 out of 10 being 50%, 60%, 70%, 80%, 90%, and 100% complementary). “Perfectly complementary” means that all the contiguous residues of a nucleic acid sequence will hydrogen bond with the same number of contiguous residues in a second nucleic acid sequence. “Substantially complementary” as used herein refers to a degree of complementarity that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%. 97%, 98%, 99%, or 100% over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, or more nucleotides, or refers to two nucleic acids that hybridize under stringent conditions.

(23) The term “standard control” as used herein refers to a predetermined amount or concentration of a polynucleotide sequence or polypeptide sequence that is present in an established normal tissue sample, e.g., a healthy, non-cancer tissue sample, or a diploid, non-transformed, non-cancerous, genomically stable healthy human cell line. The standard control value is suitable for the use of a method of the present invention, to serve as a basis for comparing the amount of a specific mRNA or protein that is present in a test sample. An established sample serving as a standard control provides an average amount of a specific mRNA or protein that is typical in a normal tissue sample. A standard control value may vary depending on the nature of the sample as well as other factors such as the gender, age, ethnicity of the subjects based on whom such a control value is established.

(24) The term “treatment,” “treat,” or “treating” refer to a method of reducing the effects of a cancer (e.g., breast cancer, lung cancer, ovarian cancer or the like) or symptom of cancer. Thus, in the disclosed method, treatment can refer to a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% reduction in the severity of an cancer or symptom of the cancer. For example, a method of treating a disease is considered to be a treatment if there is a 10% reduction in one or more symptoms of the disease in a subject as compared to a control. Thus, the reduction can be a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100% or any percent reduction between 10 and 100% as compared to native or control levels. It is understood that treatment does not necessarily refer to a cure or complete ablation of the disease, condition, or symptoms of the disease or condition.

(25) The term “recommending” or “suggesting,” in the context of a treatment of a disease, refers to making a suggestion or a recommendation for therapeutic intervention (e.g., drug therapy, adjunctive therapy, etc.) and/or disease management which are specifically applicable to the patient.

(26) The terms “responsive,” “clinical response,” “positive clinical response,” and the like, as used in the context of a patient's response to a cancer therapy, are used interchangeably and refer to a favorable patient response to a treatment as opposed to unfavorable responses, i.e. adverse events. In a patient, beneficial response can be expressed in terms of a number of clinical parameters, including loss of detectable tumor (complete response, CR), decrease in tumor size and/or cancer cell number (partial response, PR), tumor growth arrest (stable disease, SD), enhancement of anti-tumor immune response, possibly resulting in regression or rejection of the tumor; relief, to some extent, of one or more symptoms associated with the tumor; increase in the length of survival following treatment; and/or decreased mortality at a given point of time following treatment. Continued increase in tumor size and/or cancer cell number and/or tumor metastasis is indicative of lack of beneficial response to treatment. In a population the clinical benefit of a drug, i.e., its efficacy can be evaluated on the basis of one or more endpoints. For example, analysis of overall response rate (ORR) classifies as responders those patients who experience CR or PR after treatment with drug. Analysis of disease control (DC) classifies as responders those patients who experience CR, PR or SD after treatment with drug.

(27) A positive clinical response can be assessed using any endpoint indicating a benefit to the patient, including, without limitation, (1) inhibition, to some extent, of tumor growth, including slowing down and complete growth arrest; (2) reduction in the number of tumor cells; (3) reduction in tumor size; (4) inhibition (i.e., reduction, slowing down or complete stopping) of tumor cell infiltration into adjacent peripheral organs and/or tissues; (5) inhibition of metastasis; (6) enhancement of anti-tumor immune response, possibly resulting in regression or rejection of the tumor; (7) relief, to some extent, of one or more symptoms associated with the tumor; (8) increase in the length of survival following treatment; and/or (9) decreased mortality at a given point of time following treatment. Positive clinical response may also be expressed in terms of various measures of clinical outcome. Positive clinical outcome can also be considered in the context of an individual's outcome relative to an outcome of a population of patients having a comparable clinical diagnosis, and can be assessed using various endpoints such as an increase in the duration of recurrence-free interval (RFI), an increase in the time of survival as compared to overall survival (OS) in a population, an increase in the time of disease-free survival (DFS), an increase in the duration of distant recurrence-free interval (DRFI), and the like. Additional endpoints include a likelihood of any event (AE)-free survival, a likelihood of metastatic relapse (MR)-free survival (MRFS), a likelihood of disease-free survival (DFS), a likelihood of relapse-free survival (RFS), a likelihood of first progression (FP), and a likelihood of distant metastatis-free survival (DMFS). An increase in the likelihood of positive clinical response corresponds to a decrease in the likelihood of cancer recurrence or relapse.

(28) The term “good prognosis” refers to the prediction of the likelihood of a clinical response, disease-specific survival, overall survival or disease free survival, including partial remission, complete remission, and suppression of cancer cell proliferation and/or metastasis. A good prognosis for a patient with a solid tumor cancer includes a positive response rate in terms of disease remission or tumor shrinkage, or any other form of evaluating reduced tumor burden or growth. A good prognosis can be measured as the length (time) of survival.

(29) The term “poor prognosis” refers to the prediction of the likelihood of cancer-attributable death or progression, including recurrence, relapse and/or metastatic spread.

(30) The term “overall survival” refers to the time interval from either the time of diagnosis or the start of treatment that the patient is still alive.

(31) The term “progression-free survival” refers to the time interval from treatment of the patient until the progression of cancer or death of the patient, whichever occurs first.

(32) The term “responder” or “responsive” refers to a patient who has cancer, and who exhibits a beneficial clinical response following treatment with a cancer therapy.

(33) The term “non-responder” or “non-responsive” refers to a patient who has a cancer, and who does not exhibit a beneficial clinical response following treatment with a cancer therapy.

(34) The term “subject” is intended to include animals. Examples of subjects include mammals, e.g., humans, dogs, cows, horses, pigs, sheep, goats, cats, mice, rabbits, rats, and transgenic non-human animals. In certain embodiments, the subject is a human, e.g., a human suffering from, at risk of suffering from, or potentially capable of suffering from cancers.

(35) The term “risk score” refers to a statistically derived value that can provide physicians and caregivers valuable diagnostic and prognostic insight. In some instances, the score provides a projected risk of disease recurrence/relapse or disease progression, a projected rate of disease progression, and/or a projected response to a particular therapy. An individual's score can be compared to a reference score or a reference score scale to determine risk of disease recurrence/relapse or to assist in the selection of therapeutic intervention or disease management approaches.

(36) The term “high CES score,” “high CES value,” “high risk score” refers to a centromere and kinetochore expression score (CES) having a numerical value in the top percentile range, such as top tertile (e.g., top 33%), of a range of CES values for a particular subject population. In some embodiments, a cancer patient with a high CES score is also at high risk of a poor prognosis or negative disease outcome. The term “intermediate CES score” or “medium CES score” refers to a CES value in the middle tertile of the range, and the term “low CES score” refers to a CES value in the lower tertile of the range.

III. Detailed Descriptions of Embodiments

(37) A. CEN/KT Genes and Gene Products

(38) The methods described herein are based, in part, on the surprising discovery of that 14 centromere and kinetochore structural protein genes (CEN/KT genes) are overexpressed in various cancers and are predictive of disease progression for specific cancer stages. The centromere and kinetochore gene expression score (CES) described herein can transform the expression levels of the 14 genes or the expression levels of at least 9 genes of the 14 genes into a predictive score. The CES score is also predictive of therapy response and survival after treatment.

(39) The methods described herein can be used to evaluate a patient with cancer. Non-limiting examples of cancer include breast cancer, lung cancer (e.g., non-small cell lung cancer); prostate cancer, ovarian cancer, digestive and gastrointestinal cancers such as colorectal cancer, gastrointestinal stromal tumors, gastrointestinal carcinoid tumors, colon cancer, rectal cancer, anal cancer, bile duct cancer, small intestine cancer, and stomach (gastric) cancer; esophageal cancer; gallbladder cancer; liver cancer; pancreatic cancer; appendix cancer; bladder cancer; prostate cancer; cervical cancer, uterine cancer, renal cancer (e.g., renal cell carcinoma); cancer of the central nervous system, e.g., lower grade brain cancer; skin cancer; lymphomas; head and neck cancers; adrenocortical cancer; and thyroid cancer. The cancer can be a very early stage cancer, early stage cancer, late stage cancer, or metastatic cancer. In some embodiments, the cancer is a very early stage cancer or an early stage cancer. In some embodiments, the breast cancer is a breast cancer subtype such as basal-like breast cancer, HER2-positive (HER2+) breast cancer, luminal B breast cancer, luminal A breast cancer, and normal-like breast cancer. The breast cancer may include an estrogen receptor positive (ER+) tumor or an estrogen receptor negative (ER.sup.−) tumor. In some embodiments, the breast cancer is ductal carcinoma in situ. In some embodiments, the cancer is early stage ovarian cancer (stage I or stage II) or an early stage (e.g., stage I), lung cancer.

(40) The present disclosure relates to measuring the gene products of a biomarker panel, e.g., a human CEN/KT gene panel of at least 9 genes including CENP-A, HJURP, MIS18B CENP-N, CENP-M, CENP-U, ZWINT, NDC80, and SPC25, or a 14 human CEN/KT genes panel including CENP-A, CENP-K, CENP-L, CENP-M, CENP-N, CENP-U, CENP-W, MIS18B, HJURP, ZWINT, NDC80, SPC24, SPC25 and NUF2, in a patient with a tumor. In some cases, the measurement is performed prior to the patient undergoing a therapeutic intervention, such as surgery, chemotherapy, radiation therapy, drug therapy, immunotherapy and the like.

(41) The human histone centromeric protein A (CENP-A) polypeptide sequence is set forth in, e.g., Genbank Accession No. AAH02703.1 and NCBI Ref. Seq. Nos. NP_001035891 and NP_001800. The human CENP-A mRNA (coding) sequence is set forth in, e.g., NCBI Ref. Seq. Nos. NM_001042426, and NM_001809.

(42) The human centromere protein K (CENP-K) polypeptide sequence is set forth in, e.g., NCBI Ref. Seq. Nos. NP_001253967 and NP_071428. The human CENP-K mRNA (coding) sequence is set forth in, e.g., NCBI Ref. Seq. Nos. NM_001267038, and NM_022145.

(43) The human centromere protein L (CENP-L) polypeptide sequence is set forth in, e.g., NCBI Ref. Seq. Nos. NP_001120653, NP_001164653 and NP_201576. The human CENP-L mRNA (coding) sequence is set forth in, e.g., NCBI Ref. Seq. Nos. NM_001127181, NM_001171182, and NM_033319.

(44) The human centromere protein M (CENP-M) polypeptide sequence is set forth in, e.g., NCBI Ref. Seq. Nos. NP_001002876, NP_001103685 and NP_076958. The human CENP-M mRNA (coding) sequence is set forth in, e.g., NCBI Ref. Seq. Nos. NM_001002876, NM_001110215, and NM_024053.

(45) The human centromere protein U (CENP-U) polypeptide sequence is set forth in, e.g., NCBI Ref. Seq. No. NP_078905. The human CENP-U mRNA (coding) sequence is set forth in, e.g., NCBI Ref. Seq. No. NM_024629.

(46) The human centromere protein W (CENP-W) polypeptide sequence is set forth in, e.g., NCBI Ref. Seq. Nos. NP_0001012525, NP_001273453 and NP_001273454. The human CENP-W mRNA (coding) sequence is set forth in, e.g., NCBI Ref. Seq. Nos. NM_001012507, NM_001286524, and NM_001286525.

(47) The human Mis18-beta (MIS18B) polypeptide sequence is set forth in, e.g., NCBI Ref Seq. No. NP_009211. The human MIS18B mRNA (coding) sequence is set forth in, e.g., NCBI Ref. Seq. No. NM_007280. The MIS18B polypeptide is also known as cancer/testis antigen 86, CT86, Opa-interacting protein 5 and OIP-5.

(48) The human holiday junction recognition (HJURP) polypeptide sequence is set forth in, e.g., NCBI Ref. Seq. Nos. NP_001269891, NP_001269892, and NP_060880. The human HJURP mRNA (coding) sequence is set forth in, e.g., NCBI Ref. Seq. Nos. NM_001282962, NM_001282963, and NM_018410.

(49) The human holiday junction recognition protein (HJURP) polypeptide sequence is set forth in, e.g., NCBI Ref. Seq. Nos. NP_001269891, NP_001269892, and NP_060880. The human HJURP mRNA (coding) sequence is set forth in, e.g., NCBI Ref. Seq. Nos. NM_001282962, NM_001282963, and NM_018410.

(50) The human ZW10 interactor (ZWINT) polypeptide sequence is set forth in, e.g., NCBI Ref. Seq. Nos. NP_001005413, NP_008988, and NP_127490. The human ZWINT mRNA (coding) sequence is set forth in, e.g., NCBI Ref. Seq. Nos. NM_001005413, NM_007057, and NM_032997.

(51) The human kinetochore protein NDC80 homolog (NDC80) polypeptide sequence is set forth in, e.g., NCBI Ref. Seq. No. NP_006092. The human NDC80mRNA (coding) sequence is set forth in, e.g., NCBI Ref. Seq. No. NM_006101. The NDC80 polypeptide is also known as kinetochore protein Hec1, HsHec1, kinetochore-associated protein 2, KNTC2, and retinoblastoma-associated protein HEC.

(52) The human kinetochore protein Spc24 (SPC24) polypeptide sequence is set forth in, e.g., NCBI Ref. Seq. Nos. NP_872319 and XP_005259810. The human SPC24 (coding) sequence is set forth in, e.g., NCBI Ref. Seq. Nos. NM_182513 and XM_005259753.

(53) The human kinetochore protein Spc25 (SPC25) polypeptide sequence is set forth in, e.g., NCBI Ref. Seq. No. NP_065726. The human SPC25 (coding) sequence is set forth in, e.g., NCBI Ref. Seq. No. NM_020675.

(54) The human kinetochore protein Nuf2 homolog (NUF2) polypeptide sequence is set forth in, e.g., NCBI Ref. Seq. No. NP_113611 and NP_663735. The human NUF2 (coding) sequence is set forth in, e.g., NCBI Ref. Seq. Nos. NM_031423 and NM_145697.

(55) The at least 9 CEN/KT biomarkers or 14 CEN/KT biomarkers are particularly useful in the methods of the present disclosure for diagnosing or prognosing cancer in a patient and for personalized therapeutic management by selecting therapy. As such, in some embodiments, the detection or determination of the expression level, e.g., RNA expression level or protein expression level of the 14 CEN/KT gene products is performed.

(56) B. Methods of Quantifying RNA Levels

(57) The methods of the present disclosure include detecting the level of RNA expression of 14 CEN/KT genes or a subset of the 14 CEN/KT genes, e.g., a subset of at least 9 genes of the 14 genes, in a tumor sample obtained from a patient suspected of having cancer or at risk of having cancer. In some embodiments, the patient has been diagnosed with cancer.

(58) The tumor sample can be a biological sample comprising cancer cells. In some embodiments, the tumor sample is a fresh or archived sample obtained from a tumor, e.g., by a tumor biopsy or fine needle aspirate. The sample also can be any biological fluid containing cancer cells. The tumor sample can be isolated or obtained from any number of primary tumors, including, but not limited to, tumors of the breast, lung, prostate, brain, liver, kidney, intestines, colon, spleen, pancreas, thymus, testis, ovary, uterus, and the like. In some embodiments, the tumor sample is from a tumor cell line. The collection of a tumor sample from a subject is performed in accordance with the standard protocol generally followed by hospital or clinics, such as during a biopsy.

(59) Any method known to those of ordinary skill in the art can be used to detect RNA expression levels. In some embodiments, RNA is isolated from the tumor sample. RNA can be isolated from the tumor sample using a variety of methods. Standard methods for RNA extraction from tissue or cells are described in, for example, Ausubel et al., Current Protocols of Molecular Biology, John Wiley & Sons, 1997 and Sambrook and Russell, Molecular Cloning: A Laboratory Manual 3rd ed., 2001. Commercially available kits, e.g., RNeasy® mini columns (Qiagen), PureLink® RNA mini kit (Thermo Fisher Scientific), etc. can also be used to isolate RNA.

(60) The level of RNA (e.g., mRNA) expression of the 14 CEN/KT genes described above can be detected or measured by a variety of methods including, but not limited to, an amplification assay, a hybridization assay, a sequencing assay, or an array. Non-limiting examples of such methods include reverse-transcription polymerase chain reaction (RT-PCR); quantitative real-time PCR (qRT-PCR); quantitative PCR, such as TaqMan®; Northern blotting; in situ hybridization assays; microarray analysis, e.g., microarrays from NanoString Technologies; multiplexed hybridization-based assays, e.g., QuantiGene 2.0 Multiplex Assay from Panomics; serial analysis of gene expression (SAGE); cDNA-mediated annealing, selection, extension, and ligation; direct sequencing or pyrosequencing; massively parallel sequencing; next generation sequencing; high performance liquid chromatography (HPLC) fragment analysis; capillarity electrophoresis; and the like.

(61) Various methods involving amplification reactions and/or reactions in which probes are linked to a solid support and used to quantify RNA may be used. Alternatively, the RNA may be linked to a solid support and quantified using a probe to the sequence of interest.

(62) In some embodiments, the target RNA is first reverse transcribed and the resulting cDNA is quantified. In some embodiments, RT-PCR or other quantitative amplification techniques are used to quantify the target RNA. Amplification of cDNA using PCR is well known (see U.S. Pat. Nos. 4,683,195 and 4,683,202; PCR PROTOCOLS: A GUIDE TO METHODS AND APPLICATIONS (Innis et al., eds, 1990)). Methods of quantitative amplification are disclosed in, e.g., U.S. Pat. Nos. 6,180,349; 6,033,854; and 5,972,602, as well as in, e.g., Gibson et al., Genome Research 6:995-1001 (1996); DeGraves, et al., Biotechniques 34(1):106-10, 112-5 (2003); Deiman B, et al., Mol Biotechnol. 20(2):163-79 (2002). Alternative methods for determining the level of a mRNA of interest in a sample may involve other nucleic acid amplification methods such as ligase chain reaction (Barany (1991) Proc. Natl. Acad. Sci. USA 88:189-193), self-sustained sequence replication (Guatelli et al. (1990) Proc. Natl. Acad. Sci. USA 87:1874-1878), transcriptional amplification system (Kwoh et al. (1989) Proc. Natl. Acad. Sci. USA 86:1173-1177), Q-Beta Replicase (Lizardi et al. (1988) Bio/Technology 6:1197), rolling circle replication (U.S. Pat. No. 5,854,033) or any other nucleic acid amplification method, followed by the detection of the amplified molecules using techniques well known to those of skill in the art.

(63) In general, quantitative amplification is based on the monitoring of the signal (e.g., fluorescence of a probe) representing copies of the template in cycles of an amplification (e.g., PCR) reaction. One method for detection of amplification products is the 5′-3′ exonuclease “hydrolysis” PCR assay (also referred to as the TaqMan® assay) (U.S. Pat. Nos. 5,210,015 and 5,487,972; Holland et al., PNAS USA 88: 7276-7280 (1991); Lee et al., Nucleic Acids Res. 21: 3761-3766 (1993)). This assay detects the accumulation of a specific PCR product by hybridization and cleavage of a doubly labeled fluorogenic probe (the “TagMan®” probe) during the amplification reaction. The fluorogenic probe consists of an oligonucleotide labeled with both a fluorescent reporter dye and a quencher dye. During PCR, this probe is cleaved by the 5′-exonuclease activity of DNA polymerase if, and only if, it hybridizes to the segment being amplified. Cleavage of the probe generates an increase in the fluorescence intensity of the reporter dye.

(64) Another method of detecting amplification products that relies on the use of energy transfer is the “beacon probe” method described by Tyagi and Kramer, Nature Biotech. 14:303-309 (1996), which is also the subject of U.S. Pat. Nos. 5,119,801 and 5,312,728. This method employs oligonucleotide hybridization probes that can form hairpin structures. On one end of the hybridization probe (either the 5′ or 3′ end), there is a donor fluorophore, and on the other end, an acceptor moiety. In the case of the Tyagi and Kramer method, this acceptor moiety is a quencher, that is, the acceptor absorbs energy released by the donor, but then does not itself fluoresce. Thus, when the beacon is in the open conformation, the fluorescence of the donor fluorophore is detectable, whereas when the beacon is in hairpin (closed) conformation, the fluorescence of the donor fluorophore is quenched. When employed in PCR, the molecular beacon probe, which hybridizes to one of the strands of the PCR product, is in “open conformation,” and fluorescence is detected, while those that remain unhybridized will not fluoresce (Tyagi and Kramer, Nature Biotechnol. 14: 303-306 (1996)). As a result, the amount of fluorescence will increase as the amount of PCR product increases, and thus may be used as a measure of the progress of the PCR. Those of skill in the art will recognize that other methods of quantitative amplification are also available.

(65) Various other techniques for performing quantitative amplification of nucleic acids are also known. For example, some methodologies employ one or more probe oligonucleotides that are structured such that a change in fluorescence is generated when the oligonucleotide(s) is hybridized to a target nucleic acid. For example, one such method involves a dual fluorophore approach that exploits fluorescence resonance energy transfer (FRET), e.g., LightCycler™ hybridization probes, where two oligo probes anneal to the amplicon. The oligonucleotides are designed to hybridize in a head-to-tail orientation with the fluorophores separated at a distance that is compatible with efficient energy transfer. Other examples of labeled oligonucleotides that are structured to emit a signal when bound to a nucleic acid or incorporated into an extension product include: Scorpions™ probes (e.g., Whitcombe et al., Nature Biotechnology 17:804-807, 1999, and U.S. Pat. No. 6,326,145), Sunrise™ (or Amplifluor™) probes (e.g., Nazarenko et al., Nuc. Acids Res. 25:2516-2521, 1997, and U.S. Pat. No. 6,117,635), and probes that form a secondary structure that results in reduced signal without a quencher and that emits increased signal when hybridized to a target (e.g., Lux Probes™).

(66) In other embodiments, intercalating agents that produce a signal when intercalated in double stranded DNA may be used. Exemplary agents include SYBR GREEN™ and SYBR GOLD™. Since these agents are not template-specific, it is assumed that the signal is generated based on template-specific amplification. This can be confirmed by monitoring signal as a function of temperature because melting point of template sequences will generally be much higher than, for example, primer-dimers, etc.

(67) In other embodiments, the mRNA is immobilized on a solid surface and contacted with a probe, e.g., in a dot blot or Northern format. In an alternative embodiment, the probe(s) are immobilized on a solid surface and the mRNA is contacted with the probe(s), for example, in a gene chip array. A skilled artisan can readily adapt known mRNA detection methods for use in detecting the level of mRNA encoding the biomarkers or other proteins of interest.

(68) In some embodiments, microarrays, e.g., are employed. DNA microarrays provide one method for the simultaneous measurement of the expression levels of large numbers of genes. Each array consists of a reproducible pattern of capture probes attached to a solid support. Labeled RNA or DNA is hybridized to complementary probes on the array and then detected by laser scanning. Hybridization intensities for each probe on the array are determined and converted to a quantitative value representing relative gene expression levels. See, U.S. Pat. Nos. 6,040,138, 5,800,992 and 6,020,135, 6,033,860, and 6,344,316. High-density oligonucleotide arrays are particularly useful for determining the gene expression profile for a large number of RNA's in a sample.

(69) Techniques for the synthesis of these arrays using mechanical synthesis methods are described in, e.g., U.S. Pat. No. 5,384,261. Although a planar array surface is often employed the array may be fabricated on a surface of virtually any shape or even a multiplicity of surfaces. Arrays may be peptides or nucleic acids on beads, gels, polymeric surfaces, fibers such as fiber optics, glass or any other appropriate substrate, see U.S. Pat. Nos. 5,770,358, 5,789,162, 5,708,153, 6,040,193 and 5,800,992. Arrays may be packaged in such a manner as to allow for diagnostics or other manipulation of an all-inclusive device.

(70) In some embodiments, gene-specific probes and/or primers are used in hybridization assays to detect RNA expression. The probes and/or primers may be labeled with any detectable moiety or compound, such as a radioisotope, fluorophore, chemiluminescent agent, and enzyme.

(71) The probes and primers necessary for practicing the present invention can be synthesized and labeled using well known techniques. Oligonucleotides used as probes and primers may be chemically synthesized according to the solid phase phosphoramidite triester method first described by Beaucage and Caruthers, Tetrahedron Letts., 22:1859-1862, 1981, using an automated synthesizer, as described in Needham-Van Devanter et al., Nucleic Acids Res. 12:6159-6168, 1984.

(72) In some embodiments, the methods further comprise detecting level of expression of one or more reference genes that can be used as controls to determine expression levels. Such genes are typically expressed constitutively at a high level and can act as a reference for determining accurate gene expression level estimates. Non-limiting examples of control genes include ARPC2, ATF4, ATP5B, B2M, CDH4, CELF1, CLTA, CLTC, COPB1, CTBP1, CYC1, CYFIP1, DAZAP2, DHX15, DIMT1, EEF1A1, FLOT2, GAPDH, GUSB, HADHA, HDLBP, HMBS, HNRNPC, HPRT1, HSP90AB1, MTCH1, MYL12B, NACA, NDUFB8, PGK1, PPIA, PPIB, PTBP1, RPL13A, RPLP0, RPS13, RPS23, RPS3, S100A6, SDHA, SEC31A, SET, SF3B1, SFRS3, SNRNP200, STARD7, SUMO1, TBP, TFRC, TMBIM6, TPT1, TRA2B, TUBA1C, UBB, UBC, UBE2D2, UBE2D3, VAMP3, XPO1, YTHDC1, YWHAZ, and 18S rRNA genes. Accordingly, a determination of RNA expression levels of the genes of interest, e.g., the gene expression levels of the panel of 14 CEN/KT genes may also comprise determining expression levels of one or more reference genes disclosed above.

(73) The level of mRNA expression of each of the 14 CEN/KT genes can be normalized to a reference level for a control gene. The control value can be predetermined, determined concurrently, or determined after a sample is obtained from the subject. The standard can be run in the same assay or can be a known standard from a previous assay. The normalized levels of mRNA expression of the CEN/KT genes can be transformed in to a score, e.g., a CES score.

(74) C. Methods of Quantifying Protein Levels

(75) In some embodiments, the methods disclosed herein include determining the level of 14 polypeptides encoded by 14 CEN/KT genes, such as CENP-A, CENP-K, CENP-L, CENP-M, CENP-N, CENP-U, CENP-W, MIS18B, HJURP, ZWINT, NDC80, SPC24, SPC25 and NUF2 or a subset of at least 9 polypeptides of the 14 polypeptides encoded by the 14 CEN/KT genes. In some embodiments, the level of the CENP-A, HJURP, MIS18B, CENP-N, CENP-M, CENP-U ZWINT, NDC80 and SPC25 polypeptides are detected or measured. These polypeptides can be detected in various tumor samples.

(76) Any method known to those of ordinary skill in the art can be used to detect protein expression levels. A general overview of the applicable technology can be found in Harlow & Lane, Antibodies: A Laboratory Manual (1988) and Harlow & Lane, Using Antibodies (1999). Methods of producing polyclonal and monoclonal antibodies that react specifically with an allelic variant are known to those of skill in the art (see, e.g., Coligan, Current Protocols in Immunology (1991); Harlow & Lane, supra; Goding, Monoclonal Antibodies: Principles and Practice (2d ed. 1986); and Kohler & Milstein, Nature 256:495-497 (1975)). Such techniques include antibody preparation by selection of antibodies from libraries of recombinant antibodies in phage or similar vectors, as well as preparation of polyclonal and monoclonal antibodies by immunizing rabbits or mice (see, e.g., Huse et al., Science 246:1275-1281 (1989); Ward et al., Nature 341:544-546 (1989)).

(77) The level of such polypeptides can be detected by a variety of methods including, but not limited to, Western blotting, immunoassays, e.g., enzyme-linked immunosorbent assay (ELISA), enzyme immunoassay (EIA), radioimmunoassay (RIA), sandwich assays, competitive assays, immunohistochemistry, mass spectrometry, 2-D gel electrophoresis, protein array, antibody array, and the like.

(78) For a review of immunological and immunoassay procedures, see Basic and Clinical Immunology (Stites & Terr eds., 7th ed. 1991). Moreover, the immunoassays can be performed in any of several configurations, which are reviewed extensively in Enzyme Immunoassay (Maggio, ed., 1980); and Harlow & Lane, supra. For a review of the general immunoassays, see also Methods in Cell Biology: Antibodies in Cell Biology, volume 37 (Asai, ed. 1993); Basic and Clinical Immunology (Stites & Terr, eds., 7th ed. 1991).

(79) Similar to normalizing the mRNA level of the CEN/KT genes, the level of protein expression can also be compared and normalized to a control value for a standard.

(80) D. Establishing CES Scores

(81) After determining the expression of level of the panel of CEN/KT genes, the method presented herein includes calculating a CES score, e.g., a risk score based on the level of the 14 CEN/KT gene expression products. The level of expression of the 14 CEN/KT genes can be equally weighted in the CES score. In some instances, the level of expression of each gene is weighted with a predefined coefficient. The predefined coefficient is the same or different for the genes.

(82) In some embodiments, the CES score is generated using the following formula: CES score=sum of the log 2 (mRNA level) for the 14 CEN/KT genes (e.g., CENP-A, CENP-K, CENP-L, CENP-M, CENP-N, CENP-U, CENP-W, MIS18B, HJURP, ZWINT, NDC80, SPC24, SPC25 and NUF2).

(83) In some embodiments, a patient's CES score is categorized as “high,” “intermediate,” or “low” relative to a reference scale, e.g., a range of CES scores from a population of reference subjects that have the same cancer as the patient. In some cases, a high score corresponds to a numerical value in the top tertile, (e.g., the highest ⅓) of the reference scale; an intermediate score corresponds to the intermediate tertile (e.g., the middle ⅓) of the reference scale; and a low score corresponds to the bottom tertile (e.g., the lowest ⅓) of the reference scale. In other embodiments, a high score represents a risk score that is 0.66 or above, e.g., 0.66, 0.67, 0.70, 0.75, 0.80, 0.85, 0.90, 0.95, 0.99 or 1.0 based on a normalized, standardized reference scale on a scale of 0 to 1. In yet other embodiments, a patient's CES score is compared to one or more threshold value(s) to provide a likelihood of cancer progression and/or response to chemotherapy or radiation therapy. In some cases, the high risk score corresponds to a numerical value, e.g., risk score in the top 5%, top 10%, top 15%, top 20%, top 25%, top 30%, top 35%, top 40%, top 45%, top 50%, or top 60% of the reference scale.

(84) In order to establish a reference CES scale or a threshold value for practicing the method of this invention, a reference population of subjects can be used. In some embodiments, the reference population has the same type of cancer or tumor as the test patient. The reference population may have the same subtype and/or stage of cancer or tumor as the test patient. The subjects in the reference population can be within the appropriate parameters, if applicable, for the purpose of screening for and/or monitoring cancer using the methods provided herein. Optionally, the reference subjects are of same gender, similar age, or similar ethnic background. The reference subject may be of the same gender, similar age, or similar ethnic background as the test subject.

(85) The status of the reference subjects can be confirmed by well established, routinely employed methods including but not limited to general physical examination of the individuals and general review of their medical history. Furthermore, the group of reference subjects must be of a reasonable size, such that the average levels of the 14 CEN/KT polynucleotides (mRNA) or corresponding polypeptide in samples obtained from the group can be reasonably regarded as representative of the normal or average level among this population of subjects.

(86) To establish a threshold value, an average value is determined based on the individual values found in each subject of the selected reference group. For example, a risk score over the threshold value can indicate a more than average likelihood of cancer progression whereas a risk score below the threshold value can indicate an average or below-average likelihood of cancer progression. In some embodiments, a standard deviation is also determined during the same process. In some cases, separate threshold values may be established for separately defined groups having distinct characteristics such as age, gender, or ethnic background.

(87) According to the methods described herein, the patient's risk score is compared to one or more threshold values. In some embodiments, the risk score is deemed “high” if it is at least 1, 2, 3, 4, 5, 10, 15, 20 or more standard deviations greater than the threshold value. In other embodiments, the risk score is “low” or below the threshold if it is at least 1, 2, 3, 4, 5, 10, 15, 20 or more standard deviations lower than the threshold value.

(88) In some embodiments, a computer-based analysis program is used to translate the raw data generated by the detection methods described herein (e.g., the presence, absence, or amount of a given marker or markers) into a risk score of predictive value to a clinician.

(89) E. Correlating CES Scores with Prognostic Outcomes or Treatment Selection

(90) The CES score, as determined according to the methods above, can predict that the patient has an above-average or statistically significant likelihood of poor prognosis, e.g., tumor progression, overall survival, recurrence, relapse, and/or metastasis. If treated with chemotherapy or radiation therapy, such a patient has a statistically significant likelihood of responding to the therapy, and in some cases have a good prognosis, e.g., long-term overall survival, any-event free survival, metastatic relapse free-survival, distant metastasis-free survival, and/or disease-free survival.

(91) In some embodiments, if the subject has a high CES score, there is a likelihood that the subject will have a poor prognosis, e.g., will experience death, cancer relapse, cancer recurrence, cancer progression, and/or local or distant metastasis. In some cases, a high CES score predicts that the subject will have poor metastatic relapse-free survival (MRFS), such as a short term MRFS, no MRFS, or a below-average probability of MRFS. In other cases, a high CES score predicts that the subject will have poor any event (AE)-free survival, e.g., a short term AE-free survival, no AE-free survival, or a below-average probability of AE-free survival. The subject may have an early stage cancer, such as an early stage breast cancer, lung cancer, gastric cancer, or ovarian cancer.

(92) In some embodiments, it is predicted that a subject with breast cancer and a high CES value will have poor distant metastasis-free survival (DMFS), e.g., a shorter term of DMFS, no DMFS, or a below-average probability of DMFS, compared to a breast cancer subject with a low CES value. A breast cancer patient with a high CES may also have an ER negative tumor and/or an advanced tumor grade. Such a patient may have an aggressive tumor. Patients with ER positive breast cancer and a high CES are predicted to have poor AE-free survival, poor DMFS or poor relapse-free survival In some cases, the patients with ER positive breast cancer have either a normal breast-like tumor, a luminal A tumor, or a luminal B tumor. In some cases, the patients with ER positive breast cancer have been treated with adjuvant tamoxifen therapy. Patients with luminal A tumors and a high CES are predicted to have poor overall survival. Similarly, patients with luminal B tumors and a high CES are expected to have poor overall survival.

(93) In some embodiments, breast cancer patients with either a specific breast cancer subtype, e.g., basal-like subtype, and a high CES value will have overall survival and/or disease-free survival (DFS) after receiving cancer therapy. These patients are also predicted to have good DMFS after receiving treatment. Additionally, these patients are predicted to be responsive to cancer therapy. In some instances, the cancer therapy includes radiation therapy, chemotherapy alone, radiation therapy and chemotherapy, or any of the above in combination with drug therapy, hormone therapy, and/or surgery.

(94) In some embodiments, patients with lung cancer, such as non-small cell lung carcinoma (NSCLC) and a high CES value are predicted to respond to adjuvant cancer therapy and experience improved overall survival and/or improved DFS, compared to not receiving adjuvant therapy. If it is determined that a patient with lung cancer has a high CES value, it is recommended or suggested that the patient receive adjuvant radiation therapy, adjuvant chemotherapy, or any combination thereof.

(95) F. Computer-Implemented Methods, Systems, and Devices

(96) Any of the methods described herein may be totally or partially performed with a computer system including one or more processors, which can be configured to perform the steps. Thus, embodiments are directed to computer systems configured to perform the steps of any of the methods described herein, potentially with different components performing a respective step or a respective group of steps. Although presented as numbered steps, steps of methods herein can be performed at a same time or in a different order. Additionally, portions of these steps may be used with portions of other steps from other methods. Also, all or portions of a step may be optional. Any of the steps of any of the methods can be performed with modules, circuits, or other means for performing these steps.

(97) Any of the computer systems mentioned herein may utilize any suitable number of subsystems. Examples of such subsystems are shown in FIG. 9 in computer apparatus 100. In some embodiments, a computer system includes a single computer apparatus, where the subsystems can be the components of the computer apparatus. In other embodiments, a computer system can include multiple computer apparatuses, each being a subsystem, with internal components.

(98) The subsystems shown in FIG. 9 are interconnected via a system bus 175. Additional subsystems such as a printer 174, keyboard 178, storage device(s) 179, monitor 176, which is coupled to display adapter 182, and others are shown. Peripherals and input/output (I/O) devices, which couple to I/O controller 171, can be connected to the computer system by any number of means known in the art, such as serial port 177. For example, serial port 177 or external interface 181 (e.g. Ethernet, Wi-Fi, etc.) can be used to connect computer system 100 to a wide area network such as the Internet, a mouse input device, or a scanner. The interconnection via system bus 175 allows the central processor 173 to communicate with each subsystem and to control the execution of instructions from system memory 172 or the storage device(s) 179 (e.g., a fixed disk, such as a hard drive or optical disk), as well as the exchange of information between subsystems. The system memory 172 and/or the storage device(s) 179 may embody a computer readable medium. Any of the data mentioned herein can be output from one component to another component and can be output to the user.

(99) A computer system can include a plurality of the same components or subsystems, e.g., connected together by external interface 181 or by an internal interface. In some embodiments, computer systems, subsystem, or apparatuses can communicate over a network. In such instances, one computer can be considered a client and another computer a server, where each can be part of a same computer system. A client and a server can each include multiple systems, subsystems, or components.

(100) It should be understood that any of the embodiments of the present disclosure can be implemented in the form of control logic using hardware (e.g., an application specific integrated circuit or field programmable gate array) and/or using computer software with a generally programmable processor in a modular or integrated manner. As user herein, a processor includes a multi-core processor on a same integrated chip, or multiple processing units on a single circuit board or networked. Based on the disclosure and teachings provided herein, a person of ordinary skill in the art will know and appreciate other ways and/or methods to implement embodiments of the present disclosure using hardware and a combination of hardware and software.

(101) Any of the software components or functions described in this application may be implemented as software code to be executed by a processor using any suitable computer language such as, for example, Java, C++ or Perl using, for example, conventional or object-oriented techniques. The software code may be stored as a series of instructions or commands on a computer readable medium for storage and/or transmission, suitable media include random access memory (RAM), a read only memory (ROM), a magnetic medium such as a hard-drive or a floppy disk, or an optical medium such as a compact disk (CD) or DVD (digital versatile disk), flash memory, and the like. The computer readable medium may be any combination of such storage or transmission devices.

(102) Such programs may also be encoded and transmitted using carrier signals adapted for transmission via wired, optical, and/or wireless networks conforming to a variety of protocols, including the Internet. As such, a computer readable medium according to an embodiment of the present invention may be created using a data signal encoded with such programs. Computer readable media encoded with the program code may be packaged with a compatible device or provided separately from other devices (e.g., via Internet download). Any such computer readable medium may reside on or within a single computer product (e.g. a hard drive, a CD, or an entire computer system), and may be present on or within different computer products within a system or network. A computer system may include a monitor, printer, or other suitable display for providing any of the results mentioned herein to a user.

(103) G. Selecting Cancer Therapies

(104) In some embodiments, the method of the present disclosure also includes selecting a therapeutic intervention for the subject with cancer having a high CES score or a high likelihood of death, disease relapse, recurrence, progression and/or metastasis. For a cancer subject with a high CES value, radiation therapy, chemotherapy, drug therapy, e.g., hormone therapy, immunotherapy, surgery, or any combination thereof can be selected. In some instances, surgery and an adjuvant therapy, such as radiation therapy, chemotherapy, drug therapy, e.g., hormone therapy, immunotherapy, or any combination thereof are suggested for the subject with a high CES score.

(105) Non-limiting examples of useful chemotherapy agents include alkylating agents, e.g., cyclophosphamide, mechlorethamine, chlorambucil, ifosfamid, melphalan, streptozocin, carmustine, lomustine, busulfan, dacarbazine, temozolomide, thiotepa, and altretamine, antimetabolites, e.g., 5-fluorouracil (5-FU), 6-mercaptopurine (6-MP), capecitabine, cytarabine, floxuridine, gemcitabine, hydroxyurea, methotrexate, and pemetrexed, anthracyclines, e.g., daunorubicin, doxorubicin, epirubicin, and idarubicin, other anti-tumor antibiotics, e.g., actinomycin-D, bleomycin, mitomycin-c and mitoxantrone, topoisomerase inhibitors, e.g., topotecan, irinotecan, etoposide, teniposide, and metoxantrone, mitotic inhibitors, e.g., paclitaxel, docetaxel, ixabepilone, vinblastine, vincristine, vinrelbine, and estramustine, corticosteroids, e.g., prednisone, methylprednisone, and dexamethasone, L-aspraginase, and the proteasome inhibitor bortezomib. Without limitations, examples of radiation therapy include external beam radiation therapy, internal radiation therapy, or systemic radiation therapy.

(106) The therapeutic intervention can include one or more DNA damaging compounds or agents, such as cisplatin, carboplatin, oxaliplatin, picoplatin, other platinum-based compounds, doxorubicin, daunorubicin, other anthracyclines, variants thereof and derivatives thereof.

(107) In some instances, administration of one or more anthracyclines; cyclophosphamide; one or more taxanes; methotrexate; 5-fluorouracil; one or more anthracyclines and cyclophosphamide; one or more anthracyclines, cyclophosphamide, and one or more taxanes; cyclophosphamide, methotrexate and 5-fluorouracil, or any combination thereof is recommended.

(108) In some embodiments, one or more therapeutic interventions are recommended. Each therapy can be administered simultaneously or sequentially.

(109) H. Kits

(110) For use in diagnostic applications, prognostic applications, and therapy selection applications described above, kits are also disclosed herein. The kits of the invention may comprise any or all of the reagents to perform the methods described herein. In such applications the kits may include any or all of the following: assay reagents, buffers, nucleic acids that bind to at least one of the genes described herein, hybridization probes and/or primers, antibodies or other moieties that specifically bind to at least one of the polypeptides encoded by the genes described herein, etc. In addition, the kit may include reagents such as nucleic acids, hybridization probes, primers, antibodies and the like that specifically bind to a reference gene or a reference polypeptide. The kit may comprise probes to one or more reference genes identified herein, such as, ARPC2, ATF4, ATP5B, B2M, CDH4, CELF1, CLTA, CLTC, COPB1, CTBP1, CYC1, CYFIP1, DAZAP2, DHX15, DIMT1, EEF1A1, FLOT2, CAPDH, GUSB, HADHA, HDLBP, HMBS, HNRNPC, HPRT1, HSP90AB1, MTCH1, MYL12B, NACA, NDUFB8, PGK1, PPIA, PPIB, PTBP1, RPL13A, RPLP0, RPS13, RPS23, RPS3, S100A6, SDHA, SEC31A, SET, SF3B1, SFRS3, SNRNP200, STARD7, SUMO1, TBP, TFRC, TMBIM6, TPT1, TRA2B, TUBA1C, UBB, UBC, UBE2D2, UBE2D3, VAMP3, XPO1, YTHDC1, YWHAZ, and 18S rRNA.

(111) The term “kit” as used herein in the context of detection reagents, are intended to refer to such things as combinations of multiple gene expression product detection reagents, or one or more gene expression product detection reagents in combination with one or more other types of elements or components (e.g., other types of biochemical reagents, containers, packages such as packaging intended for commercial sale, substrates to which gene expression detection product reagents are attached, electronic hardware components, etc.).

(112) In some embodiments, the present disclosure provides oligonucleotide probes attached to a solid support, such as an array slide or chip, e.g., as described in DNA Microarrays: A Molecular Cloning Manual, 2003, Eds. Bowtell and Sambrook, Cold Spring Harbor Laboratory Press. Construction of such devices are well known in the art, for example as described in US Patents and Patent Publications U.S. Pat. No. 5,837,832; PCT application WO95/11995; U.S. Pat. Nos. 5,807,522; 7,157,229, 7,083,975, 6,414,175, 6,375,903, 6,315,958, 6,295,153, and 5,143,854, 2007/0037274, 2007/0140906, 2004/0126757, 2004/0110212, 2004/0110211, 2003/0143550, 2003/0003032, and 2002/0041420. Nucleic acid arrays are also reviewed in the following references: Biotechnol Annu Rev 8:85-101 (2002); Sosnowski et al, Psychiatr Genet 12(4):181-92 (December 2002); Heller, Annu Rev Biomed Eng 4: 129-53 (2002); Kolchinsky et al, Hum. Mutat 19(4):343-60 (April 2002); and McGail et al, Adv Biochem Eng Biotechnol 77:21-42 (2002).

(113) A microarray can be composed of a large number of unique, single-stranded polynucleotides, usually either synthetic antisense polynucleotides or fragments of cDNAs, fixed to a solid support. Typical polynucleotides are preferably about 6-60 nucleotides in length, more preferably about 15-30 nucleotides in length, and most preferably about 18-25 nucleotides in length. For certain types of arrays or other detection kits/systems, it may be preferable to use oligonucleotides that are only about 7-20 nucleotides in length. In other types of arrays, such as arrays used in conjunction with chemiluminescent detection technology, preferred probe lengths can be, for example, about 15-80 nucleotides in length, preferably about 50-70 nucleotides in length, more preferably about 55-65 nucleotides in length, and most preferably about 60 nucleotides in length.

(114) In addition, the kits may include instructional materials containing directions (i.e., protocols) for the practice of the methods provided herein. While the instructional materials typically comprise written or printed materials they are not limited to such. Any medium capable of storing such instructions and communicating them to an end user is contemplated by this invention. Such media include, but are not limited to electronic storage media (e.g., magnetic discs, tapes, cartridges, chips), optical media (e.g., CD ROM), and the like. Such media may include addresses to internet sites that provide such instructional materials.

(115) Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, one of skill in the art will appreciate that certain changes and modifications may be practiced within the scope of the appended claims. In addition, each reference provided herein is incorporated by reference in its entirety to the same extent as if each reference was individually incorporated by reference.

IV. EXAMPLES

(116) The following examples are offered to illustrate, but not to limit, the claimed invention.

Example 1. M is Expression of Specific Centromere and Kinetochore Proteins Predicts Cancer Patient Survival and Response to Radiotherapy and Chemotherapy

(117) Chromosomal instability (CIN) is a hallmark of most human cancers and contributes to tumor heterogeneity and drug resistance. Aberrant centromere and kinetochore function causes CIN through chromosome missegregation during mitosis and chromosome rearrangements. However, we previously lacked a systematic understanding of the impact of centromere and kinetochore structural protein genes (CEN/KT genes) in cancer progression in patients. Based on differential gene expression between cancer and normal tissues and prognostic values of gene misexpression using a large number of patient data from many cancer types, we identified a core subset of 14 CEN/KT genes and devised a CES system (for Centromere and kinetochore gene Expression Score) that strongly correlates with copy number alternation (CNA) and mutation frequencies in various types of cancers. The CES score is an effective predictor of overall patient survival and disease progression for a wide spectrum of cancer types, including breast, lung, gastric and early stage ovarian cancers. Most importantly, high CES values are correlated with sensitivity to DNA damaging compounds in cancer cell lines, and effectively predict therapeutic outcomes for cancer patients after chemotherapy and radiotherapy. These results suggest that the CES system provides a novel and effective biomarker for cancer prognosis and for choosing therapeutic options.

INTRODUCTION

(118) Genomic instability is characteristic of most human cancers and is believed to enable acquisition of other cancer hallmarks such as uninhibited cell growth and proliferation, heterogeneity and drug resistance (Hanahan and Weinberg, 2011). The major type of genomic instability is chromosomal instability (CIN), characterized by an increased rate of chromosomal abnormalities including gain/loss of whole chromosomes or large segments (aneuploidy), structural rearrangements and focal aberrations (e.g. amplifications and deletions) (Beroukhim et al., 2010; Geigl et al., 2008). CIN has been observed in pre-cancerous lesions and malignant growth (P than et al., 2003). Aneuploidy has been hypothesized to promote tumorigenesis (Boveri, 1902, 1914; Siegel and Amon, 2012; Weaver et al., 2007). Recent cancer genome sequencing studies suggested that CIN contributes to inter- and intra-tumor heterogeneity (de Bruin et al., 2014; Hiley and Swanton, 2014; Nik-Zainal et al., 2012; Yachida et al., 2010; Zhang et al., 2014). Aberrant chromosome behavior can cause abnormal chromosomal structure, increase mutation frequency or epigenetically modify gene activity.

(119) During cancer development, defective chromosome segregation and integrity pathways could synergize with altered signal transduction pathways, or they could act independently. For example, many oncogenes encode fused or misregulated signaling molecules caused by chromosomal translocations or inversions (Pierotti, 2003). In another example, dynamic amplification of the EGFR locus in glioblastoma cells contributes to resistance to EGFR inhibitors (Nathanson et al., 2014). On the other hand, rare mutations in spindle checkpoint components such as Bub1, BubR1 and Mad1 promote aneuploidy and link to tumorigenesis in mouse and humans (Kops et al., 2005). Thus, continuous modifications of the genomic landscape can allow rapid accumulation of deleterious changes that promote cancer progression and growth (Schvartzman et al., 2010), and confer drug resistance during treatments (Lee et al., 2011; Nathanson et al., 2014; Swanton et al., 2007; Weaver and Cleveland, 2006). One paradoxical phenomenon is that extreme CIN can cause growth disadvantage, presumably due to excess stress from genotoxic effects and proteomic imbalance (Hiley and Swanton, 2014; Siegel and Amon, 2012). These results, and the possibility of selectively killing cancer cells displaying CIN, demonstrate CIN to be both a challenge and a potential opportunity for cancer treatment (Carter et al., 2006; Roschke and Kirsch, 2005).

(120) While the exact cause of CIN in most sporadic cancers remains unclear, proposed mechanisms include oncogene-induced replication stress, the breakage-fusion-bridge cycles induced by telomere dysfunction or translocations, and aberrant mitosis (Artandi and DePinho, 2010; Kops et al., 2005; Negrini et al., 2010). Chromosome missegregation also can be accompanied by DNA damage through chromosome fragmentation (Janssen et al., 2011). Centromeres and associated kinetochores are required for proper chromosome congression, mitotic checkpoint function, and separation of sister chromatids during mitosis in eukaryotic cells (Allshire, 1997; Cleveland et al., 2003; Earnshaw et al., 1991). Thus, another potential cause of CIN is misregulation of centromere and kinetochore functions, which leads to chromosomal abnormalities in cell lines and model organisms.

(121) Centromeres and kinetochores consist of centromeric chromatin, as well as inner and outer kinetochore structures (FIG. 1A). CENP-A, a histone H3 variant enriched at active centromeres, is a key epigenetic mark that determines centromere identity and its faithful propagation (Allshire and Karpen, 2008; Black et al., 2010). All other centromere and kinetochore proteins ultimately require CENP-A for their localization (Allshire and Karpen, 2008). The CCAN (Constitutive Centromere Associated Network) links chromatin to the outer kinetochore and contains several subcomplexes. The CENP-T/-W/-S/-X complex resides within the H3 domains interspersed between CENP-A nucleosomes (Blower et al., 2002; Foltz et al., 2006; Nishino et al., 2012; Sullivan and Karpen, 2004). CENP-N/-L/-M determines the localization of CENP-H/-I/-K, which is in turn required for CENP-O/-P/-Q/-R/-U recruitment. The CCAN ensures the recruitment of the KMN network (KNL1 complex, MIS12 complex and NDC80 complex) to the outer kinetochore (Cheeseman and Desai, 2008; Hori et al., 2008; Perpelescu and Fukagawa, 2011), and the NDC80 complex interacts with spindle microtubules.

(122) CENP-A is incorporated into centromeric chromatin using HJURP as its chaperone and assembly factor (Dunleavy et al., 2009; Foltz et al., 2009; Mellone et al., 2009). HJURP is recruited to the centromere by the MIS18 complex containing MIS18A, MIS18B and M18BP1 subunits (Barnhart et al., 2011; Fujita et al., 2007; Moree et al., 2011). Moreover, several CCAN components such as CENP-C and members of CENP-H/-I/-K and CENP-N/-L/-M are also required for CENP-A assembly (Black and Cleveland, 2011; Cheeseman et al., 2008; Moree et al., 2011; Okada et al., 2006).

(123) The levels of centromere and kinetochore proteins appear to be tightly regulated to ensure faithful chromosome segregation. Loss of many centromere and kinetochore proteins by mutation or depletion result in chromosome segregation defects and cell death, and overexpression of some key proteins can also compromise functions (Allshire and Karpen, 2008). For example, overexpression or ectopic tethering of Drosophila CENP-A results in mis-incorporation into normally non-centromeric chromosomal regions, causing neo-centromere formation, dicentric behavior, and chromosomal breakage and abnormalities (Heun et al., 2006; Mendiburo et al., 2011). Elevated levels of human CENP-A or HJURP in cell lines also mislocalize to other regions of the genome and cause chromatin bridges and micronuclei (Mishra et al., 2011). Importantly, overexpression of several centromeric proteins, including CENP-A, HJURP and CENP-H, correlates with poor prognosis for several types of cancers, suggesting potential roles in cancer etiology (Hu et al., 2010; Mcgovern et al., 2012; Tomonaga et al., 2005; Tomonaga et al., 2003).

(124) We hypothesized that misregulation of centromere and kinetochore protein genes cause chromosomal abnormalities that contribute to human cancer progression and/or tumor maintenance. We systematically investigated differential expression of centromere and kinetochore structural protein (CEN/KT) genes between cancerous and normal tissues, and studied the prognostic impact of their gene expression levels. We found that overexpression of 14 CEN/KT genes is consistently observed in many different types of cancers. We derive a CES system (for Centromere and kinetochore gene Expression Score) that summarizes the extent of centromere and kinetochore gene misexpression across several cancer types. We correlated CES values with a significant fraction of genomic instability in a wide spectrum of cancer types. We also show that the tumor CES value predicts patient survival and disease progression. Radiotherapy (RT) and DNA damaging compounds kill cancer cells by damaging DNA beyond repair followed by cell death, yet are associated with potentially severe collateral damage to patients. We hypothesized that tumors with high CES values are already subjected to high levels of genotoxic stress and might be more sensitive to further damage. This idea is supported by sensitivity of high CES cancer cell lines to Topo I inhibitors that cause DNA damage and inhibit replication and transcription (Mathijssen et al., 2002). Using breast cancer and lung cancer clinical datasets, we found that the CES system effectively forecasts patient outcome after RT or adjuvant chemotherapy, and propose that this system may be valuable for optimizing treatment regimens in clinical oncology. The CEN/KT genes identified here are components that determine dynamic centromere and kinetochore structure and play pivotal roles in faithful chromosome segregation. Many of the CES genes are involved in the process of CENP-A nucleosome assembly, suggesting the potential importance of this process in cancer progression. These chromosomal functions are distinct from many existing drug targets that are involved in signal transduction and regulation of oncogenic or tumor suppression pathways. Thus, the CEN/KT proteins identified here may be novel targets for development of cancer therapy drugs, which may be particularly effective when combined with drugs targeted to components of orthogonal pathways, such as signal transduction and cell growth.

(125) Results

(126) A. Misregulation of a Subset of Centromere and Kinetochore Protein Genes in Human Cancers

(127) We manually compiled a list of 31 centromere and kinetochore (CEN/KT) protein genes (FIG. 1B) to investigate their potential roles in cancer prognosis. The list was restricted to proteins demonstrated to localize to and determine centromere or kinetochore structures (Black et al., 2010). The list includes CENP-A and downstream CCAN and KMN components, as well as factors required for CENP-A nucleosome assembly and centromere propagation (e.g., HJURP and MIS18) that transiently localize to centromeres (Dunleavy et al., 2009; Foltz et al., 2009; Fujita et al., 2007; Mellone et al., 2009).

(128) Using GEO databases, CEN/KT gene expression analysis was performed for a wide spectrum of human cancer types, specifically breast, lung, liver, nasopharyngeal, gastric, head and neck, cervical, prostate, glioblastoma, colorectal, pancreas and ovarian (Table 1). We consistently observe misregulation of a subset of CEN/KT genes in most types of cancers compared to corresponding normal tissues. In addition, we detected difference between tumors at different disease stages during cancer progression. For example, in breast tissues, CEN/KT misregulation in ductal carcinoma in situ (DCIS) is intermediate between normal tissues and invasive ductal carcinomas (IDCs). In liver, CEN/KT genes show no significant misregulation in cirrhotic or dysplastic tissues, but are significantly misregulated from very early stage to very advanced cancers. In prostate, only metastatic cancers display significant misregulation for CEN/KT genes, while malignant local lesions show limited misregulation. These results suggest a potential role for CEN/KT protein misregulation in initiation or early stages of cancer progression. In addition, the absence of CEN/KT gene misregulation in liver dysplasia suggests that defective CEN/KT regulation is not simply a result of cell over-proliferation.

(129) TABLE-US-00001 TABLE 1 GEO datasets used for studying CEN/KT gene. Cancer types GEO Series Accession Number breast GSE21422 and GSE3744 lung GSE19188 ovarian GSE14407 liver GSE6764 pancreas GSE16515 colorectal GSE8671 nasopharyngeal GSE12452 gastric GSE13911 head and neck GSE6791 cervical GSE6791 prostate GSE3325 glioblastoma GSE4290

(130) To address the potential role of CEN/KT genes in cancer progression, we analyzed datasets containing tissue samples representing different stages of disease progression. Specifically, our analyses of 13 Affymetrix gene expression microarray datasets from 9 cancer types revealed that expression of 15 CEN/KT genes is significantly misregulated (FDR p<0.05, at least 2-fold difference) in over 50% of examined cancer datasets comparing cancer to corresponding normal tissues, and early to advanced stage tumor samples (FIG. 1C and Table 2). These results suggest that defective CEN/KT gene regulation is conserved among a wide array of cancers, and may play an important role in disease progression.

(131) TABLE-US-00002 TABLE 2 GEO datasets used for studying differentially expressed CEN/KT genes. Brain Breast Cervical Head & Neck Colon Gastric and CNS GSE17080 GSE21422 GSE3744 GSE6791 GSE6791 GSE12452 GSE8671 GSE13911 GSE4290 IDC DCIS IDC BC Tumor Tumor Tumor adenoma Tumor astrocytomas vs vs vs vs vs vs vs vs vs vs Gene Probe ID Normal Normal Normal Normal Normal Normal Normal Normal Normal normal CENP-A 204962_s_at 30.98 2.83 5.27 8.75 6.23 4.04 5.12 17.18 7.69 4.56 210821_x_at 8.81 1.10 3.20 3.15 0.06 2.33 0.64 9.59 4.92 3.37 HJURP 218726_at 37.95 2.04 2.60 9.22 5.72 1.24 4.01 18.63 7.30 5.76 M18BP1 206500_s_at 4.20 0.65 0.72 2.55 2.52 1.55 0.94 7.63 2.83 2.47 226630_at 1.08 0.43 0.02 0.05 6.20 0.23 2.84 11.10 0.90 1.17 241816_at 1.62 0.24 0.16 0.50 0.37 0.05 0.38 1.49 0.90 2.96 244173_at 0.39 0.85 0.56 1.23 0.08 0.94 0.15 0.31 1.48 0.24 MIS18A 219004_s_at 12.37 0.98 1.92 2.98 7.15 4.35 4.20 13.61 4.64 0.15 228597_at 13.05 1.38 1.46 2.97 9.07 1.06 4.41 16.26 2.44 2.11 229671_s_at 10.95 1.80 1.57 2.85 0.31 4.07 4.30 11.33 0.84 2.25 MIS18B 213599_at 33.63 2.57 4.22 4.46 7.61 3.43 5.05 18.04 5.22 3.65 CENP-T 218148_at 1.17 1.61 0.25 0.98 1.86 0.75 0.15 1.17 0.51 1.80 CENP-W 226936_at 7.98 0.04 0.28 2.09 7.43 3.97 2.91 23.45 8.09 0.12 CENP-S 213454_at 12.06 0.28 0.95 2.80 5.74 2.06 0.29 16.29 0.47 0.17 CENP-X 209478_at 14.56 2.44 4.71 0.87 0.03 0.08 0.89 4.53 1.51 0.05 CENP-C 204739_at 6.71 1.25 1.54 0.91 2.86 0.03 0.56 1.46 1.89 0.61 CENP-N 219555_s_at 21.13 1.53 3.69 5.96 3.62 3.23 3.81 18.46 6.20 0.82 222118_at 5.59 0.55 2.54 2.49 3.96 5.11 3.88 10.95 3.97 0.11 228559_at 21.26 2.71 2.59 5.66 4.53 2.12 2.53 13.61 4.35 0.83 234811_at 2.59 0.02 0.60 0.51 0.28 0.15 0.57 1.45 0.50 0.72 CENP-M 218741_at 24.37 2.19 3.40 4.38 3.36 2.26 0.94 8.71 7.41 3.42 CENP-U 218883_s_at 37.45 3.12 3.19 7.30 5.54 0.32 7.22 11.01 4.63 8.43 229304_s_at 7.37 1.98 1.65 1.71 1.70 0.51 4.02 7.01 0.35 3.24 229305_at 24.09 1.43 1.31 3.17 3.39 0.94 6.02 8.36 1.61 2.52 CENP-H 231772_x_at 17.85 1.74 2.07 2.02 3.38 3.51 5.46 11.62 6.93 5.25 CENP-I 1555046_at 1.01 0.46 0.20 1.07 0.81 0.44 0.91 1.23 0.74 0.47 1563223_a_at 0.07 0.25 0.09 0.94 1.43 1.54 0.85 1.33 2.20 0.25 207590_s_at 12.03 0.98 1.52 2.32 1.75 1.53 3.70 8.26 1.47 0.53 214804_at 17.29 0.65 1.22 2.32 5.19 2.70 4.71 6.92 4.35 1.64 CENP-L 1554271_a_at 20.53 3.57 2.99 4.54 0.91 2.43 1.92 10.63 3.93 4.22 232065_x_at 9.57 4.56 2.84 3.83 4.45 3.39 4.20 8.42 9.45 4.21 CENP-K 222848_at 29.45 2.84 2.61 3.76 11.72 1.57 6.76 16.12 4.87 5.49 CENP-O 219472_at 1.89 0.24 0.35 0.12 1.49 0.20 0.01 0.50 1.38 1.45 226118_at 15.16 1.81 1.98 2.75 4.76 2.79 3.05 4.28 3.02 3.50 CENP-Q 219294_at 5.36 0.10 0.27 1.77 8.13 3.39 4.03 9.66 4.18 5.63 CENP-R 205176_s_at 0.30 0.60 1.59 0.06 6.54 0.59 5.11 12.20 0.97 7.38 KNL1 1552680_a_at 32.52 0.58 0.12 3.16 1.62 0.47 1.31 3.15 4.37 1.78 1552682_a_at 2.97 0.84 0.64 0.98 0.32 0.04 0.82 4.67 1.57 0.03 220247_at 0.14 0.45 0.37 0.73 1.52 3.81 0.25 0.17 0.56 0.25 228323_at 38.73 3.05 4.18 9.34 8.85 1.10 5.12 13.74 5.34 5.67 ZWINT 204026_s_at 44.43 3.62 3.42 9.20 8.74 3.10 9.20 14.70 4.08 3.44 MIS12 221559_s_at 0.01 0.43 0.81 0.25 8.92 1.59 1.52 1.41 0.05 3.83 NSL1 209483_s_at 5.65 0.40 0.15 1.81 0.98 0.12 0.09 0.42 0.70 0.51 209484_s_at 4.87 0.53 0.51 1.37 4.00 1.56 1.82 0.45 1.90 3.76 230592_at 0.29 0.10 0.87 0.81 3.52 0.63 0.90 0.54 0.31 1.31 235799_at 0.43 0.09 0.45 0.07 2.28 2.93 0.34 0.83 2.87 0.48 PMF1 202337_at 5.86 2.30 3.72 0.33 0.51 2.40 0.00 6.97 0.38 5.13 KNL3 219512_at 14.65 1.43 1.28 3.67 5.02 4.92 3.76 7.22 3.94 1.89 NDC80 204162_at 28.46 3.16 3.56 5.33 6.95 2.68 6.97 15.36 8.77 10.01 SPC24 235572_at 20.13 1.79 2.81 4.01 3.21 0.39 2.75 3.03 11.63 3.85 SPC25 209891_at 34.65 1.93 2.94 4.58 4.22 1.90 2.87 15.78 7.47 2.78 NUF2 223381_at 31.63 2.91 6.65 10.62 8.28 1.88 6.00 17.42 11.67 6.77 Brain and CNS GSE6764 Lung Pancreatic Glio- ogligoden- dys- early late GSE19188 GSE31210 GSE16515 blastoma drogliomas plastic stage stage LCC ADC SCC ADC Tumor vs vs vs vs vs vs vs vs vs vs Gene Probe ID normal normal normal normal normal normal normal normal Normal Normal CENP-A 204962_s_at 13.34 5.07 0.16 3.35 13.65 24.32 18.91 42.27 8.51 6.41 210821_x_at 5.54 5.47 0.07 0.36 0.09 19.21 14.49 23.43 2.73 0.72 HJURP 218726_at 15.26 3.21 0.10 2.56 8.02 23.64 22.57 38.31 7.84 4.19 M18BP1 206500_s_at 5.74 1.29 0.10 1.77 2.00 3.65 5.68 6.72 0.44 1.62 226630_at 4.65 0.77 0.01 1.09 2.68 2.24 3.26 3.09 0.65 0.87 241816_at 5.30 0.63 0.60 1.82 1.38 3.46 3.57 6.97 0.40 1.05 244173_at 0.68 0.04 0.02 0.81 1.29 0.12 0.01 0.60 0.27 3.52 MIS18A 219004_s_at 5.88 1.37 0.64 1.42 5.19 14.42 13.88 23.43 6.17 2.35 228597_at 9.17 1.42 0.22 2.54 3.82 14.46 11.80 20.73 5.47 2.27 229671_s_at 6.30 2.27 0.17 0.13 1.64 10.45 9.52 16.44 5.55 0.21 MIS18B 213599_at 9.33 5.63 0.37 2.17 7.90 21.78 17.32 32.91 4.44 4.12 CENP-T 218148_at 1.77 0.90 1.76 0.74 3.15 0.03 0.63 0.40 0.02 0.61 CENP-W 226936_at 4.65 0.08 0.13 4.53 9.20 10.86 10.21 31.70 3.15 3.72 CENP-S 213454_at 0.67 0.28 0.83 0.30 2.77 11.49 3.84 3.64 6.57 0.32 CENP-X 209478_at 1.68 1.92 0.20 1.80 3.87 10.68 11.88 13.76 8.85 3.24 CENP-C 204739_at 1.07 0.19 0.15 0.57 1.48 2.53 4.33 2.45 0.88 2.75 CENP-N 219555_s_at 7.90 0.57 0.26 1.35 8.56 15.33 15.21 31.04 4.06 3.18 222118_at 4.82 0.30 0.03 1.08 5.35 4.85 3.00 12.01 0.74 0.46 228559_at 1.27 1.52 0.23 1.32 1.61 9.43 7.21 23.60 1.94 1.46 234811_at 2.54 1.41 0.47 0.51 0.73 1.68 0.21 1.06 0.16 1.78 CENP-M 218741_at 6.77 3.38 0.38 2.46 5.08 10.61 13.00 22.74 8.90 4.17 CENP-U 218883_s_at 15.47 7.14 0.12 4.37 10.03 13.16 15.13 23.22 7.44 6.89 229304_s_at 7.81 3.88 1.47 0.79 3.30 6.97 5.79 12.70 2.37 2.37 229305_at 8.77 3.55 1.27 0.67 2.54 12.41 8.95 19.81 4.74 2.92 CENP-H 231772_x_at 8.20 3.13 0.07 1.69 5.11 15.83 10.18 19.21 3.95 1.23 CENP-I 1555046_at 0.12 0.22 0.00 0.70 1.82 2.48 1.23 0.75 0.96 3.30 1563223a_at 1.23 0.70 0.33 1.68 1.43 1.45 0.89 0.86 0.53 2.77 207590_s_at 2.88 0.52 0.22 0.09 3.50 13.56 13.93 21.23 5.26 0.43 214804_at 6.96 2.04 0.30 0.34 6.83 14.58 14.02 30.52 3.89 2.20 CENP-L 1554271_a_at 11.16 3.79 0.47 1.31 6.83 15.96 18.96 22.31 6.30 3.26 232065_x_at 12.98 2.86 0.11 3.29 8.56 14.14 13.80 22.30 6.57 3.07 CENP-K 222848_at 17.13 3.66 0.35 2.55 8.39 14.39 16.39 19.78 6.94 7.03 CENP-O 219472_at 2.69 2.05 0.30 1.05 0.04 6.35 4.93 9.48 0.68 1.78 226118_at 4.92 1.88 0.05 1.44 4.61 16.95 10.16 18.59 1.14 2.83 CENP-Q 219294_at 5.71 4.69 0.05 0.74 5.61 10.00 4.87 5.66 0.66 1.12 CENP-R 205176_s_at 14.69 0.97 1.22 2.97 6.25 5.86 4.27 4.78 3.83 0.46 KNL1 1552680_a_at 7.99 1.84 1.41 1.82 2.77 14.73 14.03 24.03 5.33 1.66 1552682_a_at 0.92 1.94 0.09 1.37 2.35 8.81 6.42 9.34 2.26 0.69 220247_at 1.97 0.79 0.01 0.85 1.98 0.24 0.71 0.11 0.09 4.67 228323_at 14.71 6.61 0.08 2.50 2.96 16.43 17.40 29.41 7.99 5.42 ZWINT 204026_s_at 9.55 4.53 0.02 3.48 9.28 14.75 17.70 21.83 8.72 6.53 MIS12 221559_s_at 8.02 3.20 1.37 0.10 0.56 0.13 0.68 0.10 0.84 0.76 NSL1 209483_s_at 0.40 0.04 0.14 0.40 0.45 4.67 1.29 1.62 6.30 0.49 209484_s_at 3.82 3.58 0.46 6.25 7.26 10.22 6.56 5.23 6.01 1.25 230592_at 2.81 2.93 0.30 0.54 1.44 3.16 0.59 3.73 0.05 0.64 235799_at 0.62 0.47 0.10 0.10 0.31 1.78 0.28 1.13 1.07 1.64 PMF1 202337_at 7.42 7.37 2.28 3.23 11.39 4.97 5.03 0.09 6.20 3.51 KNL3 219512_at 9.53 1.47 0.95 1.62 5.64 8.30 5.97 12.44 1.22 4.61 NDC80 204162_at 27.43 10.70 0.05 6.56 11.78 16.17 15.58 27.49 4.39 5.69 SPC24 235572_at 14.29 6.71 0.37 5.78 7.97 15.80 15.17 29.58 8.76 1.65 SPC25 209891_at 7.66 5.66 0.15 2.00 7.60 22.18 13.90 28.24 5.43 2.16 NUF2 223381_at 13.94 6.85 0.41 3.79 13.32 23.72 21.31 38.00 8.13 7.02 Numbers represent −log(p value). Bold font highlight indicates >2-fold change

(132) We then investigated CEN/KT gene misregulation using TCGA RNA-seq data across different types of cancer. A recent study demonstrated a strong correlation between the FoxM1 transcription factor and kinetochore gene expression, and proposed that CEN/KT genes are simultaneously up-regulated by FoxM1 in cancers (Thiru et al., 2014). Consistent with this observation, we also detected strong correlations among many CEN/KT genes in diverse cancer types using co-expression correlation network analyses. However, the number of genes and correlation coefficients in this network vary greatly among different cancers, suggesting significantly different strength of co-expression within and between cancer types. For example, in several cancers such as bladder, cervical and uterine cancers, this sub-network contains many fewer nodes and edges than cancers such as AML, lung adenocarcinomas or lower grade brain cancers. This result suggests significant regulatory differences for CEN/KT gene expression among cancer types and/or among individuals within the same type.

(133) B. A Subset of CEN/KT Genes have Significant Prognostic Value for Survival and Metastasis in Multiple Human Cancers

(134) To determine whether CEN/KT gene misregulation has prognostic value for cancer patients, we carried out meta-analyses using CEN/KT expression data from multiple cancer GEO datasets. First, we conducted a meta-analysis of the prognostic impact of the 31 CEN/KT gene expression levels in over 3,000 human breast cancer clinical samples using Breast Cancer Gene-Expression Miner v3.0 (BC-GenExMiner 3.0) (Jezequel et al., 2013). Overexpression of 22 individual CEN/KT genes and reduced expression of CENP-C are significantly associated with poor any event (AE)-free survival (p<0.05) and poor metastatic relapse (MR)-free survival (MRFS) (p<0.05) (Table 3).

(135) TABLE-US-00003 TABLE 3 Any event-free survival and metastatic relapse- free survival of CEN/KT genes in breast cancers. Breast Cancer AEFS Breast Cancer MRFS Genes HR (95% CI) p-value HR (95% CI) p-value CENP-A 1.47 (1.31-1.66) <0.0001 1.56 (1.33-1.83) <0.0001 Overexpression HJURP 1.55 (1.37-1.76) <0.0001 1.69 (1.43-1.98) <0.0001 Overexpression M18BP1 0.96 (0.85-1.09) 0.5668 0.93 (0.80-1.09) 0.3998 MIS18A 1.34 (1.18-1.51) <0.0001 1.48 (1.26-1.74) <0.0001 Overexpression MIS18B 1.42 (1.26-1.61) <0.0001 1.51 (1.28-1.77) <0.0001 Overexpression CENP-C  0.82 (0.75-0.91)* 0.0001  0.78 (0.69-0.88)* 0.0001 Reduced expression CENP-N 1.61 (1.46-1.77) <0.0001 1.82 (1.60-2.07) <0.0001 Overexpression CENP-I 1.44 (1.28-1.63) <0.0001 1.46 (1.25-1.72) <0.0001 Overexpression CENP-H 1.27 (1.08-1.50) 0.005 1.32 (1.01-1.72) 0.0413 Overexpression CENP-T 1.02 (0.90-1.17) 0.7206 1.08 (0.91-1.28) 0.3921 CENP-W 1.95 (1.40-2.72) 0.0001 2.13 (1.41-3.19) 0.0003 Overexpression CENP-S 1.14 (0.98-1.32) 0.0899 1.10 (0.91-1.32) 0.3313 CENP-X 1.22 (1.12-1.34) 0.0001 1.20 (1.06-1.36) 0.0038 Overexpression CENP-M 1.39 (1.23-1.57) <0.0001 1.49 (1.27-1.75) <0.0001 Overexpression CENP-U 1.35 (1.19-1.52) <0.0001 1.51 (1.29-1.77) <0.0001 Overexpression CENP-L 1.44 (1.22-1.70) <0.0001 1.43 (1.15-1.79) 0.0014 Overexpression CENP-K 1.28 (1.10-1.48) 0.0012 1.34 (1.10-1.65) 0.0046 Overexpression CENP-O 1.31 (1.16-1.48) <0.0001 1.28 (1.09-1.50) 0.0024 Overexpression CENP-P 0.96 (0.79-1.16) 0.6576 0.88 (0.69-1.13) 0.3268 CENP-Q 0.99 (0.88-1.12) 0.8696 0.98 (0.84-1.15) 0.8346 CENP-R 0.96 (0.85-1.08) 0.4688 0.90 (0.77-1.05) 0.1652 KNL1 1.19 (1.08-1.32) 0.0006 1.21 (1.07-1.38) 0.0034 Overexpression ZWINT 1.51 (1.37-1.67) <0.0001 1.66 (1.46-1.89) <0.0001 Overexpression MIS12 1.14 (1.00-1.30) 0.045 1.17 (0.98-1.39) 0.0769 PMF1 0.96 (0.87-1.05) 0.3813 0.99 (0.87-1.12) 0.8274 NSL1 1.02 (0.90-1.14) 0.7956 1.03 (0.88-1.21) 0.6793 KNL3 1.26 (1.11-1.42) 0.0003 1.44 (1.23-1.70) <0.0001 Overexpression NDC80 1.32 (1.17-1.48) <0.0001 1.38 (1.18-1.62) <0.0001 Overexpression SPC24 1.54 (1.25-1.88) <0.0001 1.66 (1.20-2.30) 0.0024 Overexpression SPC25 1.32 (1.17-1.48) <0.0001 1.36 (1.16-1.59) 0.0001 Overexpression NUF2 1.32 (1.14-1.54) 0.0003 1.41 (1.13-1.76) 0.0025 Overexpression

(136) Most of the identified 22 genes with the highest hazard ratio for AE-free and MR-free survival were also isolated in the co-expression correlation network analysis using TCGA breast adenocarcinoma data. Eleven identified genes (CENP-A, HJURP, MIS18A, MIS18B, CENP-C, CENP-N, CENP-H, CENP-I, CENP-M, CENP-K, CENP-L) are required for stable assembly of nascent CENP-A at centromeres, implying an important role for centromere chromatin assembly in breast cancer progression. Notably, misexpression of nine other CEN/KT genes (CENP-T, -S, -P, -Q, -R, M18BP1, PMF1, MIS12 and NSL1) demonstrated no significant prognostic value, even though they are also important or essential components of centromeres or kinetochores. For example, only the MIS18A and MIS18B subunits of the Mis18 complex show significant prognostic values, even though the third component M18BP1 is also essential for centromere assembly. Analysis using K-M Plotter software based on a different algorithm identified most of the same genes plus several more genes (Table 4) (Gyorffy et al., 2010). We conclude that different CEN/KT genes can display distinct regulation and roles in cancer etiology, even when their functions are intimately related.

(137) TABLE-US-00004 TABLE 4 Prognostic value of CEN/KT genes for breast cancer using K-M plotter. BREAST CANCER BREAST CANCER RFS BREAST CANCER DMFS OS (n = 1115) (n = 3455) (n = 1609) HR (95% CI) p-value HR (95% CI) p-value HR (95% CI) p-value CENP-A 1.89 (1.49-2.42) 1.60E−07 1.97 (1.75-2.22) 0.00E+00 1.87 (1.52-2.3)  1.90E−09 HJURP 1.73 (1.36-2.2)  7.10E−06 1.72 (1.53-1.93) 0.00E+00 1.87 (1.52-2.29) 1.90E−09 M18BP1 1.07 (0.85-1.36) 5.50E−01  1.3 (1.16-1.46) 6.20E−06  1.3 (1.06-1.59) 1.10E−02 MIS18A 1.75 (1.38-2.23) 4.10E−06 1.16 (1.03-1.3)  1.30E−02 1.82 (1.48-2.24) 7.50E−09 MIS18B 1.89 (1.49-2.41) 1.50E−07 1.43 (1.27-1.61) 1.30E−09 1.62 (1.33-1.99) 2.50E−06 CENP-C 0.88 (0.69-1.12) 3.00E−01 0.71 (0.63-0.8)  8.10E−09 0.91 (0.74-1.11) 3.40E−01 CENP-N 1.85 (1.45-2.36) 4.90E−07 1.95 (1.73-2.19) 0.00E+00  1.8 (1.46-2.21) 1.70E−08 CENP-I 1.53 (1.2-1.94)  5.10E−04 1.45 (1.29-1.62) 3.30E−10 1.76 (1.44-2.17) 4.30E−08 CENP-H NA NA NA NA NA NA CENP-T 0.92 (0.72-1.17) 4.90E−01 0.73 (0.65-0.83) 1.70E−07 1.09 (0.89-1.33) 4.20E−01 CENP-W NA NA NA NA NA NA CENP-S HR = 1.09 (0.86- 4.70E−01  1.1 (0.98-1.24) 9.20E−02 0.92 (0.75-1.12) 4.00E−01 1.39) CENP-X 1.07 (0.84-1.36) 5.70E−01 1.39 (1.24-1.56) 2.30E−08 1.28 (1.05-1.57) 1.70E−02 CENP-M 1.55 (1.22-1.97) 3.30E−04 1.49 (1.32-1.67) 1.70E−11  1.4 (1.14-1.72) 1.00E−03 CENP-U 1.75 (1.38-2.23) 3.90E−06 1.98 (1.76-2.23) 0.00E+00 1.79 (1.46-2.2)  2.00E−08 CENP-L NA NA NA NA NA NA CENP-K NA NA NA NA NA NA CENP-O 0.92 (0.72-1.16) 4.80E−01 0.8 (0.71-0.9) 1.20E−04 0.93 (0.76-1.14) 5.10E−01 CENP-P NA NA NA NA NA NA CENP-Q 1.05 (0.83-1.33) 7.00E−01 1.14 (1.02-1.28) 2.40E−02 1.14 (0.93-1.39) 2.20E−01 CENP-R 1.06 (0.84-1.35) 6.20E−01 1.17 (1.05-1.32) 6.50E−03 0.94 (0.77-1.15) 5.80E−01 KNL1 0.98 (0.77-1.24) 8.60E−01 0.86 (0.76-0.96) 9.70E−03 0.97 (0.79-1.18) 7.40E−01 ZWINT 1.55 (1.22-1.97) 2.80E−04  1.7 (1.51-1.91) 0.00E+00 1.56 (1.27-1.91) 1.70E−05 MIS12 0.94 (0.74-1.2)  6.40E−01 1.05 (0.93-1.17) 4.40E−01 0.99 (0.81-1.21) 9.10E−01 NSL1 0.94 (0.74-1.19) 5.80E−01  1.2 (1.07-1.35) 2.20E−03 1.09 (0.89-1.34) 3.90E−01 PMF1 0.78 (0.61-0.99) 4.00E−02 0.92 (0.82-1.03) 1.50E−01 0.9 (0.73-1.1) 3.00E−01 KNL3 1.36 (1.07-1.72) 1.20E−02 1.36 (1.21-1.52) 2.30E−07 1.31 (1.07-1.61) 8.00E−03 NDC80 1.51 (1.19-1.91) 6.80E−04 1.87 (1.66-2.11) 0.00E+00 1.82 (1.48-2.24) 6.40E−09 SPC24 NA NA NA NA NA NA SPC25 1.49 (1.18-1.9)  9.40E−04 1.44 (1.28-1.61) 8.30E−10 1.55 (1.26-1.9) 2.10E−05 NUF2 NA NA NA NA NA NA

(138) OS=overall survival, RFS=relapse free survival, DMFS=distant metastasis free survival. For significant correlations, HR cell is italicized when HR>1, and HR cell is bold when HR<1 and p<0.05. NA=not applicable. NA indicates genes not included on U133A platform. For genes with more than one probe, the most sensitive probes and associated values are presented.

(139) Moreover, we investigated prognostic values of CEN/KT gene expression for overall survival and disease progression in data from >1,600 lung cancer patients, >350 gastric cancer patients, and a smaller number (n<150) of stage I and stage II ovarian cancer patients, using K-M Plotter (Gyorffy et al., 2010). We identified 20 CEN/KT genes whose misexpression is indicative of lung cancer prognosis (p<0.05) (Table 5), 23 for gastric cancer prognosis (p<0.05) (Table 6), and 20 for early stage ovarian cancers (p<0.05) (Table 7). Most CEN/KT genes for prognosis of different types of cancers overlap (Table 8). These results suggest that many CENK/T gene expression levels are effective predictors of breast, lung, gastric, and early stage ovarian cancer prognosis.

(140) TABLE-US-00005 TABLE 5 Prognostic value of CEN/KT genes for lung cancer using K-M plotter. LUNG CANCER OS (n = 1405) LUNG CANCER FP (n = 982) Genes HR (95% CI) p-value HR (95% CI) p-value CENP-A 1.57 (1.35-1.83) 5.60E−09 1.87 (1.51-2.31) 6.00E−09 HJURP 1.73 (1.49-2.02) 1.20E−12 1.96 (1.61-2.38) 6.70E−12 M18BP1 0.74 (0.63-0.86) 8.40E−05 0.61 (0.49-0.75) 3.80E−06 MIS18A 1.38 (1.18-1.61) 3.20E−05 137 (1.11-1.7)  0.0031 MIS18B 1.67 (1.43-1.94) 3.80E−11 1.81 (1.46-2.24) 3.20E−08 CENP-C 0.62 (0.53-0.72) 5.50E−10 0.5 (0.4-0.62) 1.40E−10 CENP-N 1.47 (1.27-1.72) 5.60E−07 1.62 (1.31-2.01) 6.90E−06 CENP-I 1.41 (1.21-1.64) 8.30E−06 1.73 (1.4-2.14)  3.50E−07 CENP-H NA NA NA NA CENP-T 1.34 (1.15-1.56) 1.50E−04 2.56 (1.26-1.93) 3.90E−05 CENP-W NA NA NA NA CENP-S 0.71 (0.61-0.83) 1.10E−05 0.64 (0.52-0.79) 3.60E−05 CENP-X 1.55 (1.33-1.8)  1.80E−08 2.74 (1.4-2.15)  3.00E−07 CENP-M 1.55 (1.33-1.8)  1.30E−08 1.53 (1.24-1.89) 7.50E−05 CENP-U  1.7 (1.46-1.98) 8.60E−12 1.57 (1.27-1.94) 2.60E−05 CENP-L NA NA NA NA CENP-K NA NA NA NA CENP-O 1.19 (1.02-1.38) 2.50E−02 2.52 (1.23-1.88) 8.60E−05 CENP-P NA NA NA NA CENP-Q 0.82 (0.71-0.96) 1.20E−02 0.86 (0.69-1.08) 2.00E−01 CENP-R   1 (0.86-1.17) 3.60E−01 1.1 (0.9-1.36) 3.50E−01 KNL1 0.93 (0.8-1.08)  0.12 0.77 (0.6-1)    0.05   ZWINT  1.5 (1.32-1.71) 3.20E−10 1.52 (1.16-1.99) 2.40E−03 MIS12 0.73 (0.63-0.85)  4.90E−05 0.62 (0.5-0.77)  8.70E−06 NSL1 0.68 (0.59-0.8)  9.40E−07 0.64 (0.52-0.79) 2.80E−05 PMF1 0.86 (0.76-0.97) 1.70E−02 1.01 (0.83-1.22) 9.40E−01 KNL3 1.08 (0.93-1.25) 3.30E−01 1.09 (0.88-1.34) 4.40E−01 NDC80 1.29 (1.11-1.51) 8.90E−04 1.21 (0.98-1.5)  7.10E−02 SPC24 NA NA NA NA SPC25 1.69 (1.45-1.97) 1.30E−11 1.99 (1.61-2.47) 1.40E−10 NUF2 NA NA NA NA

(141) OS=overall survival, RFS=relapse free survival, DMFS=distant metastasis free survival. For significant correlations, HR cell is italicized when HR>1 and p<0.05, and HR cell is bold when HR<1 and p<0.05. NA=not applicable. NA indicates genes not included on U133A platform. For genes with more than one probe, the most sensitive probes and associated values are presented.

(142) TABLE-US-00006 TABLE 6 Prognostic value of CEN/KT genes for gastric cancer using K-M plotter. GASTRIC CANCER OS (n = 593) GASTRIC CANCER FP (n = 359) Genes HR (95% CI) p-value HR (95% CI) p-value CENP-A  1.5 (1.23-1.82) 5.90E−05 1.86 (1.45-2.37) 5.00E−07 HJURP  1.7 (1.36-2.12) 2.60E−06 2.23 (1.74-2.86) 7.20E−11 M18BP1 1.18 (0.95-1.47) 1.40E−01 0.73 (0.56-0.96) 2.50E−02 MIS18A 1.29 (1.04-1.6)  1.90E−02 1.33 (1.04-1.7)  0.024 MIS18B 1.28 (1.05-1.56) 1.50E−02 1.55 (1.18-2.03) 1.50E−03 CENP-C 0.78 (0.64-0.96) 1.80E−02  0.8 (0.63-1.03) 8.40E−02 CENP-N 1.54 (1.26-1.89) 2.90E−05 2.06 (1.53-2.76) 8.80E−07 CENP-I 1.52 (1.25-1.84) 2.20E−05 1.75 (1.36-2.24) 7.70E−06 CENP-H NA NA NA NA CENP-T 1.15 (0.95-1.39) 1.60E−01 1.61 (1.25-2.08) 2.00E−04 CENP-W NA NA NA NA CENP-S 1.44 (1.16-1.78) 1.00E−03 1.37 (1.07-1.75) 1.20E−02 CENP-X 0.67 (0.54-0.84) 3.00E−04 0.56 (0.43-0.74) 2.70E−05 CENP-M 1.38 (1.1-1.73)  5.60E−03 1.51 (1.18-1.93) 9.50E−04 CENP-U 1.48 (1.19-1.85) 4.40E−04 1.59 (1.22-2.06) 4.60E−04 CENP-L NA NA NA NA CENP-K NA NA NA NA CENP-O 1.16 (0.94-1.43) 1.60E−01 1.53 (1.2-1.96)  5.90E−04 CENP-P NA NA NA NA CENP-Q 1.59 (1.29-1.96) 1.30E−05 1.52 (1.14-2.02) 4.20E−03 CENP-R 1.43 (1.16-1.77) 7.50E−04 1.66 (1.29-2.13) 6.80E−05 KNL1 0.82 (0.66-1.01) 6.60E−02  0.8 (0.61-1.05) 1.10E−01 ZWINT 1.39 (1.13-1.72) 1.80E−03 1.56 (1.22-2)   3.00E−04 MIS12 1.28 (1.04-1.57) 1.80E−02 1.33 (1.02-1.74) 3.70E−02 NSL1 0.88 (0.71-1.08) 2.20E−01 0.74 (0.57-0.95) 1.70E−02 PMF1 0.82 (0.67-1)   5.20E−02 0.71 (0.55-0.91) 6.70E−03 KNL3 1.24 (1.02-1.5)  3.00E−02 1.35 (1.05-1.75) 2.10E−02 NDC80 1.54 (1.26-1.89) 2.10E−05 1.88 (1.44-2.45) 2.00E−06 SPC24 NA NA NA NA SPC25 1.45 (1.19-1.77) 2.10E−04 1.94 (1.45-2.58) 4.60E−06 NUF2 NA NA NA NA

(143) OS=overall survival, FP=first progression. NA indicates that probes corresponding to the gene did not pass the qualifier filter. For significant correlations, HR cell is italicized when HR>1 and p<0.05 and HR cell is bold when HR<1 and p<0.05.

(144) TABLE-US-00007 TABLE 7 Prognostic value of CEN/KT genes for stages 1 and 2 combined ovarian cancer using K-M plotter. OVARIAN CANCER OS (n = 133) OVARIAN CANCER PFS (n = 126) Genes HR (95% CI) p-value HR (95% CI) p-value CENP-A  9.2 (1.24-68.13) 8.20E−0317.24 (2.37-125.29) 1.10E−04 HJURP  5.17 (1.54-17.35) 3.00E−03 3.12 (1.7-5.73)  1.10E−04 M18BP1 3.65 (1.37-9.75) 5.60E−03 3.03 (1.28-7.16) 8.10E−03 MIS18A  7.59 (1.03-56.14) 1.90E−02 3.24 (1.71-6.13) 1.30E−04 MIS18B  4.78 (1.13-20.28) 1.90E−024.63 (1.65-12.95) 1.30E−03 CENP-C 0.43 (0.19-0.96) 3.40E−02 3.34 (1.84-6.06) 2.70E−05 CENP-N  5.17 (1.54-17.29) 3.00E−03 2.36 (1-5.6)    4.40E−02 CENP-I  3.85 (1.15-12.88) 1.80E−024.13 (1.63-10.51) 1.20E−03 CENP-H NA NA NA NA CENP-T 1.49 (0.66-3.38) 3.40E−01 1.35 (0.71-2.55) 3.60E−01 CENP-W NA NA NA NA CENP-S 1.49 (0.66-3.33) 3.30E−01 1.81 (0.99-3.3)  4.90E−02 CENP-X 1.84 (0.83-4.11) 1.30E−01 0.49 (0.25-0.95) 3.10E−02 CENP-M 4.36 (1.3-14.59) 9.20E−03 2.96 (1.37-6.38) 3.80E−03 CENP-U  4.94 (1.16-20.97) 1.60E−02 1.93 (1.06-3.5)  2.90E−02 CENP-L NA NA NA NA CENP-K NA NA NA NA CENP-O 1.97 (0.89-4.35) 8.80E−02 0.73 (0.39-1.37) 3.30E−01 CENP-P NA NA NA NA CENP-Q 1.92 (0.86-4.28) 1.10E−01 1.88 (1.02-3.46) 3.80E−02 CENP-R 0.38 (0.13-1.11) 6.60E−02 1.33 (0.74-2.41) 3.40E−01 KNL1 1.66 (0.69-3.97) 2.50E−01 0.47 (0.23-0.93) 2.60E−02 ZWINT 2.6 (1.14-5.9) 1.80E−02 4.03 (2.02-8)   1.80E−05 MIS12  3.79 (1.13-12.71) 2.00E−02 1.83 (0.98-3.42) 5.40E−02 NSL1 3.21 (1.27-8.07) 9.10E−03 3.83 (2.07-7.08) 4.60E−06 PMF1 3.36 (1.44-7.84) 2.90E−03 2.86 (1.57-5.19) 3.20E−04 KNL3  4.16 (1.53-11.29) 2.60E−03 3.92 (2-7.68)   2.00E−05 NDC80  5.15 (2.03-13.09) 1.40E−04 3.94 (1.99-7.78) 2.40E−05 SPC24 NA NA NA NA SPC25 2.98 (1.24-7.16) 1.00E−024.17 (1.63-10.63) 1.20E−03 NUF2 NA NA NA NA

(145) OS=overall survival, PFS=progression-free survival. NA indicates that probes corresponding to the gene did not pass the qualifier filter. For significant correlations, HR cell is italicized when HR>1 and p<0.05, and HR cell is bold when HR<1 and p<0.05.

(146) TABLE-US-00008 TABLE 8 Comparison of different gene lists from the tables above. lung Cancer breast cancer breast cancer (K-M gastric cancer CES Genes (GenExMiner) (K-M plotter) Plotter) (K-M Plotter) differential Genes CENP-A X X X X X yes HJURP X X X X X yes M18BP1 X # # MIS18A X X X X MIS18B X X X X X yes CENP-C # # # # CENP-N X X X X X yes CENP-I X X X X CENP-H X NA NA NA CENP-T X X X CENP-W X NA NA NA X yes CENP-S # X CENP-X X X X # CENP-M X X X X X yes CENP-U X X X X X yes CENP-L X NA NA NA X yes CENP-K X NA NA NA X yes CENP-O X # X X CENP-P NA NA NA CENP-Q X # X CENP-R # X KNL1 X X X ZWINT X X X X X yes MIS12 # X NSL1 X # # PMF1 # # # KNL3 X X X NDC80 X X X X X yes SPC24 X NA NA NA X yes SPC25 X X X X X yes NUF2 X NA NA NA X yes NA = Not applicable. “X” indicate overexpression. “#” indicates reduced expression.

(147) C. Centromere and Kinetochore Gene Expression Score (CES) is Indicative of the Level of Genomic Instability for Many Cancers

(148) We compared the gene lists obtained using different approaches and identified 14 CEN/KT genes in common (FIG. 2 and Table 8). The shared gene list contains 7 genes involved in CENP-A assembly and all 4 components of the NDC80 complex, but no MIS12 complex members. Based on the overlap, we consider misregulation of these 14 CEN/KT genes as the core subset that provides effective prognostic signatures for cancer progression and patient outcome for various cancer types (Table 9 and FIG. 2). Since individual genes in the list demonstrate overexpression in cancer samples, we propose that overall misregulation of the pathway and the extent can be represented by the sum of the individual gene expression levels rather than any single gene. We therefore defined the centromere and kinetochore gene expression score (CES) in a given sample as the sum of the log.sub.2(mRNA level) for the 14 CEN/KT genes.

(149) TABLE-US-00009 TABLE 9 List of CES Genes CES Genes CENP-A centromere HJURP MIS18B Mis18 CENP-N inner CENP-M kinetochore CENP-W CENP-U CENP-L CENP-K ZWINT outer NDC80 kinetochore NUF2 SPC24 SPC25

(150) Proper centromere and kinetochore function ensures faithful chromosome segregation and genome stability. We investigated whether CEN/KT gene misregulation is correlated with the extent of genome instability in cancer samples. TCGA datasets were used to compare CES values to the fraction of cancer genomes with CNA and mutation frequencies (Table 10). For many cancer types, including breast, low-grade brain gliomas and stomach adenocarcinomas, we detected a significant positive correlation between CES values and both CNA fractions and mutation frequencies (Spearman's rho, p<0.05, student-t test). For some cancers, such as lung adenocarcinomas, adrenocortical carcinomas, colorectal carcinomas, kidney renal clear cell (RCC) carcinomas, kidney renal papillary cell (RPC) carcinomas and ovarian serus cystadenocarcinomas, we only detected a significant correlation between CES values and either CNA fraction or mutation frequency. We observed no correlation for many cancers, such as cervical squamous cell carcinomas, glioblastomas and thyroid carcinomas. Overall, we conclude that there is significant correlation between CES values and the level of genome instability in multiple cancer types in TCGA datasets.

(151) TABLE-US-00010 TABLE 10 Spearman's correlation cofficient between CES values and mutation frequencies and copy number alteration across TCGA datasets. Mutation frequency Copy Number Alteration Spearman's Spearman's Cancer Types rho p-value N rho p-value N Adrenocortical Cancinoma 0.468 3.34E−06 72 0.046 0.703 72 Bladder Urothelial Carcinoma 0.240 6.23E−03 129 0.244 3.36E−08 353 Lower Grade Glioma 0.323 4.75E−08 273 0.483 1.51E−30 499 Breast adenocarcinoma 0.443 3.69E−48 975 0.539 3.40E−82 1076 Cervical Squamous Cell Carcinoma and 0.095 0.191 191 0.091 0.155 244 Endocervical Adenocarcinoma Colectoral Carcinoma 0.145 0.05 182 −0.031 0.674 182 Glioblastoma 0.090 0.28 147 0.128 0.12 148 Head&Neck SCC 0.124 0.031 304 0.208 3.15E−06 494 Kidney RCC 0.036 0.466 410 0.179 4.70E−05 513 Kidney RPC 0.049 0.542 121 0.182 2.35E−03 276 Lung ADC 0.338 6.33E−06 171 0.290 7.51E−11 485 Lung SCC 0.236 1.53E−03 178 0.509 3.56E−34 498 Ovarian Serous Cystadenocarcinoma 0.071 0.368 161 0.133 0.031 262 Prostate Adenocarcinoma 0.349 1.60E−08 248 0.487 1.38E−29 474 Skin cutaneous melanoma 0.196 2.73E−04 339 0.066 0.152 468 Stomach adenocarcinoma 0.386 2.04E−08 198 0.377 2.76E−10 262 Thyroid carcinoma 0.056 0.273 391 0.036 0.427 489 Uterine Carcinosarcoma 0.432 8.97E−04 56 0.263 0.05 56 Significant (p <0.05) two tailed p-values for Spearman's coefficient correlation are highlighted by bold font.

(152) D. CES is Prognostic for Cancer Patient Overall Survival, Relapse and Distant Metastasis

(153) We evaluated the CES system for prognosis of cancer patient survival using breast and lung cancer microarray datasets. We split patients for each test GEO dataset into high, medium and low CES groups by dividing the full CES range of a dataset into tertiles. Kaplan-Meier survival curves demonstrated that the CES system effectively predicts overall survival (OS) and disease-free survival (DFS) for breast and lung cancer datasets. In general, patients with lower CES values have significantly better prognosis for both OS (FIG. 3A) and DFS (FIG. 3B). Notably, for lung cancer dataset GSE19188, patients in both the high and low CES groups show significantly better DFS than those with medium CES, which is possibly due to better response of high CES patients to adjuvant treatments (Botling et al., 2013) (see below). We also determined prognostic value of the CES for breast cancer distant metastasis-free survival (DMFS) using dataset GSE6532 (Loi, 2007). Kaplan-Meier curves showed that high CES patients have significantly worse DMFS (p=1.21E-05, FIG. 3C) than those with low CES.

(154) To better understand the impact of CEN/KT gene misregulation on cancer progression, we analyzed breast cancer data with clinicopathological information. ER− tumors tend to be more aggressive, and positive lymph nodes indicate cancer invasion. We find that high CES values significantly correlate with advanced tumor grade and negative ER status (p<0.05), but have no significant correlation with patient age, tumor size, lymph node status or tumor stage (data not shown). Moreover, we found significant correlations between misregulation of many CEN/KT genes and poor AE-free and MR-free survival for ER+breast cancer patients regardless of lymph node status (Table 11, p<0.05). These analyses suggest that CEN/KT gene misexpression can predict patient survival and disease progression for pathologically classified breast cancers.

(155) TABLE-US-00011 TABLE 11 Prognostic value of individual CEN/KT genes for breast cancers with clinicopathological information. p-value AE-free survival p-value MR-free survival Gene N+, N+, N−, N+, N+, N−, name ER+ N−, ER+ ER− ER− ER+ N−, ER+ ER− ER− CENP-A 0.0407 <0.0001 0.247 0.245 0.1092 <0.0001 0.0423 0.196 HJURP 0.0001 <0.0001 0.7176 0.534 0.0022 <0.0001 0.3109 0.676 M18BP1 0.8638 0.8429 0.0822 0.523 0.9256 0.5233 0.1423 0.695 MIS18A 0.0246 0.2008 0.0823 0.103 0.0899 0.0343 0.2567 0.441 MIS18B 0.0173 0.0001 0.07 0.334 0.0486 0.0003 0.0151 0.534 CENP-C 0.6629 0.0966 0.2412 0.346 0.4351 0.0036 0.4788 0.042 CENP-N 0.0601 <0.0001 0.5045 0.441 0.4172 <0.0001 0.2694 0.813 CENP-I 0.0029 0.0002 0.4031 0.881 0.0465 0.0034 0.6094 0.937 CENP-H 0.0417 0.7757 0.87 0.751 0.1094 0.1989 0.6952 0.765 CENP-T 0.5857 0.1209 0.0525 0.748 0.2311 0.2491 0.2937 0.98 CENP-W 0.2808 0.0054 0.1119 0.929 0.0779 0.0045 0.0668 0.756 CENP-S 0.7168 0.1122 0.6003 0.499 0.4346 0.3601 0.6644 0.865 CENP-X 0.0502 0.0036 0.9954 0.527 0.0155 0.0421 0.2276 0.58 CENP-M 0.0077 0.0003 0.6798 0.551 0.0071 0.0005 0.322 0.721 CENP-U 0.1553 0.0007 0.9789 0.941 0.0134 0.0001 0.7316 0.227 CENP-L 0.0179 0.403 0.8631 0.11 0.1092 0.5438 0.7616 0.996 CENP-K 0.6084 0.1594 0.5005 0.645 0.6674 0.5904 0.3571 0.736 CENP-O 0.0059 0.1174 0.5991 0.452 0.0426 0.5381 0.2694 0.908 CENP-P 0.8499 0.4767 0.2822 0.246 0.8073 0.1364 0.6465 0.246 CENP-Q 0.4007 0.8576 0.1232 0.782 0.4123 0.2321 0.3785 0.459 CENP-R 0.6737 0.6343 0.5745 0.99 0.2943 0.4 0.1213 0.999 KNL1 0.0332 0.2529 0.5922 0.336 0.0035 0.3585 0.4865 0.165 MIS12 0.2789 0.0833 0.386 0.475 0.0949 0.3634 0.9375 0.099 NSL1 0.3705 0.2677 0.445 0.046 0.7039 0.4334 0.581 0.03 KNL3 0.0457 0.0044 0.1049 0.973 0.0031 0.0036 0.9868 0.51 NDC80 0.0967 0.0005 0.4815 0.817 0.0873 0.0072 0.8999 0.615 SPC24 0.1865 0.0016 0.2107 0.726 0.0753 0.8263 0.9996 0.939 SPC25 0.0193 <0.0001 0.2205 0.76 0.0551 0.0003 0.3055 0.953 NUF2 0.0409 0.1901 0.3714 0.957 0.0767 0.5886 0.5009 0.687

(156) Breast cancers also can be divided into subtypes based on gene expression signatures (Parker et al., 2009). Basal-like, HER2+(both usually ER−) and luminal B (ER+) subtypes tumors are more aggressive than luminal A (ER+) and normal-like. We observe that more aggressive molecular subtypes associate with higher average CES values (p<0.05). Using BC GenExMiner software, we found that 17 CEN/KT genes display higher expression in basal-like, HER2+ and luminal B breast cancers, compared to normal-like and luminal A tumors, with several showing significant (p<0.05) correlation with poor AE-free survival within normal breast-like, luminal A and luminal B subtype tumors (Table 12). These results indicate that CEN/KT misregulation varies among different breast cancer subtypes.

(157) TABLE-US-00012 TABLE 12 Prognostic value of individual CEN/KT genes for breast cancers with subtype information. BC Subtype Luminal A Luminal B Normal Basal-like HER2+ AE-free AE-free breast-like AE-free AE-free survival survival AE-free Gene survival survival HR HR survival name HR (95% CI) p-value HR (95% CI) p-value (95% CI) p-value (95% CI) p-value HR (95% CI) p-value CENP-A 0.98 (0.73-1.32) 0.9081  .89 (0.66-1.19) 0.4214 1.24 (0.93-1.65) 0.1461 1.40 (1.09- 0.0075 1.59 (1.06- 0.026 1.80) 2.39) HJURP 1.01 (0.76-1.33) 0.9705 0.84 (0.61-1.14) 0.2553 1.37 (1.03-1.83) 0.0323 1.41 (1.10- 0.0073 1.96 (1.32- 0.0008 1.81) 2.90) M18BP1 0.93 (0.71-1.23) 0.6235 0.86 (0.63-1.17) 0.3444 1.27 (0.96-1.67) 0.0978 0.66 (0.51- 0.0015 0.96 (0.66- 0.8147 0.85) 1.39) MIS18A 1.14 (0.86-1.52) 0.3598 1.09 (0.80-1.50) 0.5719 1.12 (0.84-1.48) 0.4436 1.19 (0.93- 0.161 1.15 (0.79- 0.4585 1.53) 1.69) MIS18B 1.11 (0.84-1.48) 0.4577 0.94 (0.70-1.28) 0.7108 1.38 (1.03-1.85) 0.0289 1.35 (1.06- 0.0159 1.13 (0.76- 0.5476 1.73) 1.68) CENP-T 1.25 (0.92-1.70) 0.1539 0.98 (0.70-1.37) 0.9037 0.79 (0.59-1.06) 0.1166 0.86 (0.65- 0.2667 0.91 (0.60- 0.635 1.13) 1.36) CENP-W 0.68 (0.33-1.42) 0.3088 1.40 (0.67-2.90) 0.3678 0.98 (0.40-2.38) 0.9667 1.15 (0.63- 0.6425 1.09 (0.40- 0.8626 2.09) 2.97) CENP-S 0.80 (0.57-1.13) 0.2034 1.16 (0.80-1.66) 0.4354 1.13 (0.82-1.55) 0.4668 0.95 (0.71- 0.7359 0.76 (0.46- 0.2829 1.27) 1.26) CENP-X 1.03 (0.77-1.36) 0.8553 0.91 (0.68-1.23) 0.5469 1.10 (0.83-1.46) 0.512 1.25 (0.98- 0.0762 1.12 (0.77- 0.5596 1.60) 1.64) CENP-C 1.24 (0.95-1.64) 0.1179 0.88 (0.65-1.18) 0.3905 0.89 (0.67-1.18) 0.4287 0.79 (0.62- 0.0636 1.11 (0.77- 0.5851 1.01) 1.59) CENP-N 0.90 (0.67-1.20) 0.4716 1.04 (0.76-1.43) 0.8006 1.26 (0.94-1.69) 0.1267 1.48 (1.15- 0.0027 1.00 (0.67- 0.9804 1.92) 1.47) CENP-M 1.00 (0.75-1.33) 0.991 1.18 (0.86-1.61) 0.3101 1.11 (0.83-1.49) 0.4707 1.37 (1.06- 0.015 1.26 (0.85- 0.2473 1.76) 1.88) CENP-U 1.03 (0.77-1.36) 0.8564 0.99 (0.72-1.36) 0.941 1.15 (0.87-1.53) 0.3226 1.22 (0.95- 0.1213 1.28 (0.87- 0.2132 1.58) 1.90) CENP-H 1.13 (0.73-1.76) 0.5861 0.98 (0.65-1.47) 0.9058 1.38 (0.93-2.04) 0.1082 1.03 (0.73- 0.8652 1.27 (0.79- 0.3308 1.46) 2.03) CENP-I 1.07 (0.81-1.41) 0.6476 1.24 (0.92-1.65) 0.1538 1.54 (1.16-2.03) 0.0028 1.16 (0.91- 0.2249 1.30 (0.89- 0.171 1.48) 1.89) CENP-L 1.05 (0.71-1.56) 0.7951 1.01 (0.68-1.50) 0.9466 1.52 (1.04-2.22) 0.0299 1.23 (0.89- 0.2055 1.39 (0.83- 0.2123 1.71) 2.32) CENP-K 1.30 (0.86-1.95) 0.2097 0.96 (0.65-1.41) 0.8263 1.53 (1.05-2.24) 0.0276 0.94 (0.69- 0.6992 1.21 (0.77- 0.4082 1.28) 1.88) CENP-O 0.94 (0.71-1.25) 0.6862 1.08 (0.78-1.48) 0.655 1.01 (0.76-1.34) 0.9583 1.35 (1.05- 0.0175 1.41 (0.96- 0.0777 1.74) 2.06) CENP-P 0.83 (0.51-1.36) 0.4675 0.93 (0.60-1.45) 0.7648 1.09 (0.68-1.73) 0.7246 0.93 (0.65- 0.6902 1.58 (0.86- 0.1387 1.33) 2.88) CENP-Q 0.80 (0.60-1.07) 0.1273 0.81 (0.59-1.10) 0.1803 1.01 (0.76-1.34) 0.9339 0.95 (0.74- 0.6922 0.83 (0.56- 0.3252 1.22) 1.21) CENP-R 0.95 (0.73-1.24) 0.6977 0.87 (0.65-1.16) 0.3527 1.11 (0.85-1.46) 0.4483 0.88 (0.69- 0.2892 0.74 (0.50- 0.1097 1.12) 1.07) KNL1 0.77 (0.58-1.04) 0.0896 0.72 (0.52-1.00) 0.0508 1.25 (0.93-1.68) 0.1357 0.95 (0.74- 0.7076 1.13 (0.76- 0.5546 1.23) 1.68) MIS12 0.96 (0.72-1.29) 0.8007 1.25 (0.89-1.76) 0.1938 1.22 (0.91-1.64) 0.1814 1.02 (0.78- 0.904 1.21 (0.81- 0.3432 1.33) 1.80) NSL1 1.12 (0.86-1.47) 0.4023 0.94 (0.70-1.26) 0.6779 1.02 (0.78-1.34) 0.8801 0.98 (0.77- 0.8407 0.91 (0.63- 0.6015 1.24) 1.31) KNL3 0.96 (0.73-1.27) 0.7981 0.82 (0.60-1.12) 0.2116 1.21 (0.91-1.61) 0.1895 1.16 (0.90- 0.2504 0.94 (0.63- 0.7496 1.49) 1.39) NDC80 0.93 (0.70-1.22) 0.591 1.15 (0.85-1.56) 0.355 1.04 (0.79-1.37) 0.7725 0.98 (0.77- 0.8681 1.13 (0.77- 0.5474 1.25) 1.65) SPC24 0.81 (0.45-1.48) 0.4995 1.20 (0.74-1.93) 0.4646 1.63 (1.00-2.63) 0.0478 1.25 (0.85- 0.2578 1.86 (1.01- 0.0466 1.84) 3.42) SPC25 1.07 (0.81-1.40) 0.6358 0.92 (0.68-1.24) 0.5797 0.97 (0.73-1.29) 0.8357 1.22 (0.96- 0.1115 1.49 (1.00- 0.051 1.56) 2.22) NUF2 0.84 (0.57-1.23) 0.3732 0.95 (0.66-1.39) 0.8041 1.45 (1.00-2.11) 0.0507 1.24 (0.91- 0.1728 1.18 (0.73- 0.4893 1.69) 1.91) Table indicates hazard ratio (HR) and associated p values for each CEN/KT gene for AE-free survival for different breast cancer subtypes. HR and p-values with significant prognostic value (p < 0.05) for breast cancer subtypes are in bold.

(158) Finally, to confirm and extend the observed prognostic value for the CES system, we performed meta-analysis on breast, lung, gastric, and ovarian cancer patients using K-M Plotter (FIGS. 3D-3F). For breast cancers, we focused on ER+ intrinsic subtypes. High CES values effectively predict poor patient survival for both luminal A and B tumors. Within basal-like and HER2+ subtypes, we observed opposite correlation between CES values and OS and DMFS, which may be due to sensitivity of high CES tumors to therapies and/or the detrimental effects of very high levels of CIN on cancer cell fitness (see below). In addition, meta-analysis shows that the CES system effectively predicts patient survival for lung, gastric and early stage ovarian cancer patients (FIGS. 3D and 3E). Notably, our results suggest that the CES system predicts patient survival for stage I lung adenocarcinomas. Taken together, the analysis suggests that the CES can be useful for predicting patient survival, relapse and metastasis for multiple cancer types.

(159) E. CES Predicts Sensitivity to DNA Damaging Agents and Patient Response to Adjuvant Chemotherapy Therapy

(160) The strong association between high CES values and genomic instability predicts that high CES cancer cells are under genotoxic stress and thus will be more sensitive to additional DNA damage. We mined the Cancer Cell Line Encyclopedia (CCLE) data, which contains information on both drug treatment and gene expression (Barretina et al., 2012). CCLE cell lines were binned into quartiles according to their CES values, we compared the top and bottom CES quartiles for the IC50 of the Topo I inhibitors and DNA damaging agents irinotecan and topotecan. Notably, cancer cell lines in the top CES quartile display significantly lower IC50s than those in the bottom quartile (p=2.19E0-8 for irinotecan and p=1.71E-06 for topotecan, respectively, student-t test) (FIGS. 4A, 5A and 5B). Consistently, cell line CES values and IC50 of Topo I inhibitors are inversely correlated with strong significance (Spearman's rho, r=−0.3836, p<0.000001 for irinotecan and r=−0.3394, p<0.000001 for topotecan, respectively) (Table 12). Moreover, we detected significant correlation between cell line CES and IC50s for irinotecan and topotecan for several cancer types after breaking down the cell lines according to their tissue of origin. We conclude that high CES cancer cell lines are more sensitive to Topo I inhibitors compared to low CES lines.

(161) TABLE-US-00013 TABLE 13 Correlation between irinotecan and topotecan IC50 and CES value in CCLE cell lines. Irinotecan topotecan Spearman's student-t Spearman's student-t (p- CCLE cell lines rho (p-value) n rho value) n breast −0.6441 0.007 16 −0.2468 0.281 21 lung −0.4186 0.005 44 −0.4252 0.0001 77 ovary −0.6226 0.003 20 −0.4685 0.018 25 haematopoietic and −0.3439 0.017 48 −0.092 0.468 65 lymphoid skin 0.2 0.327 26 −0.1634 0.364 33 CNS −0.2034 0.436 17 −0.1255 0.568 23 pancreas −0.4387 0.078 17 −0.1429 0.536 21 Overall pool −0.3836 <.000001 277 −0.3394 <.000001 412

(162) We then used the JBR.10 clinical trial dataset (GSE14814) to determine if early stage non-small cell lung cancers (NSCLC) with high CES values are more sensitive to adjuvant chemotherapy (FIG. 4B). In this prospective clinical trial, post-surgery early stage NSCLC patients were randomly assigned for adjuvant chemotherapy (ACT) including cisplatin, which causes DNA damage and promotes apoptosis, and vinorelbine, which inhibits mitosis through interactions with tubulin, or with no treatment (OBS) (Zhu et al., 2010). We divided patients into CES high (top tertile) and low (lower two tertiles) groups. For the OBS group, high CES predicts poor OS compared to low CES (HR=2.728, p=0.017), validating the prognosis power of the CES system (FIG. 6A). ACT effectively negated the adverse effect associated with high CES (HR=0.710, p=0.402), suggesting prediction power of the CES system for chemo-sensitivity (FIG. 6B). Indeed, ACT significantly improved overall survival for high CES patients compared to OBS (HR=0.391, log-rank p=0.035) (FIG. 4B, left). This effect is specific for the high CES group because there is no significant benefit associated with ACT for the low CES group (HR=1.318, log-rank p=0.431) (FIG. 4B, right). We also examined the UT lung SPORE NSCLC dataset (GSE41274) (Tang et al., 2013) (FIG. 4C). Post-surgery patients in this dataset were either treated with ACT including cisplatin and mainly taxanes, or received no treatment (OBS). We observed a similar trend for ACT on high CES patients without statistical significance (HR.233, log-rank p=0.110) possibly due to small sample size and relatively short follow-up time for ACT patients (FIG. 6B). Therefore, we performed meta-analysis combining the two datasets (FIG. 4C), and our results showed that ACT significantly improved poor OS associated with high CES in early stage NSCLC (HR.432, p=0.016) using the meta-dataset (FIG. 4C, left). Again this power is specific for the high CES group because ACT showed no such impact for low CES group (HR=1.075, p=0.783) (FIG. 4C, right). Importantly, meta-analysis showed that ACT specifically improved 5-year survival for the high CES group (81.5% for ACT versus 47.3% for OBS, p=0.002) but not for the low CES group (74.4% for ACT versus 68.4% for OBS, p=0.347). Taken together, our results suggest that the CES system is useful in predicting patient sensitivity to adjuvant chemotherapy, including cisplatin for NSCLC.

(163) To address small sample sizes in individual datasets when predicting drug sensitivity, we performed meta-analysis on chemo-sensitivity for several cancer types using K-M Plotter. For NSCLC, the CES showed prediction value in chemo-sensitivity for both OS and risk of first progression (FP) (FIGS. 7A and 7B). For breast cancers, we focused on ER+ tumors because many patients suffer from relapse sometime after endocrine therapy with unclear causes. For systematically untreated patients with ER+ tumors, high CES values are associated with significantly poor relapse-free survival (RFS) as expected (HR=1.83, p=4.3E-05) (FIG. 7C). Chemotherapy with or without hormone therapy (HR=1.14, p=0.67), but not tamoxifen alone (HR=1.80, p=4E-11), effectively reduced hazard ratio associated with high CES, implying contribution of CIN to relapse in ER+ breast cancer patients after hormone therapy. For gastric cancers, no significant prediction power was detected for sensitivity to 5-FU (FIG. 7D). For ovarian cancers, most patients had late stage tumors, for which CES does not significantly predict patient OS (HR=1.09, p=0.29). Nevertheless, both platin and topotecan reduced hazards associated with high CES (FIG. 7E), and topotecan (HR.63, p=0.029) showed some superiority to platin (HR=0.85, p=0.075). We noted that in CCLE ovarian cancer cell lines, high CES value also correlates with increased topotecan sensitivity (Spearman's rho, r=−0.469, p=0.018) (Table 13). These results suggest that the CES system may be useful to predict patient sensitivity to adjuvant chemotherapy for multiple cancer types.

(164) F. CES Predicts Patient Response to Radiation Therapy in Breast and Lung Cancers

(165) In light of the results on drug sensitivity, we reasoned that if centromere misregulation is a shared important property among different cancer types, the CES system may be also predictive for radiation therapy (RT) that damages DNA and causes apoptosis. We determined whether the CES correlates with cancer patient outcome following RT. Using a breast cancer dataset, we found that upon RT, patients with high CES values displayed both improved overall survival (HR.279, p=0.008) and disease-free survival (HR=0.254, p=0.016) compared to without RT. In contrast, there was no survival benefit associated with RT for patients in the low CES group (HR=1.309, p=0.58 for OS and HR=0.950, p=0.98 for DFS) (FIG. 4E). For the patient group with intermediate CES values, we observed intermediate HR although the correlation was not significant (HR=0.370, p=0.085 for OS, and HR=0.389, p=0.16 for DFS, respectively). Further analyses suggest that the association between RT and better prognosis was specific for the patient group with high CES (FIGS. 8A-8D). We then performed meta-analysis on lung cancer data using K-M Plotter and the results are consistent with the results in breast cancers (FIGS. 7A and 7B). Our analyses suggest that the CES system effectively predicts cancer patient sensitivity to RT as well as chemotherapy.

(166) Discussion

(167) In this study, using a hypothesis-driven approach focused on a specific cellular structure regulating chromosome segregation, we identified a subset of 14 CEN/KT genes whose overexpression is a shared property of and is prognostic for a wide spectrum of human cancers (Table 9). We defined the CES as the sum of the mRNA expression levels for the fourteen genes. We show that the CES value is prognostic for overall survival, cancer relapse and disease progression in several cancer types. It is also prognostic for breast cancer luminal subtypes and early stage NSCLCs. Moreover, the CES forecasts sensitivity to DNA damaging compounds in cancer cell lines and patient datasets, and patient sensitivity to radiotherapy. Importantly, the CES value is significantly correlated with the levels of CNA and mutation frequencies for many cancer types. This result is consistent with numerous basic research studies in cell lines and model organisms showing that misregulation of centromere and kinetochore structure causes chromosome missegregation and rearrangements and contributes to CIN (Allshire and Karpen, 2008; Black et al., 2010). For example, misregulation of CES genes including CENP-A and HJURP causes defective chromosome segregation. Such severe defects may cause chromosome bridging and micronuclei (Mishra et al., 2011), which in turn lead to structural aberrations and DNA damage (Janssen et al., 2011). This idea is further supported by the fact that 50% of the CES genes are involved in assembly of CENP-A nucleosomes, which is the structural foundation for centromere function and propagation, and kinetochore formation in mitosis. These proteins together comprise an epigenetic pathway for replenishing centromeric CENP-A nucleosomes through each cell cycle. Surprisingly, none of the essential MIS12 complex members passed our significance threshold for inclusion in the CES gene list. The results suggest that misregulation of centromere and kinetochore, especially the process of centromere replenishment, is a key mechanism of CIN and genomic instability in many cancers. The genomic defects contribute to cancer progression on one hand, but also appear to be a burden when passing certain threshold on the other as evidenced by sensitivity to further DNA damage.

(168) We have demonstrated that the CES system represents a novel biomarker that effectively predicts the level of genomic instability, patient survival, and the impact of DNA damaging therapies for many cancers. Our results indicate that variation among individual tumors within the same cancer type not only predicts cancer patient survival and disease progression, but also forecasts sensitivity to several DNA damaging agents in cancer cell lines, patient outcome after adjuvant radiotherapy, or adjuvant chemotherapy including specific DNA damaging compounds such as cisplatin. Specific association of improved patient survival after RT or chemotherapy with high CES values suggests that the CES system is useful in identifying patients at high risk for relapse and disease progression, and which patients are likely to respond favorably to specific treatments.

(169) The universal requirement for centromeres and kinetochores in genome maintenance implies that the application may go beyond just one type of cancer, as supported by the prognostic power of the CES in breast, lung, gastric and early stage ovarian cancers. In addition, significant chromosome abnormalities and CIN were observed in pre-cancerous lesions in breast and other tissues (Man et al., 2003). Importantly, CEN/KT genes are misexpressed in a fraction of breast DCIS, early stage liver cancers display higher CES while non-cancerous dysplasia do not, and CEN/KT genes are overexpressed only in metastatic prostate cancers compared to benign tumors and non-metastatic cancers. These observations show that the CES system is useful for early diagnosis and to help avoid problems associated with overdiagnosis.

(170) In addition to potential applications for cancer management, our results have important implications related to cancer progression and genomic instability. A major hypothesis that underlies this study and the CES system is that misexpression of CEN/KT genes impairs centromere and kinetochore functions, leading to increased chromosomal abnormalities and genotoxic stress. Consistent with this hypothesis, high CES values are correlated with high levels of genomic instability in a large number of clinical samples from multiple cancers (Table 2). This hypothesis is further supported by mechanistic studies. Perturbation of centromere and kinetochore components causes aberrant functions that increase genome instability, such as defective mitotic checkpoints, spindle attachments, chromosome congression and sister chromatid separation. Overexpression of Drosophila CENP-A or tethering human HJURP to non-centromeric regions leads to neo-centromeres and structural rearrangements (Barnhart et al., 2011; Heun et al., 2006; Mendiburo et al., 2011). On the other hand, depletion and perhaps the presence of excess centromere proteins, can cause endogenous centromere dysfunction, whole chromosome aneuploidy, or mitotic arrest by checkpoint activation (Blower and Karpen, 2001; Cheeseman et al., 2008; Foltz et al., 2006; Okada et al., 2006).

(171) Extreme CIN appears to be detrimental to cancer cell fitness (Hiley and Swanton, 2014; Siegel and Amon, 2012). A possible application for the CES system is its effectiveness at predicting sensitivity to radiation and chemotherapeutic drugs for cancer patients. A simple explanation for the observed sensitivity of high CES tumors is that radiation, cisplatin and Topo I inhibitors increase DNA damage to a level that cannot be effectively repaired. This implies that modulating doses or changing patient sensitivity thresholds may benefit patients with medium CES tumors.

(172) In addition to the ‘CIN threshold’ model, sensitivity of high CES cancers may be explained by direct involvement of some of the CES genes in DNA repair. For example, HJURP was shown to be important in DNA repair in cancer cell lines (Kato et al., 2007), and we have previously demonstrated radio-sensitivity of cancers and cell lines with higher HJURP levels (Hu et al., 2010). The role of CENP-A in DNA damage and repair is unclear and may rely on genetic and cellular contexts (Lacoste et al., 2014; Mathew et al., 2014; Zeitlin et al., 2009). In addition, CENP-S/CENP-X is also known as the MHF complex, which stimulates replication fork remodeling by FANCM in DNA repair (Yan et al., 2010). It is conceivable that overexpression of the CES gene CENP-W may favor formation of CENP-S/-X/-T/-W complexes at centromeres and deplete the pool of available CENP-S/-X for repair. If centromere misregulation enhances CIN and genome instability on one hand, and suppresses effective DNA repair on the other, the CES system may identify a group of patients that are extremely sensitive to further DNA damage.

(173) Although CEN/KT genes are essential for proliferation, it is unlikely that their misexpression simply reflects faster proliferation rates in cancers. We emphasize that the primary consequences of centromere and kinetochore defects are chromosome missegregation and genomic abnormalities (Allshire and Karpen, 2008), which induce cell cycle arrest and cell death as secondary effects (Allshire and Karpen, 2008; Heun et al., 2006). Indeed, multiple experiments support this conclusion. First, mitotically active tissues do not necessarily overexpress CEN/KT genes compared with corresponding differentiated normal tissues. For example, we did not observe CEN/KT misexpression in advanced liver dysplastic tissues or many breast DCIS compared to corresponding normal tissues. Similarly, small intestine inflammatory lesions characteristic of non-cancerous, cryptic hyperplasia in coeliac disease do not misexpress CEN/KT genes (Bracken et al., 2008). Second, mRNA levels for many CEN/KT genes do not fluctuate in the cell cycle (Thiru et al., 2014). Third, we tested several CEN/KT genes including CENP-A and HJURP in isogenic breast cancer progression cell lines, and found that they are dramatically upregulated during cancer progression, even though these cell lines have similar doubling times (Zhang, W., unpublished data; Stampfer, M., personal comm.). Fourth, a pure role in proliferation would imply that mRNA levels for CEN/KT genes should always change in the same direction and show similar prognostic value for cancers. However, several essential CEN/KT genes have no prognostic value even when their binding partners in the same complex do (FIG. 2). Furthermore, for some genes such as CENP-C, reduced expression correlates with more aggressive tumors in several types of cancers. Finally, high CES values correlate with high levels of CIN, which is known to lead to reduced proliferation (Lee et al., 2011). For example, overexpression of CENP-A causes cell cycle arrest due to chromosome missegregation. Together, existing evidence argues that the functions of CEN/KT genes are to ensure genome stability rather than simply promoting proliferation.

(174) Specifically killing cells that contain chromosome aberrations has been proposed for cancer therapy (Roschke and Kirsch, 2005). Here we identified a group of genes whose misregulation relate to drug sensitivity. It may be possible in the future to develop novel small molecules that modulate centromere assembly and centromere/kinetochore structure, which could help overcome drug resistance due to CIN or increase cancer cell response to specific therapies.

(175) Materials and Methods

(176) A. Datasets Used in this Study

(177) The misregulation of CEN/KT genes and their impact on prognosis were assessed using several published microarray data sets profiled with Affymetrix GeneChip arrays (HG-U133A and B or HG-U133 Plus 2.0). Microarray datasets were downloaded from the GEO website. Normalized UT SPORE NSCLC dataset was directly obtained from Drs. Yang Xie and Hao Tang at UT Southwestern. CEN/KT mRNA expression levels, fraction of copy number alteration, and frequency of gene mutations for the set of samples in each TCGA study were obtained from cBioPortal (Gao et al., 2013).

(178) B. Meta-Analysis of Individual CEN/KT Genes and the CES for Cancer Prognosis Using Kaplan-Meier Survival Curves

(179) We performed meta-analysis for breast cancer AE-survival, MR-free survival, breast cancer subtype, and breast cancers with clinicopathological information on 17 breast cancer datasets using bc-GenExMiner v3.1, and for breast, lung, gastric and ovarian cancers using K-M Plotter following respective tutorials (Gyorffy et al., 2013; Jezequel et al., 2012). For meta-analysis using K-M Plotter for prognosis, we chose to use the top CES terile as high CES group, and the rest as low CES group. For meta-analysis on sensitivity to adjuvant therapies using K-M Plotter, we chose to use automatically computed best performing CES threshold for patient stratification in all dataset to increase detection sensitivity, even though tertile or median method gave similar results with statistical significance for many datasets. The K-M Plotter software only incorporates genes with probes present on both U133A+B to ensure comparability between datasets for meta-analysis, thus it excluded 7 CEN/KT genes including CENP-H, -W, -L, -K, -P, SPC24 and NUF2, of which 5 are also CES genes. Therefore, we used the 9 remaining CES genes, e.g., CENP-A, HJURP, MIS18B, CENP-N, CENP-M, CENP-U, ZWINT, NDC80, and SPC25, as a simplified version of the CES when using K-M Plotter.

(180) C. Gene Co-Expression Network Construction

(181) The CEN/KT gene co-expression correlation networks were constructed for each cancer type using TCGA datasets downloaded from the cBioPortal (Gao et al., 2013). A network of CEN/KT genes was constructed using Cytoscape 2.8.0 software (www.cytoscape.org) with the ExpressionCorrelation plugin (the website at baderlab.org/Software/ExpressionCorrelation). Correlation coeffecients exceeding a threshold (R≥0.4) were displayed as edges between genes represented by nodes. Nodes with fewer edges were arranged to the left of the network and those with more edges to the right.

(182) D. Statistical Analysis

(183) The Statistical Analysis of Microarrays (SAM) Excel add-on package (the website at www-stat.stanford.edu/˜tibs/SAM/) was used to identify differences between normal and tumor tissues in expression levels of CEN/KT genes (FDR≤0.05 and fold changes ≥2). Sample clustering was performed on the CEN/KT gene expression profiles using hierarchical clustering in Cluster 3.0 and Java Treeview 1.1.6r4 to group samples by centroid. For CCLE drug sensitivity, analysis was performed in Excel (Microsoft) and GraphPad. Kaplan-Meier survival curves for the CES system were generated for patients to evaluate differences in disease-free survival (DFS), stratified into groups of high (upper tertile), intermediate (middle tertile) and low (lower tertile) CES to evaluate differences in disease-free survival (DFS). For NSCLC JBR.10 trial and UT lung SPORE datasets for chemotherapy prediction, CES high patient group contains patients of the top CES tertile, and the rest two tertiles are defined as CES low. Statistical analyses were performed using the Statistical Package for the Social Sciences version 11.5 (SPSS, Inc., Chicago, Ill.) and Prism 6.0 GraphPad. Forest plots for meta-analysis on CES prognosis and treatment sensitivity were generated in Prism 6.0. For NSCLC JBR.10 and UT SPORE meta-analysis on sensitivity to adjuvant chemotherapy, we pooled the top CES tertiles and lower two CES tertiles from the two datasets for meta-groups, respectively, and Kaplan-Meier survival curves were made in Prims 6.0. Five-year survival was analyzed by chi-square test for significance.

REFERENCES

(184) Allshire, R. C. (1997). Centromeres, checkpoints and chromatid cohesion. Curr Opin Genet Dev 7, 264-273. Allshire, R. C., and Karpen, G. H. (2008). Epigenetic regulation of centromeric chromatin: old dogs, new tricks? Nature Reviews Genetics 9, 923-937. Artandi, S. E., and DePinho, R. A. (2010). Telomeres and telomerase in cancer. Carcinogenesis 31, 9-18. Barnhart, M. C., Kuich, P. H., Stellfox, M. E., Ward, J. A., Bassett, E. A., Black, B. E., and Foltz, D. R. (2011). HJURP is a CENP-A chromatin assembly factor sufficient to form a functional de novo kinetochore. J Cell Biol 194, 229-243. Barretina, J., Caponigro, G., Stransky, N., Venkatesan, K., Margolin, A. A., Kim, S., Wilson, C. J., Lehar, J., Kryukov, G. V., Sonkin, D., et al. (2012). The Cancer Cell Line Encyclopedia enables predictive modelling of anticancer drug sensitivity. Nature 483, 603-607. Beroukhim, R., Mermel, C. H., Porter, D., Wei, G., Raychaudhuri, S., Donovan, J., Barretina, J., Boehm, J. S., Dobson, J., Urashima, M., et al. (2010). The landscape of somatic copy-number alteration across human cancers. Nature, pp. 899-905. Black, B. E., and Cleveland, D. W. (2011). Epigenetic centromere propagation and the nature of CENP-a nucleosomes. Cell 144, 471-479. Black, B. E., Jansen, L. E., Foltz, D. R., and Cleveland, D. W. (2010). Centromere identity, function, and epigenetic propagation across cell divisions. Cold Spring Harb Symp Quant Biol 75, 403-418. Blower, M. D., and Karpen, G. H. (2001). The role of Drosophila CID in kinetochore formation, cell-cycle progression and heterochromatin interactions. Nat Cell Biol 3, 730-739. Blower, M. D., Sullivan, B. A., and Karpen, G. H. (2002). Conserved organization of centromeric chromatin in flies and humans. Dev Cell 2, 319-330. Botling, J., Edlund, K., Lohr, M., Hellwig, B., Holmberg, L., Lambe, M., Berglund, A., Ekman, S., Bergqvist, M., Ponten, F., et al. (2013). Biomarker discovery in non-small cell lung cancer: integrating gene expression profiling, meta-analysis, and tissue microarray validation. Chin Cancer Res 19, 194-204. Boveri, T. (1902). Ueber mehrpolige Mitosen als Mittel zur Analyse des Zellkerns. vehr d phys med Ges zu Wurzburg NF 35, 67-90. Boveri, T. (1914). Zur Frage der Enstehung maligner Tumoren (The Origin od Malignant Tumors) (Jena: Gustav Fischer). Bracken, S., Byrne, G., Kelly, J., Jackson, J., and Feighery, C. (2008). Altered gene expression in highly purified enterocytes from patients with active coeliac disease. BMC genomics 9, 377. Carter, S. L., Eklund, A. C., Kohane, I. S., Harris, L. N., and Szallasi, Z. (2006). A signature of chromosomal instability inferred from gene expression profiles predicts clinical outcome in multiple human cancers. In Nat Genet, pp. 1043-1048. Cheeseman, I. M., and Desai, A. (2008). Molecular architecture of the kinetochore-microtubule interface. Nature reviews Molecular cell biology 9, 33-46. Cheeseman, I. M., Hori, T., Fukagawa, T., and Desai, A. (2008). KNL1 and the CENP-H/I/K Complex Coordinately Direct Kinetochore Assembly in Vertebrates. Molecular biology of the cell 19, 587-594. Cleveland, D. W., Mao, Y., and Sullivan, K. F. (2003). Centromeres and kinetochores: from epigenetics to mitotic checkpoint signaling. Cell 112, 407-421. de Bruin, E. C., McGranahan, N., Mitter, R., Salm, M., Wedge, D. C., Yates, L., Jamal-Hanjani, M., Shaft, S., Murugaesu, N., Rowan, A. J., et al. (2014). Spatial and temporal diversity in genomic instability processes defines lung cancer evolution. Science 346, 251-256. Dunleavy, E. M., Roche, D., Tagami, H., Lacoste, N., Ray-Gallet, D., Nakamura, Y., Daigo, Y., Nakatani, Y., and Almouzni-Pettinotti, G. (2009). HJURP is a cell-cycle-dependent maintenance and deposition factor of CENP-A at centromeres. Cell 137, 485-497. Earnshaw, W. C., Bernat, R. L., Cooke, C. A., and Rothfield, N. F. (1991). Role of the centromere/kinetochore in cell cycle control. Cold Spring Harb Symp Quant Biol 56, 675-685. Foltz, D. R., Jansen, L. E., Bailey, A. O., Yates, J. R., 3rd, Bassett, E. A., Wood, S., Black, B. E., and Cleveland, D. W. (2009). Centromere-specific assembly of CENP-a nucleosomes is mediated by HJURP. Cell 137, 472-484. Foltz, D. R., Jansen, L. E., Black, B. E., Bailey, A. O., Yates, J. R., 3rd, and Cleveland, D. W. (2006). The human CENP-A centromeric nucleosome-associated complex. Nat Cell Biol 8, 458-469. Fujita, Y., Hayashi, T., Kiyomitsu, T., Toyoda, Y., Kokubu, A., Obuse, C., and Yanagida, M. (2007). Priming of centromere for CENP-A recruitment by human hMis18alpha, hMis18beta, and M18BP1. Dev Cell 12, 17-30. Gao, J., Aksoy, B. A., Dogrusoz, U., Dresdner, G., Gross, B., Sumer, S. O., Sun, Y., Jacobsen, A., Sinha, R., Larsson, E., et al. (2013). Integrative analysis of complex cancer genomics and clinical profiles using the cBioPortaL Science signaling 6, pll. Geigl, J. B., Obenauf, A. C., Schwarzbraun, T., and Speicher, M. R. (2008). Defining ‘chromosomal instability’. Trends in genetics: TIG 24, 64-69. Gyorffy, B., Lanczky, A., Eklund, A. C., Denkert, C., Budczies, J., Li, Q., and Szallasi, Z. (2010). An online survival analysis tool to rapidly assess the effect of 22,277 genes on breast cancer prognosis using microarray data of 1,809 patients. Breast Cancer Res Treat 123, 725-731. Gyorffy, B., Surowiak, P., Budczies, J., and Lanczky, A. (2013). Online survival analysis software to assess the prognostic value of biomarkers using transcriptomic data in non-small-cell lung cancer. PLoS One 8, e82241. Hanahan, D., and Weinberg, R. A. (2011). Hallmarks of cancer: the next generation. In Cell, pp. 646-674. Heun, P., Erhardt, S., Blower, M. D., Weiss, S., Skora, A. D., and Karpen, G. H. (2006). Mislocalization of the Drosophila centromere-specific histone CID promotes formation of functional ectopic kinetochores. Dev Cell 10, 303-315. Hiley, C. T., and Swanton, C. (2014). Spatial and temporal cancer evolution: causes and consequences of tumour diversity. Clinical medicine 14 Suppl 6, s33-37. Hori, T., Amano, M., Suzuki, A., Backer, C. B., Welburn, J. P., Dong, Y., McEwen, B. F., Shang, W.-H., Suzuki, E., Okawa, K., et al. (2008). CCAN makes multiple contacts with centromeric DNA to provide distinct pathways to the outer kinetochore. Cell 135, 1039-1052. Hu, Z., Huang, G., Sadanandam, A., Gu, S., Lenburg, M. E., Pai, M., Bayani, N., Blakely, E. A., Gray, J. W., and Mao, J.-H. (2010). The expression level of HJURP has an independent prognostic impact and predicts the sensitivity to radiotherapy in breast cancer. In Breast Cancer Res, pp. R18. Janssen, A., van der Burg, M., Szuhai, K., Kops, G. J., and Medema, R. H. (2011). Chromosome segregation errors as a cause of DNA damage and structural chromosome aberrations. Science 333, 1895-1898. Jezequel, P., Campone, M., Gouraud, W., Guerin-Charbonnel, C., Leux, C., Ricolleau, G., and Campion, L. (2012). bc-GenExMiner: an easy-to-use online platform for gene prognostic analyses in breast cancer. Breast cancer research and treatment 131, 765-775. Jezequel, P., Frenel, J. S., Campion, L., Guerin-Charbonnel, C., Gouraud, W., Ricolleau, G., and Campone, M. (2013). bc-GenExMiner 3.0: new mining module computes breast cancer gene expression correlation analyses. Database (Oxford) 2013, bas060. Kato, T., Sato, N., Hayama, S., Yamabuki, T., Ito, T., Miyamoto, M., Kondo, S., Nakamura, Y., and Daigo, Y. (2007). Activation of Holliday junction recognizing protein involved in the chromosomal stability and immortality of cancer cells. Cancer Res 67, 8544-8553. Kops, G. J. P. L., Weaver, B. A. A., and Cleveland, D. W. (2005). On the road to cancer: aneuploidy and the mitotic checkpoint. In Nature reviews Cancer, pp. 773-785. Lacoste, N., Woolfe, A., Tachiwana, H., Garea, A. V., Barth, T., Cantaloube, S., Kurumizaka, H., Imhof, A., and Almouzni, G. (2014). Mislocalization of the centromeric histone variant CenH3/CENP-A in human cells depends on the chaperone DAXX. Molecular cell 53, 631-644. Lee, A. J. X., Endesfelder, D., Rowan, A. J., Walther, A., Birkbak, N.J., Futreal, P. A., Downward, J., Szallasi, Z., Tomlinson, I. P. M., Howell, M., et al. (2011). Chromosomal instability confers intrinsic multidrug resistance. In Cancer Research, pp. 1858-1870. Loi (2007). Definition of clinically distinct molecular subtypes in estrogen receptor-positive breast carcinomas through genomic grade (vol 25, pg 1239, 2007). Journal of Clinical Oncology 25, 3790-3790. Mathew, V., Pauleau, A. L., Steffen, N., Bergner, A., Becker, P. B., and Erhardt, S. (2014). The histone-fold protein CHRAC14 influences chromatin composition in response to DNA damage. Cell reports 7, 321-330. Mathijssen, R. H., Loos, W. J., Verweij, J., and Sparreboom, A. (2002). Pharmacology of topoisomerase I inhibitors irinotecan (CPT-11) and topotecan. Current cancer drug targets 2, 103-123. Mcgovern, S. L., Qi, Y., Pusztai, L., Symmans, W. F., and Buchholz, T. A. (2012). Centromere protein-A, an essential centromere protein, is a prognostic marker for relapse in estrogen receptor-positive breast cancer. Breast Cancer Res, pp. R72. Mellone, B. G., Zhang, W., and Karpen, G. H. (2009). Frodos found: Behold the CENP-a “Ring” bearers. Cell, pp. 409-412. Mendiburo, M. J., Padeken, J., Fillop, S., Schepers, A., and Heun, P. (2011). Drosophila CENH3 Is Sufficient for Centromere Formation. Science 334, 686-690. Mishra, P. K., Au, W. C., Choy, J. S., Kuich, P. H., Baker, R. E., Foltz, D. R., and Basrai, M. A. (2011). Misregulation of Scm3p/HJURP causes chromosome instability in Saccharomyces cerevisiae and human cells. PLoS Genet 7, e1002303. Moree, B., Meyer, C. B., Fuller, C. J., and Straight, A. F. (2011). CENP-C recruits M18BP1 to centromeres to promote CENP-A chromatin assembly. The Journal of Cell Biology 194, 855-871. Nathanson, D. A., Gini, B., Mottahedeh, J., Visnyei, K., Koga, T., Gomez, G., Eskin, A., Hwang, K., Wang, J., Masui, K., et al. (2014). Targeted therapy resistance mediated by dynamic regulation of extrachromosomal mutant EGFR DNA. Science 343, 72-76. Negrini, S., Gorgoulis, V. G., and Halazonetis, T. D. (2010). Genomic instability—an evolving hallmark of cancer. Nat Rev Mol Cell Biol, pp. 220-228. Nfic-Zainal, S., Van Loo, P., Wedge, D. C., Alexandrov, L. B., Greenman, C. D., Lau, K. W., Raine, K., Jones, D., Marshall, J., Ramakrishna, M., et al. (2012). The life history of 21 breast cancers. Cell 149, 994-1007. Nishino, T., Takeuchi, K., Gascoigne, K. E., Suzuki, A., Hori, T., Oyama, T., Morikawa, K., Cheeseman, I. M., and Fukagawa, T. (2012). CENP-T-W-S-X forms a unique centromeric chromatin structure with a histone-like fold. Cell 148, 487-501. Okada, M., Cheeseman, I. M., Hori, T., Okawa, K., McLeod, I. X., Yates, J. R., 3rd, Desai, A., and Fukagawa, T. (2006). The CENP-H-I complex is required for the efficient incorporation of newly synthesized CENP-A into centromeres. Nat Cell Biol 8, 446-457. Parker, J. S., Mullins, M., Cheang, M. C., Leung, S., Voduc, D., Vickery, T., Davies, S., Fauron, C., He, X., Hu, Z., et al. (2009). Supervised risk predictor of breast cancer based on intrinsic subtypes. J Clin Oncol 27, 1160-1167. Perpelescu, M., and Fukagawa, T. (2011). The ABCs of CENPs. Chromosoma 120, 425-446. Pierotti, M. A., Sozzi, Gabriella, Croce, Carlo M. (2003). Holland-Frei Cancer Medicine, 6th Edition, 6th Edition edn (Hamilton (ON): BC Decker). Pihan, G. A., Wallace, J., Zhou, Y., and Doxsey, S. J. (2003). Centrosome abnormalities and chromosome instability occur together in pre-invasive carcinomas. Cancer Research, pp. 1398-1404. Roschke, A. V., and Kirsch, I. R. (2005). Targeting cancer cells by exploiting karyotypic complexity and chromosomal instability. In Cell Cycle, pp. 679-682. Schvartzman, J. M., Sotillo, R., and Benezra, R. (2010). Mitotic chromosomal instability and cancer: mouse modelling of the human disease. Nature reviews Cancer 10, 102-115. Siegel, J. J., and Amon, A. (2012). New insights into the troubles of aneuploidy. Annu Rev Cell Dev Biol 28, 189-214. Sullivan, B. A., and Karpen, G. H. (2004). Centromeric chromatin exhibits a histone modification pattern that is distinct from both euchromatin and heterochromatin. Nature structural & molecular biology 11, 1076-1083. Swanton, C., Marani, M., Pardo, O., Warne, P. H., Kelly, G., Sahai, E., Elustondo, F., Chang, J., Temple, J., Ahmed, A. A., et al. (2007). Regulators of mitotic arrest and ceramide metabolism are determinants of sensitivity to paclitaxel and other chemotherapeutic drugs. Cancer cell 11, 498-512. Tang, H., Xiao, G., Behrens, C., Schiller, J., Allen, J., Chow, C.-W., Suraokar, M., Corvalan, A., Mao, J., White, M. A., et al. (2013). A 12-gene set predicts survival benefits from adjuvant chemotherapy in non-small cell lung cancer patients. Clin Cancer Res, pp. 1577-1586. Thiru, P., Kern, D. M., McKinley, K. L., Monda, J. K., Rago, F., Su, K. C., Tsinman, T., Yarar, D., Bell, G. W., and Cheeseman, I. M. (2014). Kinetochore genes are coordinately up-regulated in human tumors as part of a FoxM1-related cell division program. Mol Biol Cell 25, 1983-1994. Tomonaga, T., Matsushita, K., Ishibashi, M., Nezu, M., Shimada, H., Ochiai, T., Yoda, K., and Nomura, F. (2005). Centromere protein H is up-regulated in primary human colorectal cancer and its overexpression induces aneuploidy. Cancer Res 65, 4683-4689. Tomonaga, T., Matsushita, K., Yamaguchi, S., Oohashi, T., Shimada, H., Ochiai, T., Yoda, K., and Nomura, F. (2003). Overexpression and mistargeting of centromere protein-A in human primary colorectal cancer. Cancer Res 63, 3511-3516. Weaver, B. A. A., and Cleveland, D. W. (2006). Does aneuploidy cause cancer? In Curr Opin Cell Biol, pp. 658-667. Weaver, B. A. A., Silk, A. D., Montagna, C., Verdier-Pinard, P., and Cleveland, D. W. (2007). Aneuploidy acts both oncogenically and as a tumor suppressor. In Cancer Cell, pp. 25-36. Yachida, S., Jones, S., Bozic, I., Antal, T., Leary, R., Fu, B., Kamiyama, M., Hruban, R. H., Eshleman, J. R., Nowak, M. A., et al. (2010). Distant metastasis occurs late during the genetic evolution of pancreatic cancer. Nature 467, 1114-1117. Yan, Z., Delannoy, M., Ling, C., Daee, D., Osman, F., Muniandy, P. A., Shen, X., Oostra, A. B., Du, H., Steltenpool, J., et al. (2010). A histone-fold complex and FANCM form a conserved DNA-remodeling complex to maintain genome stability. Molecular cell 37, 865-878. Zeitlin, S. G., Baker, N. M., Chapados, B. R., Soutoglou, E., Wang, J. Y., Berns, M. W., and Cleveland, D. W. (2009). Double-strand DNA breaks recruit the centromeric histone CENP-A. Proc Natl Acad Sci USA 106, 15762-15767. Zhang, J., Fujimoto, J., Zhang, J., Wedge, D. C., Song, X., Zhang, J., Seth, S., Chow, C. W., Cao, Y., Gumbs, C., et al. (2014). Intratumor heterogeneity in localized lung adenocarcinomas delineated by multiregion sequencing. Science 346, 256-259. Zhu, C. Q., Ding, K., Strumpf, D., Weir, B. A., Meyerson, M., Pennell, N., Thomas, R. K., Naoki, K., Ladd-Acosta, C., Liu, N., et al. (2010). Prognostic and predictive gene signature for adjuvant chemotherapy in resected non-small-cell lung cancer. J Clin Oncol 28, 4417-4424.

(185) TABLE-US-00014 >gi|12803733|gb|AAH02703.1| CENPA protein sapiens+  MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRL  AREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG  (SEQ ID NO: 1) >gi|83816964|ref|NP_060880.3| Holliday junction recognition protein isoform a [Homo sapiens] MLGTLRAMEGEDVEDDQLLQKLRASRRRFQRRMQRLIEKYNQPFEDTPVVQMATLTYETPQGLRIWGGRL  IKERNEGEIQDSSMKPADRTDGSVQAAAWGPELPSHRTVLGADSKSGEVDATSDQEESVAWALAPAVPQS  PLKNELRRKYLTQVDILLQGAEYFECAGNRAGRDVRVTPLPSLASPAVPAPGYCSRISRKSPGDPAKPAS  SPREWDPLHPSSTDMALVPRNDSLSLQETSSSSFLSSQPFEDDDICNVTISDLYAGMLHSMSRLLSTKPS  SIISTKTFIMQNWNSRRRHRYKSRMNKTYCKGARRSQRSSKENFIPCSEPVKGTGALRDCKNVLDVSCRK  TGLKLEKAFLEVNRPQIHKLDPSWKERKVTPSKYSSLIYFDSSATYNLDEENRFRTLKWLISPVKIVSRP  TIRQGHGENRQREIEIRFDQLHREYCLSPRNQPRRMCLPDSWAMNMYRGGPASPGGLQGLETRRLSLPSS  KAKAKSLSEAFENLGKRSLEAGRCLPKSDSSSSLPKTNPTHSATRPQQTSDLHVQGNSSGIFRKSVSPSK  TLSVPDKEVPGHGRNRYDEIKEEFDKLHQKYCLKSPGQMTVPLCIGVSTDKASMEVRYQTEGFLGKLNPD  PHFQGFQKLPSSPLGCRKSLLGSTAIEAPSSTCVARAITRDGTRDHQFPAKRPRLSEPQGSGRQGNSLGA  SDGVDNTVRPGDQGSSSQPNSEERGENTSYRMEEKSDFMLEKLETKSV (SEQ ID NO: 2) >gi|545477999|ref|NP_001269891.1| Holliday junction recognition protein  isoform b [Homo sapiens] MLGTLRAMEGEDVEDDQLLQKLRASRRRFQRRMQRLIEKYNQPFEDTPVVQMATLTYETPQGLRIWGGRL  IKERNEGEIQPAVPQSPLKNELRRKYLTQVDILLQGAEYFECAGNRAGRDVRVTPLPSLASPAVPAPGYC  SRISRKSPGDPAKPASSPREWDPLHPSSTDMALVPRNDSLSLQETSSSSFLSSQPFEDDDICNVTISDLY  AGMLHSMSRLLSTKPSSIISTKTFIMQNWNSRRRHRYKSRMNKTYCKGARRSQRSSKENFIPCSEPVKGT  GALRDCKNVLDVSCRKTGLKLEKAFLEVNRPQIHKLDPSWKERKVTPSKYSSLIYFDSSATYNLDEENRF  RTLKWLISPVKIVSRPTIRQGHGENRQREIEIRFDQLHREYCLSPRNQPRRMCLPDSWAMNMYRGGPASP  GGLQGLETRRLSLPSSKAKAKSLSEAFENLGKRSLEAGRCLPKSDSSSSLPKTNPTHSATRPQQTSDLHV  QGNSSGIFRKSVSPSKTLSVPDKEVPGHGRNRYDEIKEEFDKLHQKYCLKSPGQMTVPLCIGVSTDKASM  EVRYQTEGFLGKLNPDPHFQGFQKLPSSPLGCRKSLLGSTAIEAPSSTCVARAITRDGTRDHQFPAKRPR  LSEPQGSGRQGNSLGASDGVDNTVRPGDQGSSSQPNSEERGENTSYRMEEKSDFMLEKLETKSV (SEQ  ID NO: 3) >gi|545478902|ref|NP_001269892.1| Holliday junction recognition protein  isoform c [Homo sapiens] MLGTLRAMEGEDVEDDQLLQKLRASRRRFQRRMQRLIEKYNQPFEDTPVVQMATLTYETPQGLRIWGGRL  IKERNEGEIQCAGNRAGRDVRVTPLPSLASPAVPAPGYCSRISRKSPGDPAKPASSPREWDPLHPSSTDM  ALVPRNDSLSLQETSSSSFLSSQPFEDDDICNVTISDLYAGMLHSMSRLLSTKPSSIISTKTFIMQNWNS  RRRHRYKSRMNKTYCKGARRSQRSSKENFIPCSEPVKGTGALRDCKNVLDVSCRKTGLKLEKAFLEVNRP  QIHKLDPSWKERKVTPSKYSSLIYFDSSATYNLDEENRFRTLKWLISPVKIVSRPTIRQGHGENRQREIE  IRFDQLHREYCLSPRNQPRRMCLPDSWAMNMYRGGPASPGGLQGLETRRLSLPSSKAKAKSLSEAFENLG  KRSLEAGRCLPKSDSSSSLPKTNPTHSATRPQQTSDLHVQGNSSGIFRKSVSPSKTLSVPDKEVPGHGRN  RYDEIKEEFDKLHQKYCLKSPGQMTVPLCIGVSTDKASMEVRYQTEGFLGKLNPDPHFQGFQKLPSSPLG  CRKSLLGSTAIEAPSSTCVARAITRDGTRDHQFPAKRPRLSEPQGSGRQGNSLGASDGVDNTVRPGDQGS  SSQPNSEERGENTSYRMEEKSDFMLEKLETKSV (SEQ ID NO: 4) >gi|9506437|ref|NP_061817.1| protein Mis18-alpha[Homo sapiens] MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWASMWSSMSEDASVADMERAQLE  EEAAAAEERPLVFLCSGCRRPLGDSLSWVASQEDTNCILLRCVSCNVSVDKEQKLSKREKENGCVLETLC  CAGCSLNLGYVYRCTPKNLDYKRDLFCLSVEAIESYVLGSSEKQIVSEDKELFNLESRVEIEKSLTQMED  VLKALQMKLWEAESKLSFATCKS (SEQ ID NO: 5) >gi|24307929|ref|NP_009211.1| protein Mis18-beta sapiens+  MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWL  QPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSC  GIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRL  KSLMKILSEVTPDQSKPEN (SEQ ID NO: 6) >gi|119625950|gb|EAX05545.1| centromere protein C 1, isoform CRA_a  [Homo sapiens] MAASGLDHLKNGYRRRFCRPSRARDINTEQGQNVLEILQDCFEEKSLANDFSTNSTKSVPNSTRKIKDTC  IQSPSKECQKSHPKSVPVSSKKKEASLQFVVEPSEATNRSVQAHEVHQKILATDVSSKNTPDSKKISSRN  INDHHSEADEEFYLSVGSPSVLLDAKTSVSQNVIPSSAQKRETYTFENSVNMLPSSTEVSVKTKKRLNFD  DKVMLKKIEIDNKVSDEEDKTSEGQERKPSGSSQNRIRDSEYEIQRQAKKSFSTLFLETVKRKSESSPIV  RHAATAPPHSCPPDDTKLIEDEFIIDESDQSFASRSWITIPRKAGSLKQRTISPAESTALFQGRKSREKH  HNILPKTLANDKHSHKPHPVETSQPSDKTVLDTSYALIGETVNNYRSTKYEMYSKNAEKPSRSKRTIKQK  QRRKFMAKPAEEQLDVGQSKDENIHTSHITQDEFQRNSDRNMEEHEEMGNDCVSKKQMPPVGSKKSSTRK  DKEESKKKRFSSESKNKLVPEEVTSTVTKSRRISRRPSDWWVVKSEESPVYSNSSVRNELPMHHNSSRKS  TKKTNQSSKNIRKKTIPLKRQKTATKGNQRVQKFLNAEGSGGIVGHDEISRCSLSEPLESDEADLAKKKN  LDCSRSTRSSKNEDNIMTAQNVPLKPQTSGYTCNIPTESNLDSGEHKTSVLEESGPSRLNNNYLMSGKND  VDDEEVHGSSDDSKQSKVIPKNRIHHKLVLPSNTPNVRRTKRTRLKPLEYWRGERIDYQGRPSGGFVISG  VLSPDTISSKRKAKENIGKVNKKSNKKRICLDNDERKTNLMVNLGIPLGDPLQPTRVKDPETREIILMDL  VRPQDTYQFFVKHGELKVYKTLDTPFFSTGKLILGPQEEKGKQHVGQDILVFYVNFGDLLCTLHETPYIL  STGDSFYVPSGNYYNIKNLRNEESVLLFTQIKR (SEQ ID NO: 7) >gi|119625951|gb|EAX05546.1| centromere protein C 1, isoform CRA_b  [Homo sapiens] MAASGLDHLKNGYRRRFCRPSRARDINTEQGQNVLEILQDCFEEKSLANDFSTNSTKSVPNSTRKIKDTC  IQSPSKECQKSHPKSVPVSSKKKEASLQFVVEPSEATNRSVQAHEVHQKILATDVSSKNTPDSKKISSRN  INDHHSEADEEFYLSVGSPSVLLDAKTSVSQNVIPSSAQKRETYTFENSVNMLPSSTEVSVKTKKRLNFD  DKVMLKKIEIDNKVSDEEDKTSEGQERKPSGSSQNRIRDSEYEIQRQAKKSFSTLFLETVKRKSESSPIV  RHAATAPPHSCPPDDTKLIEDEFIIDESDQSFASRSWITIPRKAGSLKQRTISPAESTALFQGRKSREKH  HNILPKTLANDKHSHKPHPVETSQPSDKTVLDTSYALIGETVNNYRSTKYEMYSKNAEKPSRSKRTIKQK  QRRKFMAKPAEEQLDVGQSKDENIHTSHITQDEFQRNSDRNMEEHEEMGNDCVSKKQMPPVGSKKSSTRK  DKEESKKKRFSSESKNKLVPEEVTSTVTKSRRISRRPSDWWVVKSEESCLKC (SEQ ID NO: 8) >gi|395132501|ref|NP_060925.2| centromere protein N isoform 3  [Homo sapiens] MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLD  IIYMQFHQHQKVWEVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQ  YTKPNQYKPTYVVYYSQTPYAFTSSSMLRRNTPLLGQELEATGKIYLRQEEIILDITEMKKACN  (SEQ ID NO: 9) >gi|395132497|ref|NP_001257403.1| centromere protein N isoform 5  [Homo sapiens] MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLD  IIYMQFHQHQKVWEVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQ  YTKPNQYKPTYVVYYSQTPYAFTSSSMLRRNTPLLGQTFETHNSTTPLQERSLGLDINMDSRIIHENIVE  KERVQRITQETFGDYPQPQLEFAQYKLETKFKSGLNGSILAEREEPLRCLIKFSSPHLLEALKSLAPAGI  ADAPLSPLLTCIPNKRMNYFKIRDK (SEQ ID NO: 10) >gi|395132495|ref|NP_001257402.1| centromere protein N isoform 4  [Homo sapiens] MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLD  IICEDVDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYSQTPY  AFTSSSMLRRNTPLLGQALTIASKHHQIVKMDLRSRYLDSLKAIVFKQYNQTFETHNSTTPLQERSLGLD  INMDSRIIHENIVEKERVQRITQETFGDYPQPQLEFAQYKLETKFKSGLNGSILAEREEPLRCLIKFSSP  HLLEALKSLAPAGIADAPLSPLLTCIPNKRMNYFKIRDK (SEQ ID NO: 11) >gi|395132493|ref|NP_001094094.2| centromere protein N isoform 2  [Homo sapiens]  MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLD  IIYMQFHQHQKVWEVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQ  YTKPNQYKPTYVVYYSQTPYAFTSSSMLRRNTPLLGQALTIASKHHQIVKMDLRSRYLDSLKAIVFKQYN  QTFETHNSTTPLQERSLGLDINMDSRIIHENIVEKERVQRITQETFGDYPQPQLEFAQYKLETKFKSGLN  GSILAEREEPLRCLIKFSSPHLLEALKSLAPAGIADAPLSPLLTCIPNKRMNYFKIRDK  (SEQ ID NO: 12) >gi|395132491|ref|NP_001094095.2| centromere protein N isoform 1  [Homo sapiens] MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLD  IIYMQFHQHQKVWEVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQ  YTKPNQYKPTYVVYYSQTPYAFTSSSMLRRNTPLLGQALTIASKHHQIVKMDLRSRYLDSLKAIVFKQYN  QTFETHNSTTPLQERSLGLDINMDSRIIHENIVEKERVQRITQETFGDYPQPQLEFAQYKLETKFKSGLN  GSILAEREEPLRCLIKFSSPHLLEALKSLAPAALVCRIQKLLCYSGSHSQGTQDPSSWQKDLYLLFVPLY   PRC (SEQ ID NO: 13) >gi|77416860|sp|Q92674.2| CENPI_HUMAN RecName: Full = Centromere protein I;  Short = CENP-I; AltName: Full = FSH primary response protein 1; AltName:  Full = Follicle-stimulating hormone primary response protein; AltName:  Full = Interphase centromere complex protein 19; AltName: Full = Leucine-rich  primary response protein 1  MSPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPVGDYEHADDQAEEDALQMAV  GYFEKGPIKASQNKDKTLEKHLKTVENVAWKNGLASEEIDILLNIALSGKFGNAVNTRILKCMIPATVIS  EDSVVKAVSWLCVGKCSGSTKVLFYRWLVAMFDFIDRKEQINLLYGFFFASLQDDALCPYVCHLLYLLTK  KENVKPFRVRKLLDLQAKMGMQPHLQALLSLYKFFAPALISVSLPVRKKIYFKNSENLWKTALLAVKQRN  RGPSPEPLKLMLGPANVRPLKRKWNSLSVIPVLNSSSYTKECGKKEMSLSDCLNRSGSFPLEQLQSFPQL  LQNIHCLELPSQMGSVLNNSLLLHYINCVRDEPVLLRFYYWLSQTLQEECIWYKVNNYEHGKEFTNFLDT  IIRAECFLQEGFYSCEAFLYKSLPLWDGLCCRSQFLQLVSWIPFSSFSEVKPLLFDHLAQLFFTSTIYFK  CSVLQSLKELLQNWLLWLSMDIHMKPVTNSPLETTLGGSMNSVSKLIHYVGWLSTTAMRLESNNTFLLHF  ILDFYEKVCDIYINYNLPLVVLFPPGIFYSALLSLDTSILNQLCFIMHRYRKNLTAAKKNELVQKTKSEF  NFSSKTYQEFNHYLTSMVGCLWTSKPFGKGIYIDPEILEKTGVAEYKNSLNVVHHPSFLSYAVSFLLQES  PEERTVNVSSIRGKKWSWYLDYLFSQGLQGLKLFIRSSVHHSSIPRAEGINCNNQY (SEQ ID NO: 14) >gi|74733576|sp|Q9H3R5.1| CENPH_HUMAN RecName: Full = Centromere protein H;  Short = CENP-H; AltName: Full = Interphase centromere complex protein 35  MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPE  QIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLI  MKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITT  VIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM (SEQ ID NO: 15) >gi|557357675|ref|NP_001273454.1| centromere protein W isoform c  [Homo sapiens]  MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLKSPGQTLVRVNVESLTRSMYWPQQR  (SEQ ID NO: 16) >gi|557355812|ref|NP_001273453.1| centromere protein W isoform a  [Homo sapiens] MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVRFHPFSGWEWGTGEVHLNCLLFVHRLA  EESRTNACASKCRVINKEHVLAAAKVILKKSRG (SEQ ID NO: 17) >gi|60302883|ref|NP_001012525.1| centromere protein W isoform b  [Homo sapiens] MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRTNACASKCRVI  NKEHVLAAAKVILKKSRG (SEQ ID NO: 18) >gi|401871068|ref|NP_001257936.1| centromere protein X isoform 3  [Homo sapiens] MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVDQLEKLLDF (SEQ ID NO: 19) >gi|401871066|ref|NP_001257935.1| centromere protein X isoform 1  [Homo sapiens] MEGAGAGSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQL  EKVLPQLLLDF (SEQ ID NO: 20) >gi|71559139|ref|NP_659435.2| centromere protein X isoform 2 [Homo sapiens] MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF  (SEQ ID NO: 21) >gi|50845414|ref|NP_001002876.1| centromere protein M isoform b  [Homo sapiens] MSVLRPLDKLPGLNTATILLVGTEDALLQQLADSMLKEDCASELKVHLAKSLPLPSSVNRPRIDLIVFVV  NLHSKYSLQNTEESLRHVDASFFLGKVCFLATGGGRL (SEQ ID NO: 22) >gi|13129022|ref|NP_076958.1| centromere protein M isoform a [Homo sapiens] MSVLRPLDKLPGLNTATILLVGTEDALLQQLADSMLKEDCASELKVHLAKSLPLPSSVNRPRIDLIVFVV  NLHSKYSLQNTEESLRHVDASFFLGKVCFLATGAGRESHCSIHRHTVVKLAHTYQSPLLYCDLEVEGFRA  TMAQRLVRVLQICAGHVPGVSALNLLSLLRSSEGPSLEDL (SEQ ID NO: 23) >gi|158966691|ref|NP_001103685.1| centromere protein M isoform c  [Homo sapiens] MGRVWDLPGVLKVEGFRATMAQRLVRVLQICAGHVPGVSALNLLSLLRSSEGPSLEDL  (SEQ ID NO: 24) >gi|74712714|sp|Q71F23.1| CENPU_HUMAN RecName: Full = Centromere protein U;  Short = CENP-U; AltName: Full = Centromere protein of 50 kDa; Short = CENP-50;  AltName: Full = Interphase centromere complex protein 24; AltName: Full = KSHV  latent nuclear antigen-interacting protein 1; AltName: Full = MLF1-  interacting protein; AltName: Full = Polo-box-interacting protein 1  MAPRGRRRPRPHRSEGARRSKNTLERTHSMKDKAGQKCKPIDVFDFPDNSDVSSIGRLGENEKDEETYET  FDPPLHSTAIYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNEASEIESVKISAKKPGRKLRPISDDSE  SIEESDTRRKVKSAEKISTQRHEVIRTTASSELSEKPAESVTSKKTGPLSAQPSVEKENLAIESQSKTQK  KGKISHDKRKKSRSKAIGSDTSDIVHIWCPEGMKTSDIKELNIVLPEFEKTHLEHQQRIESKVCKAAIAT  FYVNVKEQFIKMLKESQMLTNLKRKNAKMISDIEKKRQRMIEVQDELLRLEPQLKQLQTKYDELKERKSS  LRNAAYFLSNLKQLYQDYSDVQAQEPNVKETYDSSSLPALLFKARTLLGAESHLRNINHQLEKLLDQG  (SEQ ID NO: 25) >gi|113958992|gb|ABI49143.1| MLF1 interacting protein isoform 2  [Homo sapiens] MAPRGRRRPRPHRSEGARRSKNTLERTHSMKDKAGQKCKPIDVFDFPDNSDVSSIGRLGENEKDEETYET  FDPPLHSTAIYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNEASEIESVKISAKKPGRKLRPISDDSE  SIEESDTRRKVKSAEKISTQRHEVIRTTASSELSEKPAESVTSKKTGPLSAQPSVEKENLAIESQSKTQK  KGKISHDKRKKSRSKAIGSDTSDIVHIWCPEGMKTSDIKELNIVLPEFEKTHLEHQQRIESKVCKAAIAT  FYVNVKEQFIKMLKESQMLTNLKRKNAKVRATAETTTNKI (SEQ ID NO: 26) >gi|113958976|gb|ABI49142.1| MLF1 interacting protein isoform 1  [Homo sapiens] MAPRGRRRPRPHRSEGARRSKNTLERTHSMKDKAGQKCKPIDVFDFPDNSDVSSIGRLGENEKDEETYET  FDPPLHSTAIYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNEASEIESVKISAKKPGRKLRPISDDSE  SIEESDTRRKVKSAEKISTQRHEVIRTTASSELSEKPAESVTSKKTGPLSAQPSVEKENLAIESQSKTQK  KGKISHDKRKKSRSKAIGSDTSDIVHIWCPEGMKTSDIKELNIVLPEFEKTHLEHQQRIESKVCKAAIAT  FYVNVKEQFIKMLKESQMLTNLKRKNAKMISDIEKKRQRMIEVQDELLRLWTGAGLW (SEQ ID NO: 27) >gi|306482665|ref|NP_001182361.1| myeloid leukemia factor 1 isoform 3  [Homo sapiens] MLKEVLQREGKSYKSETLMYIKKARASENKLSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNR  RGHNDGEDSLTATSCSLVPFGDFGGMHTDVSSFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSS  VMTYSKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEE  VNQEFINMNESDAHAFDEEWQSEVLKYKPGRHNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRS  NVLGDKLHIKGSSVKSNKK (SEQ ID NO: 28) >gi|283945459|ref|NP_001164653.1| centromere protein L isoform 2  [Homo sapiens] MDSYSAPESTPSASSRPEDYFIGATPLQKRLESVRKQSSFILTPPRRKIPQCSQLQEDVDPQKVAFLLHK  QWTLYSLTPLYKFSYSNLKEYSRLLNAFIVAEKQKGLAVEVGEDFNIKVIFSTLLGMKGTQRDPEAFLVQ  IVSKSQLPSENREGKVLWTGWFCCVFGDSLLETVSEDFTCLPLFLANGAESNTAIIGTWFQKTFDCYFSP  LAINAFNLSWMAAMWTACKMDHYVATTEFLWSVPCSPQSLDISFAIHPEDAKALWDSVHKTPGEVTQEEV  DLFMDCLYSHFHRHFKIHLSATRLVRVSTSVASAHTDGKIKILCHKYLIGVLAYLTELAIFQIE  (SEQ ID NO: 29) >gi|1876085081ref|NP 001120653.1| centromere protein L isoform 1  [Homo sapiens] MDSYSAPESTPSASSRPEDYFIGATPLQKRLESVRKQSSFILTPPRRKIPQCSQLQEDVDPQKVAFLLHK  QWTLYSLTPLYKFSYSNLKEYSRLLNAFIVAEKQKGLAVEVGEDFNIKVIFSTLLGMKGTQRDPEAFLVQ  GLILSPRLEYSGTILVDCNLCLLGSSDPSTLAFQVAGTAGACHHTRIVSKSQLPSENREGKVLWTGWFCC  VFGDSLLETVSEDFTCLPLFLANGAESNTAIIGTWFQKTFDCYFSPLAINAFNLSWMAAMWTACKMDHYV  ATTEFLWSVPCSPQSLDISFAIHPEDAKALWDSVHKTPGEVTQEEVDLFMDCLYSHFHRHFKIHLSATRL  VRVSTSVASAHTDGKIKILCHKYLIGVLAYLTELAIFQIE (SEQ ID NO: 30) >gi|74732954|sp|Q9BS16.1| CENPK_HUMAN RecName: Full = Centromere protein K;  Short = CENP-K; AltName: Full = Interphase centromere complex protein 37;  AltName: Full = Protein AF-5a1pha; AltName: Full = p33  MNQEDLDPDSTTDVGDVTNTEEELIRECEEMWKDMEECQNKLSLIGTETLTDSNAQLSLLIMQVKCLTAE  LSQWQKKTPETIPLTEDVLITLGKEEFQKLRQDLEMVLSTKESKNEKLKEDLEREQRWLDEQQQIMESLN  VLHSELKNKVETFSESRIFNELKTKMLNIKEYKEKLLSTLGEFLEDHFPLPDRSVKKKKKNIQESSVNLI  TLHEMLEILINRLFDVPHDPYVKISDSFWPPYVELLLRNGIALRHPEDPTRIRLEAFHQ  (SEQ ID NO: 31) >gi|315221159|ref|NP_001186732.1| centromere protein 0 isoform 2  [Homo sapiens] MAGI LASGLGVLAHLERLETQVSRSRKQSEELQSVQAQEGALGTKIHKLRRLRDELRAVVRHRRASVKAC  IANVEPNQTVEINEQEALEEKLENVKAILQAYHFTGLSGKLTSRGVCVCISTAFEGNLLDSYFVDLVIQK  PLRIHHHSVPVFIPLEEIAAKYLQTNIQHFLFSLCEYLNAYSGRKYQADRLQSDFAALLTGPLQRNPLCN  LLSFTYKLDPGGQSFPFCARLLYKDLTATLPTDVTVTCQGVEVLSTSWEEQRASHETLFCTKPLHQVFAS  FTRKGEKLDMSLVS (SEQ ID NO: 32) >gi|13236565|ref|NP_077298.1| centromere protein 0 isoform 1 sapiens+  MEQANPLRPDGESKGGVLAHLERLETQVSRSRKQSEELQSVQAQEGALGTKIHKLRRLRDELRAVVRHRR  ASVKACIANVEPNQTVEINEQEALEEKLENVKAILQAYHFTGLSGKLTSRGVCVCISTAFEGNLLDSYFV  DLVIQKPLRIHHHSVPVFIPLEEIAAKYLQTNIQHFLFSLCEYLNAYSGRKYQADRLQSDFAALLTGPLQ  RNPLCNLLSFTYKLDPGGQSFPFCARLLYKDLTATLPTDVTVTCQGVEVLSTSWEEQRASHETLFCTKPL  HQVFASFTRKGEKLDMSLVS (SEQ ID NO: 33) >gi|444299651|ref|NP_653091.3| protein CASC5 isoform 2 sapiens+  MDGVSSEANEENDNIERPVRRRHSSILKPPRSPLQDLRGGNERVQESNALRNKKNSRRVSFADTIKVFQT  ESHMKIVRKSEMEETETGENLLLIQNKKLEDNYCEITGMNTLLSAPIHTQMQQKEFSIIEHTRERKHAND  QTVIFSDENQMDLTSSHTVMITKGLLDNPISEKSTKIDTTSFLANLKLHTEDSRMKKEVNFSVDQNTSSE  NKIDFNDFIKRLKTGKCSAFPDVPDKENFEIPIYSKEPNSASSTHQMHVSLKEDENNSNITRLFREKDDG  MNFTQCHTANIQTLIPTSSETNSRESKGNDITIYGNDFMDLTFNHTLQILPATGNFSEIENQTQNAMDVT  TGYGTKASGNKTVFKSKQNTAFQDLSINSADKIHITRSHIMGAETHIVSQTCNQDARILAMTPESIYSNP  SIQGCKTVFYSSCNDAMEMTKCLSNMREEKNLLKHDSNYAKMYCNPDAMSSLTEKTIYSGEENMDITKSH  TVAIDNQIFKQDQSNVQIAAAPTPEKEMMLQNLMTTSEDGKMNVNCNSVPHVSKERIQQSLSNPLSISLT  DRKTELLSGENMDLTESHTSNLGSQVPLAAYNLAPESTSESHSQSKSSSDECEEITKSRNEPFQRSDIIA  KNSLTDTWNKDKDWVLKILPYLDKDSPQSADCNQEIATSHNIVYCGGVLDKQITNRNTVSWEQSLFSTTK  PLFSSGQFSMKNHDTAISSHTVKSVLGQNSKLAEPLRKSLSNPTPDYCHDKMIICSEEEQNMDLTKSHTV  VIGFGPSELQELGKTNLEHTTGQLTTMNRQIAVKVEKCGKSPIEKSGVLKSNCIMDVLEDESVQKPKFPK  EKQNVKIWGRKSVGGPKIDKTIVFSEDDKNDMDITKSYTIEINHRPLLEKRDCHLVPLAGTSETILYTCR  QDDMEITRSHTTALECKTVSPDEITTRPMDKTVVFVDNHVELEMTESHTVFIDYQEKERTDRPNFELSQR  KSLGTPTVICTPTEESVFFPGNGESDRLVANDSQLTPLEEWSNNRGPVEVADNMELSKSATCKNIKDVQS  PGFLNEPLSSKSQRRKSLKLKNDKTIVFSENHKNDMDITQSCMVEIDNESALEDKEDFHLAGASKTILYS  CGQDDMEITRSHTTALECKTLLPNEIAIRPMDKTVLFTDNYSDLEVTDSHTVFIDCQATEKILEENPKFG  IGKGKNLGVSFPKDNSCVQEIAEKQALAVGNKIVLHTEQKQQLFAATNRTTNEIIKFHSAAMDEKVIGKV  VDQACTLEKAQVESCQLNNRDRRNVDFTSSHATAVCGSSDNYSCLPNVISCTDNLEGSAMLLCDKDEEKA  NYCPVQNDLAYANDFASEYYLESEGQPLSAPCPLLEKEEVIQTSTKGQLDCVITLHKDQDLIKDPRNLLA  NQTLVYSQDLGEMTKLNSKRVSFKLPKDQMKVYVDDIYVIPQPHFSTDQPPLPKKGQSSINKEEVILSKA  GNKSLNIIENSSAPICENKPKILNSEEWFAAACKKELKENIQTTNYNTALDFHSNSDVTKQVIQTHVNAG  EAPDPVITSNVPCFHSIKPNLNNLNGKTGEFLAFQTVHLPPLPEQLLELGNKAHNDMHIVQATEIHNINI  ISSNAKDSRDEENKKSHNGAETTSLPPKTVFKDKVRRCSLGIFLPRLPNKRNCSVTGIDDLEQIPADTTD  INHLETQPVSSKDSGIGSVAGKLNLSPSQYINEENLPVYPDEINSSDSINIETEEKALIETYQKEISPYE  NKMGKTCNSQKRTWVQEEEDIHKEKKIRKNEIKFSDTTQDREIFDHHTEEDIDKSANSVLIKNLSRTPSS  CSSSLDSIKADGTSLDFSTYRSSQMESQFLRDTICEESLREKLQDGRITIREFFILLQVHILIQKPRQSN  LPGNFTVNTPPTPEDLMLSQYVYRPKIQIYREDCEARRQKIEELKLSASNQDKLLVDINKNLWEKMRHCS  DKELKAFGIYLNKIKSCFTKMTKVFTHQGKVALYGKLVQSAQNEREKLQIKIDEMDKILKKIDNCLTEME  TETKNLEDEEKNNPVEEWDSEMRAAEKELEQLKTEEEELQRNLLELEVQKEQTLAQIDFMQKQRNRTEEL  LDQLSLSEWDVVEWSDDQAVFTFVYDTIQLTITFEESVVGFPFLDKRYRKIVDVNFQSLLDEDQAPPSSL  LVHKLIFQYVEEKESWKKTCTTQHQLPKMLEEFSLVVHHCRLLGEEIEYLKRWGPNYNLMNIDINNNELR  LLFSSSAAFAKFEITLFLSAYYPSVPLPSTIQNHVGNTSQDDIATILSKVPLENNYLKNVVKQIYQDLFQ  DCHFYH (SEQ ID NO: 34) >gi|444299649|ref|NP_733468.3| protein CASC5 isoform 1 sapiens+  MDGVSSEANEENDNIERPVRRRHSSILKPPRSPLQDLRGGNERVQESNALRNKKNSRRVSFADTIKVFQT  ESHMKIVRKSEMEGCSAMVPSQLQLLPPGFKRFSCLSLPETETGENLLLIQNKKLEDNYCEITGMNTLLS  APIHTQMQQKEFSIIEHTRERKHANDQTVIFSDENQMDLTSSHTVMITKGLLDNPISEKSTKIDTTSFLA  NLKLHTEDSRMKKEVNFSVDQNTSSENKIDFNDFIKRLKTGKCSAFPDVPDKENFEIPIYSKEPNSASST  HQMHVSLKEDENNSNITRLFREKDDGMNFTQCHTANIQTLIPTSSETNSRESKGNDITIYGNDFMDLTFN  HTLQILPATGNFSEIENQTQNAMDVTTGYGTKASGNKTVFKSKQNTAFQDLSINSADKIHITRSHIMGAE  THIVSQTCNQDARILAMTPESIYSNPSIQGCKTVFYSSCNDAMEMTKCLSNMREEKNLLKHDSNYAKMYC  NPDAMSSLTEKTIYSGEENMDITKSHTVAIDNQIFKQDQSNVQIAAAPTPEKEMMLQNLMTTSEDGKMNV  NCNSVPHVSKERIQQSLSNPLSISLTDRKTELLSGENMDLTESHTSNLGSQVPLAAYNLAPESTSESHSQ  SKSSSDECEEITKSRNEPFQRSDIIAKNSLTDTWNKDKDWVLKILPYLDKDSPQSADCNQEIATSHNIVY  CGGVLDKQITNRNTVSWEQSLFSTTKPLFSSGQFSMKNHDTAISSHTVKSVLGQNSKLAEPLRKSLSNPT  PDYCHDKMIICSEEEQNMDLTKSHTVVIGFGPSELQELGKTNLEHTTGQLTTMNRQIAVKVEKCGKSPIE  KSGVLKSNCIMDVLEDESVQKPKFPKEKQNVKIWGRKSVGGPKIDKTIVFSEDDKNDMDITKSYTIEINH  RPLLEKRDCHLVPLAGTSETILYTCRQDDMEITRSHTTALECKTVSPDEITTRPMDKTVVFVDNHVELEM  TESHTVFIDYQEKERTDRPNFELSQRKSLGTPTVICTPTEESVFFPGNGESDRLVANDSQLTPLEEWSNN  RGPVEVADNMELSKSATCKNIKDVQSPGFLNEPLSSKSQRRKSLKLKNDKTIVFSENHKNDMDITQSCMV  EIDNESALEDKEDFHLAGASKTILYSCGQDDMEITRSHTTALECKTLLPNEIAIRPMDKTVLFTDNYSDL  EVTDSHTVFIDCQATEKILEENPKFGIGKGKNLGVSFPKDNSCVQEIAEKQALAVGNKIVLHTEQKQQLF  AATNRTTNEIIKFHSAAMDEKVIGKVVDQACTLEKAQVESCQLNNRDRRNVDFTSSHATAVCGSSDNYSC  LPNVISCTDNLEGSAMLLCDKDEEKANYCPVQNDLAYANDFASEYYLESEGQPLSAPCPLLEKEEVIQTS  TKGQLDCVITLHKDQDLIKDPRNLLANQTLVYSQDLGEMTKLNSKRVSFKLPKDQMKVYVDDIYVIPQPH  FSTDQPPLPKKGQSSINKEEVILSKAGNKSLNIIENSSAPICENKPKILNSEEWFAAACKKELKENIQTT  NYNTALDFHSNSDVTKQVIQTHVNAGEAPDPVITSNVPCFHSIKPNLNNLNGKTGEFLAFQTVHLPPLPE  QLLELGNKAHNDMHIVQATEIHNINIISSNAKDSRDEENKKSHNGAETTSLPPKTVFKDKVRRCSLGIFL  PRLPNKRNCSVTGIDDLEQIPADTTDINHLETQPVSSKDSGIGSVAGKLNLSPSQYINEENLPVYPDEIN  SSDSINIETEEKALIETYQKEISPYENKMGKTCNSQKRTWVQEEEDIHKEKKIRKNEIKFSDTTQDREIF  DHHTEEDIDKSANSVLIKNLSRTPSSCSSSLDSIKADGTSLDFSTYRSSQMESQFLRDTICEESLREKLQ  DGRITIREFFILLQVHILIQKPRQSNLPGNFTVNTPPTPEDLMLSQYVYRPKIQIYREDCEARRQKIEEL  KLSASNQDKLLVDINKNLWEKMRHCSDKELKAFGIYLNKIKSCFTKMTKVFTHQGKVALYGKLVQSAQNE  REKLQIKIDEMDKILKKIDNCLTEMETETKNLEDEEKNNPVEEWDSEMRAAEKELEQLKTEEEELQRNLL  ELEVQKEQTLAQIDFMQKQRNRTEELLDQLSLSEWDVVEWSDDQAVFTFVYDTIQLTITFEESVVGFPFL  DKRYRKIVDVNFQSLLDEDQAPPSSLLVHKLIFQYVEEKESWKKTCTTQHQLPKMLEEFSLVVHHCRLLG  EEIEYLKRWGPNYNLMNIDINNNELRLLFSSSAAFAKFEITLFLSAYYPSVPLPSTIQNHVGNTSQDDIA  TILSKVPLENNYLKNVVKQIYQDLFQDCHFYH (SEQ ID NO: 35) >gi|119612836|gb|EAW92430.1| cancer susceptibility candidate 5, isoform  CRA_b [Homo sapiens] MDGVSSEANEENDNIERPVRRRHSSILKPPRSPLQDLRGGNERVQESNALRNKKNSRRVSFADTIKVFQT  ESHMKIVRKSEMEETETGENLLLIQNKKLEDNYCEITGMNTLLSAPIHTQMQQKEFSIIEHTRERKHAND  QTVIFSDENQMDLTSSHTVMITKGLLDNPISEKSTKIDTTSFLANLKLHTEDSRMKKEVNFSVDQNTSSE  NKIDENDFIKRLKTGKCSAFPDVPDKENFEIPIYSKEPNSASSTHQMHVSLKEDENNSNITRLFREKDDG  MNFTQCHTANIQTLIPTSSETNSRESKGNDITIYGNDFMDLTFNHTLQILPATGNFSEIENQTQNAMDVT  TGYGTKASGNKTVFKSKQNTAFQDLSINSADKIHITRSHIMGAETHIVSQTCNQDARILAMTPESIYSNP  SIQGCKTVFYSSCNDAMEMTKCLSNMREEKNLLKHDSNYSKMYCNPDAMSSLTEKTIYSGEENMDITKSH  TVAIDNQIFKQDQSNVQIAAAPTPEKEMMLQNLMTTSEDGKMNVNCNSVPHVSKERIQQSLSNPLSISLT  DRKTELLSGENMDLTESHTSNLGSQVPLAAYNLAPESTSESHSQSKSSSDECEEITKSRNEPFQRSDIIA  KNSLTDTWNKDKDWVLKILPYLDKDSPQSADCNQEIATSHNIVYCGGVLDKQITNRNTVSWEQSLFSTTK  PLFSSGQFSMKNHDTAISSHTVKSVLGQNSKLAEPLRKSLSNPTPDYCHDKMIICSEEEQNMDLTKSHTV  VIGFGPSELQELGKTNLEHTTGQLTTMNRQIAVKVEKCGKSPIEKSGVLKSNCIMDVLEDESVQKPKFPK  EKQNVKIWGRKSVGGPKIDKTIVFSEDDKNDMDITKSYTIEINHRPLLEKRDCHLVPLAGTSETILYTCG  QDDMEITRSHTTALECKTVSPDEITTRPMDKTVVFVDNHVELEMTESHTVFIDYQEKERTDRPNFELSQR  KSLGTPTVICTPTEESVFFPGNGESDRLVANDSQLTPLEEWSNNRGPVEVADNMELSKSATCKNIKDVQS  PGFLNEPLSSKSQRRKSLKLKNDKTIVFSENHKNDMDITQSCMVEIDNESALEDKEDFHLAGASKTILYS  CGQDDMEITRSHTTALECKTLLPNEIAIRPMDKTVLFTDNYSDLEVTDSHTVFIDCQATEKILEENPKFG  IGKGKNLGVSFPKDNSCVQEIAEKQALAVGNKIVLHTEQKQQLFAATNRTTNEIIKFHSAAMDEKVIGKV  VDQACTLEKAQVESCQLNNRDRRNVDFTSSHATAVCGSSDNYSCLPNVISCTDNLEGSAMLLCDKDEEKA  NYCPVQNDLAYANDFASEYYLESEGQPLSAPCPLLEKEEVIQTSTKGQLDCVITLHKDQDLIKDPRNLLA  NQTLVYSQDLGEMTKLNSKRVSFKLPKDQMKVYVDDIYVIPQPHFSTDQPPLPKKGQSSINKEEVILSKA  GNKSLNIIENSSAPICENKPKILNSEEWFAAACKKELKENIQTTNYNTALDFHSNSDVTKQVIQTHVNAG  EAPDPVITSNVPCFHSIKPNLNNLNGKTGEFLAFQTVHLPPLPEQLLELGNKAHNDMHIVQATEIHNINI  ISSNAKDSRDEENKKSHNGAETTSLPPKTVFKDKVRRCSLGIFLPRLPNKRNCSVTGIDDLEQIPADTTD  INHLETQPVSSKDSGIGSVAGKLNLSPSQYINEENLPVYPDEINSSDSINIETEEKALIETYQKEISPYE  NKMGKTCNSQKRTWVQEEEDIHKEKKIRKNEIKFSDTTQDREVSSVLNQRMFLNFGFCFVFLNCGYSQIL  ILVSGRQKIIIST (SEQ ID NO: 36) >gi|119612835|gb|EAW92429.1| cancer susceptibility candidate 5, isoform  CRA_a, partial [Homo sapiens]  MDGVSSEANEENDNIERPVRRRHSSILKPPRSPLQDLRGGNERVQESNALRNKKNSRRVSFADTIKVFQT  ESHMKIVRKSEMEETETGENLLLIQNKKLEDNYCEITGMNTLLSAPIHTQMQQKEFSIIEHTRERKHAND  QTVIFSDENQMDLTSSHTVMITKGLLDNPISEKSTKIDTTSFLANLKLHTEDSRMKKEVNFSVDQNTSSE  NKIDENDFIKRLKTGKCSAFPDVPDKENFEIPIYSKEPNSASSTHQMHVSLKEDENNSNITRLFREKDDG  MNFTQCHTANIQTLIPTSSETNSRESKGNDITIYGNDFMDLTFNHTLQILPATGNFSEIENQTQNAMDVT  TGYGTKASGNKTVFKSKQNTAFQDLSINSADKIHITRSHIMGAETHIVSQTCNQDARILAMTPESIYSNP  SIQGCKTVFYSSCNDAMEMTKCLSNMREEKNLLKHDSNYSKMYCNPDAMSSLTEKTIYSGEENMDITKSH  TVAIDNQIFKQDQSNVQIAAAPTPEKEMMLQNLMTTSEDGKMNVNCNSVPHVSKERIQQSLSNPLSISLT  DRKTELLSGENMDLTESHTSNLGSQVPLAAYNLAPESTSESHSQSKSSSDECEEITKSRNEPFQRSDIIA  KNSLTDTWNKDKDWVLKILPYLDKDSPQSADCNQEIATSHNIVYCGGVLDKQITNRNTVSWEQSLFSTTK  PLFSSGQFSMKNHDTAISSHTVKSVLGQNSKLAEPLRKSLSNPTPDYCHDKMIICSEEEQNMDLTKSHTV  VIGFGPSELQELGKTNLEHTTGQLTTMNRQIAVKVEKCGKSPIEKSGVLKSNCIMDVLEDESVQKPKFPK  EKQNVKIWGRKSVGGPKIDKTIVFSEDDKNDMDITKSYTIEINHRPLLEKRDCHLVPLAGTSETILYTCG  QDDMEITRSHTTALECKTVSPDEITTRPMDKTVVFVDNHVELEMTESHTVFIDYQEKERTDRPNFELSQR  KSLGTPTVICTPTEESVFFPGNGESDRLVANDSQLTPLEEWSNNRGPVEVADNMELSKSATCKNIKDVQS  PGFLNEPLSSKSQRRKSLKLKNDKTIVFSENHKNDMDITQSCMVEIDNESALEDKEDFHLAGASKTILYS  CGQDDMEITRSHTTALECKTLLPNEIAIRPMDKTVLFTDNYSDLEVTDSHTVFIDCQATEKILEENPKFG  IGKGKNLGVSFPKDNSCVQEIAEKQALAVGNKIVLHTEQKQQLFAATNRTTNEIIKFHSAAMDEKVIGKV  VDQACTLEKAQVESCQLNNRDRRNVDFTSSHATAVCGSSDNYSCLPNVISCTDNLEGSAMLLCDKDEEKA  NYCPVQNDLAYANDFASEYYLESEGQPLSAPCPLLEKEEVIQTSTKGQLDCVITLHKDQDLIKDPRNLLA  NQTLVYSQDLGEMTKLNSKRVSFKLPKDQMKVYVDDIYVIPQPHFSTDQPPLPKKGQSSINKEEVILSKA  GNKSLNIIENSSAPICENKPKILNSEEWFAAACKKELKENIQTTNYNTALDFHSNSDVTKQVIQTHVNAG  EAPDPVITSNVPCFHSIKPNLNNLNGKTGEFLAFQTVHLPPLPEQLLELGNKAHNDMHIVQATEIHNINI  ISSNAKDSRDEENKKSHNGAETTSLPPKTVFKDKVRRCSLGIFLPRLPNKRNCSVTGIDDLEQIPADTTD  INHLETQPVSSKDSGIGSVAGKLNLSPSQYINEENLPVYPDEINSSDSINIETEEKALIETYQKEISPYE  NKMGKTCNSQKRTWVQEEEDIHKEKKIRKNEIKFSDTTQDREIFDHHTEEDIDKSANSVLIKNLSRTPSS  CSSSLDSIKADGTSLDFSTYRSSQMESQFLRDTICEESLREKLQDGRITIREFFILLQVHILIQKPRQSN  LPGNFTVNTPPTPEDLMLSQYVYRPKIQIYREDCEARRQKIEELKLSASNQDKLLVDINKNLWEKMRHCS  DKELKAFGIYLNKIKSCFTKMTKVFTHQGKVALYGKLVQSAQNEREKLQIKIDEMDKILKKIDNCLTEME  TETKNLEDEEKNNPVEEWDSEMRAAEKELEQLKTEEEELQRNLLELEVQKEQTLAQIDFMQKQRNRTEEL  LDQLSLSEWDVVEWSDDQAVFTFVYDTIQLTITFEESVVGFPFLDKRYRKIVDVNFQSLLDEDQAPPSSL  LVHKLIFQYVEEKESWKKTCTTQHQL (SEQ ID NO: 37) >gi|110349759|ref|NP_056286.3| kinetochore-associated protein NSL1 homolog  isoform 1 [Homo sapiens] MAGSPELVVLDPPWDKELAAGTESQALVSATPREDFRVRCTSKRAVTEMLQLCGRFVQKLGDALPEEIRE  PALRDAQWTFESAVQENISINGQAWQEASDNCFMDSDIKVLEDQFDEIIVDIATKRKQYPRKILECVIKT  IKAKQEILKQYHPVVHPLDLKYDPDPAPHMENLKCRGETVAKEISEAMKSLPALIEQGEGFSQVLRMQPV  IHLQRIHQEVFSSCHRKPDAKPENFITQIETTPTETASRKTSDMVLKRKQTKDCPQRKWYPLRPKKINLD   T (SEQ ID NO: 38) >gi|110349761|ref|NP_001036014.1| kinetochore-associated protein NSL1  homolog isoform 2 [Homo sapiens]  MAGSPELVVLDPPWDKELAAGTESQALVSATPREDFRVRCTSKRAVTEMLQLCGRFVQKLGDALPEEIRE  PALRDAQWTFESAVQENISINGQAWQEASDNCFMDSDIKVLEDQFDEIIVDIATKRKQYPRKILECVIKT  IKAKQEILKQYHPVVHPLDLKYDPDPVLNGNAFNFSPFNMMLAVDLSYMVFITSSPSYGKFEMQRGNSSK   GDQ (SEQ ID NO: 39) >gi|223972618|ref|NP_079194.3| kinetochore-associated protein DSN1 homolog  isoform 1 [Homo sapiens] MTSVTRSEIIDEKGPVMSKTHDHQLESSLSPVEVFAKTSASLEMNQGVSEERIHLGSSPKKGGNCDLSHQ  ERLQSKSLHLSPQEQSASYQDRRQSWRRASMKETNRRKSLHPIHQGITELSRSISVDLAESKRLGCLLLS  SFQFSIQKLEPFLRDTKGFSLESFRAKASSLSEELKHFADGLETDGTLQKCFEDSNGKASDFSLEASVAE  MKEYITKFSLERQTWDQLLLHYQQEAKEILSRGSTEAKITEVKVEPMTYLGSSQNEVLNTKPDYQKILQN  QSKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPPAIHGS  GSGSCQ (SEQ ID NO: 40) >gi|223890153|ref|NP_001138790.1| kinetochore-associated protein DSN1  homolog isoform 3 [Homo sapiens] MSKTHDHQLESSLSPVEVFAKTSASLEMNQGVSEERIHLGSSPKKGGNCDLSHQERLQSKSLHLSPQEQS  ASYQDRRQSWRRASMKETNRRKSLHPIHQGITELSRSISVDLAESKRLGCLLLSSFQFSIQKLEPFLRDT  KGFSLESFRAKASSLSEELKHFADGLETDGTLQKCFEDSNGKASDFSLEASVAEMKEYITKFSLERQTWD  QLLLHYQQEAKEILSRGSTEAKITEVKVEPMTYLGSSQNEVLNTKPDYQKILQNQSKVFDCMELVMDELQ  GSVKQLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPPAIHGSGSGSCQ  (SEQ ID NO: 41) >gi|223890151|ref|NP_001138789.1| kinetochore-associated protein DSN1  homolog isoform 2 [Homo sapiens] MTSVTRSEIIDELSRSISVDLAESKRLGCLLLSSFQFSIQKLEPFLRDTKGFSLESFRAKASSLSEELKH  FADGLETDGTLQKCFEDSNGKASDFSLEASVAEMKEYITKFSLERQTWDQLLLHYQQEAKEILSRGSTEA  KITEVKVEPMTYLGSSQNEVLNTKPDYQKILQNQSKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKVS  VQLGKRSMQQLDPSPARKLLKLQLQNPPAIHGSGSGSCQ (SEQ ID NO: 42) >gi|74735330|sp1014777.1| NDC80_HUMAN RecName: Full = Kinetochore protein  NDC80 homolog; AltName: Full = Highly expressed in cancer protein; AltName:  Full = inetochore protein Hecl; Short = HsHec1; AltName: Full = Kinetochore-  associated protein 2; AltName: Full = Retinoblastoma-associated protein HEC  MKRSSVSSGGAGRLSMQELRSQDVNKQGLYTPQTKEKPTFGKLSINKPTSERKVSLFGKRTSGHGSRNSQ  LGIFSSSEKIKDPRPLNDKAFIQQCIRQLCEFLTENGYAHNVSMKSLQAPSVKDFLKIFTFLYGFLCPSY  ELPDTKFEEEVPRIFKDLGYPFALSKSSMYTVGAPHTWPHIVAALVWLIDCIKIHTAMKESSPLFDDGQP  WGEETEDGIMHNKLFLDYTIKCYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIA  RLEQEREKEPNRLESLRKLKASLQGDVQKYQAYMSNLESHSAILDQKLNGLNEEIARVELECETIKQENT  RLQNIIDNQKYSVADIERINHERNELQQTINKLTKDLEAEQQKLWNEELKYARGKEAIETQLAEYHKLAR  KLKLIPKGAENSKGYDFEIKFNPEAGANCLVKYRAQVYVPLKELLNETEEEINKALNKKMGLEDTLEQLN  AMITESKRSVRTLKEEVQKLDDLYQQKIKEAEEEDEKCASELESLEKHKHLLESTVNQGLSEAMNELDAV  QREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKY  EKKATLIKSSEE (SEQ ID NO: 43) >gi|32698866|ref|NP_872319.1| kinetochore protein Spc24 [Homo sapiens] MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEKQLREILTMEKEVAQSLLNAK  EQVHQGGVELQQLEAGLQEAGEEDTRLKASLLQLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVA  QLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEW (SEQ ID NO: 44) >gi|48146511|emb|CAG33478.1| Spc25 [Homo sapiens] MVEDELALFDKSINEFWNKFKSTDTSCQMAGLRDTYKDSIKAFAEKLSVKLKEEERMVEMFLEYQNQISR  QNKLIQEKKDNLLKLIAEVKGKKQELEVLTANIQDLKEEYSRKKETISTANKANAERLKRLQKSADLYKD  RLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAF  LANVRKAFTATVYN (SEQ ID NO: 45) >gi|115311829|sp|Q9BZD4.2| NUF2_HUMAN RecName: Full = Kinetochore protein  Nuf2; Short = hNuf2; Short = hNuf2R; Short = hsNuf2; AltName: Full = Cell division  cycle-associated protein 1  METLSFPRYNVAEIVIHIRNKILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVN  SEVMYPHLMEGFLPFSNLVTHLDSFLPICRVNDFETADILCPKAKRTSRFLSGIINFIHFREACRETYME  FLWQYKSSADKMQQLNAAHQEALMKLERLDSVPVEEQEEFKQLSDGIQELQQSLNQDFHQKTIVLQEGNS  QKKSNISEKTKRLNELKLSVVSLKEIQESLKTKIVDSPEKLKNYKEKMKDTVQKLKNARQEVVEKYEIYG  DSVDCLPSCQLEVQLYQKKIQDLSDNREKLASILKESLNLEDQIESDESELKKLKTEENSFKRLMIVKKE  KLATAQFKINKKHEDVKQYKRTVIEDCNKVQEKRGAVYERVTTINQEIQKIKLGIQQLKDAAEREKLKSQ  EIFLNLKTALEKYHDGIEKAAEDSYAKIDEKTAELKRKMFKMST (SEQ ID NO: 46)

(186) Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, one of skill in the art will appreciate that certain changes and modifications may be practiced within the scope of the appended claims. In addition, each reference provided herein is incorporated by reference in its entirety to the same extent as if each reference was individually incorporated by reference.