Modified Zika virus NS1 protein with reduced cross-reactive immunogenicity
11434259 · 2022-09-06
Assignee
Inventors
Cpc classification
C12N2770/24122
CHEMISTRY; METALLURGY
C12N2770/24134
CHEMISTRY; METALLURGY
C07K16/1081
CHEMISTRY; METALLURGY
A61K39/00
HUMAN NECESSITIES
C07K2319/30
CHEMISTRY; METALLURGY
C07K14/1825
CHEMISTRY; METALLURGY
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
C12N2770/36134
CHEMISTRY; METALLURGY
A61K39/015
HUMAN NECESSITIES
International classification
A61K39/00
HUMAN NECESSITIES
Abstract
The present invention relates to vaccine compositions and therapeutic interventions for treating and preventing infections and diseases caused by flaviviruses, including Zika, dengue, and Usutu virus. It also relates to compositions and methods for diagnosis and differential diagnosis of flaviviruses and co-endemic pathogens.
Claims
1. An isolated, non-naturally occurring Zika virus NS1 polypeptide having an amino acid sequence wherein the B-cell epitope STTAS (SEQ ID NO:702) is modified through deletion or mutation and is no longer capable of inducing a cross-reactive immune response with the human spindle-like microcephaly associated protein (ASPM).
2. The synthetic polypeptide of claim 1, wherein said NS1 polypeptide comprises an amino acid sequence selected from the group consisting of amino acids 21 to 384 of SEQ ID NO:441 and amino acids 21 to 213 of SEQ ID NO:445.
3. A fusion protein comprising the synthetic polypeptide sequences of claim 1.
4. The fusion protein of claim 3, wherein said fusion protein comprises a peptide sequence selected from the group consisting a signal sequence, a linker sequence, a purification tag sequence and an immunoglobulin sequence in operable association with said synthetic polypeptide, wherein said peptide sequence selected from the group consisting of a signal sequence, a linker sequence, a purification tag sequence and an immunoglobulin sequence is exogenous to said synthetic polypeptide sequence.
5. An immunogenic composition comprising a synthetic polypeptide of claim 1 and a pharmaceutically acceptable carrier.
6. The immunogenic composition of claim 5, further comprising an adjuvant.
Description
DESCRIPTION OF THE FIGURES
(1)
(2)
(3)
(4)
(5) A: From Cavalcanti et al, Journal of Infection in Developing Countries, 2016 Distribution of reported Zika microcephaly cases in Brazil. B. Distribution of P. falciparum distribution in Brazil. C. Distribution of P. falciparum distribution globally.
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
(36)
(37)
DEFINITIONS
(38) As used herein, the term “genome” refers to the genetic material (e.g., chromosomes) of an organism or a host cell.
(39) As used herein, the term “proteome” refers to the entire set of proteins expressed by a genome, cell, tissue or organism. A “partial proteome” refers to a subset the entire set of proteins expressed by a genome, cell, tissue or organism. Examples of “partial proteomes” include, but are not limited to, transmembrane proteins, secreted proteins, and proteins with a membrane motif. Human proteome refers to all the proteins comprised in a human being. Multiple such sets of proteins have been sequenced and are accessible at the InterPro international repository (ebi.ac.uk/interpro). Human proteome is also understood to include those proteins and antigens thereof which may be over-expressed in certain pathologies, or expressed in a different isoforms in certain pathologies. Hence, as used herein, tumor associated antigens are considered part of the human proteome.
(40) As used herein, the terms “protein,” “polypeptide,” and “peptide” refer to a molecule comprising amino acids joined via peptide bonds. In general “peptide” is used to refer to a sequence of 20 or less amino acids and “polypeptide” is used to refer to a sequence of greater than 20 amino acids.
(41) As used herein, the term, “synthetic polypeptide,” “synthetic peptide” and “synthetic protein” refer to peptides, polypeptides, and proteins that are produced by a recombinant process (i.e., expression of exogenous nucleic acid encoding the peptide, polypeptide or protein in an organism, host cell, or cell-free system) or by chemical synthesis.
(42) As used herein, the term “protein of interest” refers to a protein encoded by a nucleic acid of interest. It may be applied to any protein to which further analysis is applied or the properties of which are tested or examined. Similarly, as used herein, “target protein” may be used to describe a protein of interest that is subject to further analysis.
(43) As used herein “peptidase” refers to an enzyme which cleaves a protein or peptide. The term peptidase may be used interchangeably with protease, proteinases, oligopeptidases, and proteolytic enzymes. Peptidases may be endopeptidases (endoproteases), or exopeptidases (exoproteases). Similarly, the term peptidase inhibitor may be used interchangeably with protease inhibitor or inhibitor of any of the other alternate terms for peptidase.
(44) As used herein, the term “exopeptidase” refers to a peptidase that requires a free N-terminal amino group, C-terminal carboxyl group or both, and hydrolyses a bond not more than three residues from the terminus. The exopeptidases are further divided into aminopeptidases, carboxypeptidases, dipeptidyl-peptidases, peptidyl-dipeptidases, tripeptidyl-peptidases and dipeptidases.
(45) As used herein, the term “endopeptidase” refers to a peptidase that hydrolyses internal, alpha-peptide bonds in a polypeptide chain, tending to act away from the N-terminus or C-terminus. Examples of endopeptidases are chymotrypsin, pepsin, papain and cathepsins. A very few endopeptidases act a fixed distance from one terminus of the substrate, an example being mitochondrial intermediate peptidase. Some endopeptidases act only on substrates smaller than proteins, and these are termed oligopeptidases. An example of an oligopeptidase is thimet oligopeptidase. Endopeptidases initiate the digestion of food proteins, generating new N- and C-termini that are substrates for the exopeptidases that complete the process. Endopeptidases also process proteins by limited proteolysis. Examples are the removal of signal peptides from secreted proteins (e.g. signal peptidase I) and the maturation of precursor proteins (e.g. enteropeptidase, furin). In the nomenclature of the Nomenclature Committee of the International Union of Biochemistry and Molecular Biology (NC-IUBMB) endopeptidases are allocated to sub-subclasses EC 3.4.21, EC 3.4.22, EC 3.4.23, EC 3.4.24 and EC 3.4.25 for serine-, cysteine-, aspartic-, metallo- and threonine-type endopeptidases, respectively. Endopeptidases of particular interest are the cathepsins, and especially cathepsin B, L and S known to be active in antigen presenting cells.
(46) As used herein, the term “immunogen” refers to a molecule which stimulates a response from the adaptive immune system, which may include responses drawn from the group comprising an antibody response, a cytotoxic T cell response, a T helper response, and a T cell memory. An immunogen may stimulate an upregulation of the immune response with a resultant inflammatory response, or may result in down-regulation or immunosuppression. Thus, the T-cell response may be a T regulatory response. An immunogen also may stimulate a B-cell response and lead to an increase in antibody titer.
(47) As used herein, the term “native” (or “wild type”) when used in reference to a protein refers to proteins encoded by the genome of a cell, tissue, or organism, other than one manipulated to produce synthetic proteins.
(48) As used herein the term “epitope” refers to a peptide sequence which elicits an immune response, from either T cells or B cells or antibody.
(49) As used herein, the term “B-cell epitope” refers to a polypeptide sequence that is recognized and bound by a B-cell receptor. A B-cell epitope may be a linear peptide or may comprise several discontinuous sequences which together are folded to form a structural epitope. Such component sequences which together make up a B-cell epitope are referred to herein as B-cell epitope sequences. Hence, a B-cell epitope may comprise one or more B-cell epitope sequences. Hence, a B cell epitope may comprise one or more B-cell epitope sequences. A linear B-cell epitope may comprise as few as 2-4 amino acids or more amino acids.
(50) As used herein, the term “predicted B-cell epitope” refers to a polypeptide sequence that is predicted to bind to a B-cell receptor by a computer program, for example, as described in PCT US2011/029192, PCT US2012/055038, and US2014/014523, each of which is incorporated herein by reference, and in addition by Bepipred (Larsen, et al., Immunome Research 2:2, 2006) and others as referenced by Larsen et al (ibid) (Hopp T et al PNAS 78:3824-3828, 1981; Parker J et al, Biochem. 25:5425-5432, 1986). A predicted B-cell epitope may refer to the identification of B-cell epitope sequences forming part of a structural B-cell epitope or to a complete B-cell epitope. In some usages herein B cell epitope is abbreviated to BEPI.
(51) B cell epitopes are indicated in tables and graphics using an inverted scale in which most negative numbers are indicative of highest binding in standard deviation units. This is for convenience to allow graphics to be plotted containing MHC binding and BEPI probability.
(52) As used herein, the term “T-cell epitope” refers to a polypeptide sequence which when bound to a major histocompatibility protein molecule provides a configuration recognized by a T-cell receptor. Typically, T-cell epitopes are presented bound to a MEW molecule on the surface of an antigen-presenting cell.
(53) As used herein, the term “predicted T-cell epitope” refers to a polypeptide sequence that is predicted to bind to a major histocompatibility protein molecule by the neural network algorithms described herein, by other computerized methods, or as determined experimentally.
(54) As used herein, the term “major histocompatibility complex (MHC)” refers to the MHC Class I and MEW Class II genes and the proteins encoded thereby. Molecules of the MEW bind small peptides and present them on the surface of cells for recognition by T-cell receptor-bearing T-cells. The MHC-Is both polygenic (there are several MHC class I and MEW class II genes) and polyallelic or polymorphic (there are multiple alleles of each gene). The terms MHC-I, MHC-1 and MHC-2 are variously used herein to indicate these classes of molecules. Included are both classical and nonclassical MHC molecules. An MHC molecule is made up of multiple chains (alpha and beta chains) which associate to form a molecule. The MHC molecule contains a cleft or groove which forms a binding site for peptides. Peptides bound in the cleft or groove may then be presented to T-cell receptors. The term “MHC binding region” refers to the groove region of the MEW molecule where peptide binding occurs.
(55) As used herein, a “MHC II binding groove” refers to the structure of an MEW molecule that binds to a peptide. The peptide that binds to the MEW II binding groove may be from about 11 amino acids to about 23 amino acids in length, but typically comprises a 15-mer. The amino acid positions in the peptide that binds to the groove are numbered based on a central core of 9 amino acids numbered 1-9, and positions outside the 9 amino acid core numbered as negative (N terminal) or positive (C terminal). Hence, in a 15mer the amino acid binding positions are numbered from −3 to +3 or as follows: −3, −2, −1, 1, 2, 3, 4, 5, 6, 7, 8, 9, +1, +2, +3.
(56) As used herein, the term “polypeptide sequence that binds to at least one major histocompatibility complex (MHC) binding region” refers to a polypeptide sequence that is recognized and bound by one or more particular MHC binding regions as predicted by the neural network algorithms described herein or as determined experimentally.
(57) As used herein, the term “affinity” refers to a measure of the strength of binding between two members of a binding pair, for example, an antibody and an epitope and an epitope and a MHC-I or II haplotype. K.sub.d is the dissociation constant and has units of molarity. The affinity constant is the inverse of the dissociation constant. An affinity constant is sometimes used as a generic term to describe this chemical entity. It is a direct measure of the energy of binding. The natural logarithm of K is linearly related to the Gibbs free energy of binding through the equation ΔG.sub.0=−RT LN(K) where R=gas constant and temperature is in degrees Kelvin. Affinity may be determined experimentally, for example by surface plasmon resonance (SPR) using commercially available Biacore SPR units (GE Healthcare) or in silico by methods such as those described herein in detail. Affinity may also be expressed as the ic50 or inhibitory concentration 50, that concentration at which 50% of the peptide is displaced. Likewise ln(ic50) refers to the natural log of the ic50.
(58) The term “K.sub.off”, as used herein, is intended to refer to the off rate constant, for example, for dissociation of an antibody from the antibody/antigen complex, or for dissociation of an epitope from an MHC haplotype.
(59) The term “K.sub.d”, as used herein, is intended to refer to the dissociation constant (the reciprocal of the affinity constant “Ka”), for example, for a particular antibody-antigen interaction or interaction between an epitope and an MHC haplotype.
(60) As used herein, the terms “strong binder” and “strong binding” and “High binder” and “high binding” or “high affinity” refer to a binding pair or describe a binding pair that have an affinity of greater than 2×10.sup.7M.sup.−1 (equivalent to a dissociation constant of 50 nM Kd)
(61) As used herein, the term “moderate binder” and “moderate binding” and “moderate affinity” refer to a binding pair or describe a binding pair that have an affinity of from 2×10.sup.7M.sup.−1 to 2×10.sup.6M.sup.−1.
(62) As used herein, the terms “weak binder” and “weak binding” and “low affinity” refer to a binding pair or describe a binding pair that have an affinity of less than 2×10.sup.6M.sup.−1 (equivalent to a dissociation constant of 500 nM Kd)
(63) Binding affinity may also be expressed by the standard deviation from the mean binding found in the peptides making up a protein. Hence a binding affinity may be expressed as “−1σ” or <−1σ, where this refers to a binding affinity of 1 or more standard deviations below the mean. A common mathematical transformation used in statistical analysis is a process called standardization wherein the distribution is transformed from its standard units to standard deviation units where the distribution has a mean of zero and a variance (and standard deviation) of 1. Because each protein comprises unique distributions for the different MHC alleles standardization of the affinity data to zero mean and unit variance provides a numerical scale where different alleles and different proteins can be compared. Analysis of a wide range of experimental results suggest that a criterion of standard deviation units can be used to discriminate between potential immunological responses and non-responses. An affinity of 1 standard deviation below the mean was found to be a useful threshold in this regard and thus approximately 15% (16.2% to be exact) of the peptides found in any protein will fall into this category.
(64) The terms “specific binding” or “specifically binding” when used in reference to the interaction of an antibody and a protein or peptide or an epitope and an MHC haplotype means that the interaction is dependent upon the presence of a particular structure (i.e., the antigenic determinant or epitope) on the protein; in other words, the antibody is recognizing and binding to a specific protein structure rather than to proteins in general. For example, if an antibody is specific for epitope “A,” the presence of a protein containing epitope A (or free, unlabeled A) in a reaction containing labeled “A” and the antibody will reduce the amount of labeled A bound to the antibody.
(65) As used herein, the term “antigen binding protein” refers to proteins that bind to a specific antigen. “Antigen binding proteins” include, but are not limited to, immunoglobulins, including polyclonal, monoclonal, chimeric, single chain, and humanized antibodies, Fab fragments, F(ab′)2 fragments, and Fab expression libraries. Various procedures known in the art are used for the production of polyclonal antibodies. For the production of antibody, various host animals can be immunized by injection with the peptide corresponding to the desired epitope including but not limited to rabbits, mice, rats, sheep, goats, etc. Various adjuvants are used to increase the immunological response, depending on the host species, including but not limited to Freund's (complete and incomplete), mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanins, dinitrophenol, and potentially useful human adjuvants such as BCG (Bacille Calmette-Guerin) and Corynebacterium parvum.
(66) For preparation of monoclonal antibodies, any technique that provides for the production of antibody molecules by continuous cell lines in culture may be used (See e.g., Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.). These include, but are not limited to, the hybridoma technique originally developed by Köhler and Milstein (Köhler and Milstein, Nature, 256:495-497 [1975]), as well as the trioma technique, the human B-cell hybridoma technique (See e.g., Kozbor et al., Immunol. Today, 4:72 [1983]), and the EBV-hybridoma technique to produce human monoclonal antibodies (Cole et al., in Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc., pp. 77-96 [1985]). In other embodiments, suitable monoclonal antibodies, including recombinant chimeric monoclonal antibodies and chimeric monoclonal antibody fusion proteins are prepared as described herein.
(67) According to the invention, techniques described for the production of single chain antibodies (U.S. Pat. No. 4,946,778; herein incorporated by reference) can be adapted to produce specific single chain antibodies as desired. An additional embodiment of the invention utilizes the techniques known in the art for the construction of Fab expression libraries (Huse et al., Science, 246:1275-1281 [1989]) to allow rapid and easy identification of monoclonal Fab fragments with the desired specificity.
(68) Antibody fragments that contain the idiotype (antigen binding region) of the antibody molecule can be generated by known techniques. For example, such fragments include but are not limited to: the F(ab′)2 fragment that can be produced by pepsin digestion of an antibody molecule; the Fab′ fragments that can be generated by reducing the disulfide bridges of an F(ab′)2 fragment, and the Fab fragments that can be generated by treating an antibody molecule with papain and a reducing agent.
(69) Genes encoding antigen-binding proteins can be isolated by methods known in the art. In the production of antibodies, screening for the desired antibody can be accomplished by techniques known in the art (e.g., radioimmunoassay, ELISA (enzyme-linked immunosorbant assay), “sandwich” immunoassays, immunoradiometric assays, gel diffusion precipitin reactions, immunodiffusion assays, in situ immunoassays (using colloidal gold, enzyme or radioisotope labels, for example), Western Blots, precipitation reactions, agglutination assays (e.g., gel agglutination assays, hemagglutination assays, etc.), complement fixation assays, immunofluorescence assays, protein A assays, and immunoelectrophoresis assays, etc.) etc.
(70) As used herein “immunoglobulin” means the distinct antibody molecule secreted by a clonal line of B cells; hence when the term “100 immunoglobulins” is used it conveys the distinct products of 100 different B-cell clones and their lineages.
(71) As used herein, the term “vector,” when used in relation to recombinant DNA technology, refers to any genetic element, such as a plasmid, phage, transposon, cosmid, chromosome, retrovirus, virion, etc., which is capable of replication when associated with the proper control elements and which can transfer gene sequences between cells. Thus, the term includes cloning and expression vehicles, as well as viral vectors.
(72) As used herein, the term “vector” when used in relation to transmission of an arbovirus refers to the intermediate host of a virus, such as a mosquito or tick or other arthropod.
(73) As used herein, the term “host cell” refers to any eukaryotic cell (e.g., mammalian cells, avian cells, amphibian cells, plant cells, fish cells, insect cells, yeast cells), and bacteria cells, and the like, whether located in vitro or in vivo (e.g., in a transgenic organism).
(74) As used herein, the term “cell culture” refers to any in vitro culture of cells. Included within this term are continuous cell lines (e.g., with an immortal phenotype), primary cell cultures, finite cell lines (e.g., non-transformed cells), and any other cell population maintained in vitro, including oocytes and embryos.
(75) The term “isolated” when used in relation to a nucleic acid, as in “an isolated oligonucleotide” refers to a nucleic acid sequence that is identified and separated from at least one contaminant nucleic acid with which it is ordinarily associated in its natural source. Isolated nucleic acids are nucleic acids present in a form or setting that is different from that in which they are found in nature. In contrast, non-isolated nucleic acids are nucleic acids such as DNA and RNA that are found in the state in which they exist in nature.
(76) The terms “in operable combination,” “in operable order,” and “operably linked” as used herein refer to the linkage of nucleic acid sequences in such a manner that a nucleic acid molecule capable of directing the transcription of a given gene and/or the synthesis of a desired protein molecule is produced. The term also refers to the linkage of amino acid sequences in such a manner so that a functional protein is produced.
(77) A “subject” is an animal such as vertebrate, preferably a mammal such as a human, or a bird, or a fish. Mammals are understood to include, but are not limited to, murines, simians, humans, bovines, ovines, cervids, equines, porcines, canines, felines etc.).
(78) An “effective amount” is an amount sufficient to effect beneficial or desired results. An effective amount can be administered in one or more administrations,
(79) As used herein, the term “purified” or “to purify” refers to the removal of undesired components from a sample. As used herein, the term “substantially purified” refers to molecules, either nucleic or amino acid sequences, that are removed from their natural environment, isolated or separated, and are at least 60% free, preferably 75% free, and most preferably 90% free from other components with which they are naturally associated. An “isolated polynucleotide” is therefore a substantially purified polynucleotide.
(80) “Strain” as used herein in reference to a microorganism describes an isolate of a microorganism (e.g., bacteria, virus, fungus, parasite) considered to be of the same species but with a unique genome and, if nucleotide changes are non-synonymous, a unique proteome differing from other strains of the same organism. Typically strains may be the result of isolation from a different host or at a different location and time but multiple strains of the same organism may be isolated from the same host.
(81) “Affinity maturation” is the molecular evolution that occurs during somatic hypermutation during which unique variable region sequences generated that are the best at targeting and neutralizing and antigen become clonally expanded and dominate the responding cell populations.
(82) “uTOPE™ analysis” as used herein refers to the computer assisted processes for predicting binding of peptides to MHC and predicting cathepsin cleavage, described in PCT US2011/029192, PCT US2012/055038, and US2014/01452, each of which is incorporated herein by reference.
(83) “Isoform” as used herein refers to different forms of a protein which differ in a small number of amino acids. The isoform may be a full length protein (i.e., by reference to a reference wild-type protein or isoform) or a modified form of a partial protein, i.e., be shorter in length than a reference wild-type protein or isoform.
(84) “Immunostimulation” as used herein refers to the signaling that leads to activation of an immune response, whether said immune response is characterized by a recruitment of cells or the release of cytokines which lead to suppression of the immune response. Thus immunostimulation refers to both upregulation or down regulation.
(85) “Up-regulation” as used herein refers to an immunostimulation which leads to cytokine release and cell recruitment tending to eliminate a non-self or exogenous epitope. Such responses include recruitment of T cells, including effectors such as cytotoxic T cells, and inflammation. In an adverse reaction upregulation may be directed to a self-epitope.
(86) “Down regulation” as used herein refers to an immunostimulation which leads to cytokine release that tends to dampen or eliminate a cell response. In some instances such elimination may include apoptosis of the responding T cells.
(87) “IGHV” as used herein is an abbreviation for immunoglobulin heavy chain variable regions
(88) “IGLV” as used herein is an abbreviation for immunoglobulin light chain variable regions “Adverse immune response” as used herein may refer to (a) the induction of immunosuppression when the appropriate response is an active immune response to eliminate a pathogen or tumor or (b) the induction of an upregulated active immune response to a self-antigen or (c) an excessive up-regulation unbalanced by any suppression, as may occur for instance in an allergic response.
(89) As used herein “epitope mimic” describes a peptide that is present and elicits an immune response in one protein (e.g., source protein) and the humoral and cellular effectors of that immune response then recognize and act upon the same peptide motif where it occurs in a different protein (e.g., target protein). For example, an antibody which is elicited by a B cell epitope in a microorganism and which binds to a B cell epitope peptide derived from a human protein would be said to have found an epitope mimic. Epitope mimics are those peptide motifs which have a high probability of being a B cell epitope both in the protein which elicits the antibody response and in the target protein to which said antibody binds. Peptides forming such B cell epitope mimics are typically in the top 25% of probability of being B cell epitopes within the protein. In some embodiments, epitope mimics are an important mechanism in autoimmunity. An “epitope mimic motif” as used herein is the amino acid motif comprising an epitope mimic. In some preferred cases the epitope mimic motif is a pentamer. An “epitope mimic sequence” as used herein is a nucleotide or amino acid sequence which comprises an epitope mimic.
(90) As used herein “TCEM mimic” is used to describe a peptide which has an identical or overlapping TCEM, but may have a different GEM. Such a mimic occurring in one protein may induce an immune response directed towards another protein which carries the same TCEM motif. This may give rise to autoimmunity or inappropriate responses to the second protein.
(91) “Anchor peptide”, as used herein, refers to peptides or polypeptides which allow binding to a substrate to facilitate purification or which facilitate attachment to a solid medium such as a bead or plastic dish or are capable of insertion into a membrane of a cell or liposome or virus like particle or other nanoparticle. Among the examples of anchor peptides are the following, which are considered non-limiting, his tags, immunoglobulins, Fc region of immunoglobulin, G coupled protein, receptor ligand, biotin, and FLAG tags. In some instances, an anchor peptide is designed to be cleavable following exposure to an endopeptidase in vitro or in vivo.
(92) “Label peptide” as used herein refers to a peptide or polypeptide which provides, either directly or by a ligated residue, a colorimetric, fluorescent, radiation emitting, light emitting, metallic or radiopaque signal which can be used to identify the location of said peptide. Among the non-limiting examples of such label peptides are streptavidin, fluorescein, luciferase, gold, ferritin, tritium,
(93) “MHC subunit chain” as used herein refers to the alpha and beta subunits of MHC molecules. A MHC II molecule is made up of an alpha chain which is constant among each of the DR, DP, and DQ variants and a beta chain which varies by allele. The MHC I molecule is made up of a constant beta macroglobulin and a variable MHC A, B or C chain.
(94) As used herein an “immunostimulant” may refer to an adjuvant, including but not limited to Freunds adjuvant, inorganic compounds (e.g., alum, aluminum hydroxide, aluminum phosphate, calcium phosphate hydroxide), mineral oil (e.g., paraffin oil), bacterial products (e.g., killed bacteria, Bordetella pertussis, Mycobacterium bovis, toxoids), nonbacterial organics (e.g., squalene, thimerosal), detergents (e.g., Quil A), plant saponins from quillaja, soybean, polygala senega, cytokines (e.g., IL-1, IL-2, IL-12), and food Based oil (e.g., adjuvant 65).
(95) A used herein the term “domain”, when used herein to describe the domains of flavivirus envelopes, refers to structural domains as characterized in crystal structures (e.g., crystal structures for tick borne encephalitis and Japanese encephalitis viruses [11, 12]).
(96) “Neural and neurologic proteins,” as used herein, refers to proteins within the human proteome, which have been identified as having a function in the nervous system in development or function. Included among such proteins, but not limited to these examples, are those which have the term neural, neuron, neuronal, neurologic, neurotropic, neurotropin, neuropeptide, neurogenic, glial, synaptic, and neurite in their curation at Uniprot (uniprot.org). Proteins are described by their Uniprot identifies in the tables included herein. Glycoprotein M6A and Glial fibrillary acidic protein are also included herein. While described by use of the identifiers for human proteins the defined term is intended to also include close homologues from other species. In some embodiments, such proteins are those identified in a key word search of the complete Human proteome Uniprot curation by search for the terms “neur”, “synapt” and “glial” contained in their names. As used herein the term neural and neurologic proteins refers not only to mature processed forms of the proteins but also to precursor forms of said proteins, including but not limited to propeptide and prepropeptide forms.
(97) “Microencephaly” and “microcephaly” as used herein describes a condition of fetuses and neonates in which part or all of the brain is absent and the cranium is reduced in size at birth.
(98) “Guillain Barré syndrome,” abbreviated as GBS, as used herein refers to a complex of symptoms, which include peripheral neuropathy affecting motor, sensitive and autonomic nerves and spinal roots causing acute, or subacute, progressive motor weakness sometimes advancing to respiratory paralysis. GBS is an autoimmune disease and has been noted following various infections, including influenza, Campylobacter, dengue and Zika virus. Although symptomatology is shared, GBS may have various pathogeneses, with different immune responses directed to different self proteins.
(99) “Flaviviruses” as used herein refers to the taxonomic group of viruses of that name [4]. Abbreviations are used for several flaviviruses including but not limited to Japanese encephalitis JEV or JAEV, West Nile Virus WNV, Tick Borne encephalitis TBEV, yellow fever YF, dengue DEN, Saint Louis encephalitis virus, SLE, hepatitis C HEPC, Usutu USUV, and Zika virus ZIKV
(100) “Microbiocide” as used herein refers to a composition which may be a peptide, polypeptide or enzyme or small molecule which acts on a microorganism to inhibit its replication or cause lethal structural damage. Microbiocides include but are not limited to bactericides, virucides, and fungicides.
(101) “Cytotoxin” or “cytocide” as used herein refers to a peptide or polypeptide which is toxic to cells and which causes cell death. Among the non-limiting examples of such polypeptides are RNAses, phospholipase, membrane active peptides such as cercropin, and diphtheria toxin. Cytotoxin also includes radionuclides which are cytotoxic such as alpha emitters or Auger particles.
(102) “Cytokine” as used herein refers to a protein which is active in cell signaling and may include, among other examples, chemokines, interferons, interleukins, lymphokines, granulocyte colony-stimulating factor tumor necrosis factor and programmed death proteins.
(103) As used herein the term “Alpha emitter” refers to a radioisotope which emits alpha radiation. Examples of alpha emitters which may be suitable for clinical use include, but are not limited to, Astatine-211, Bismuth-212, Bismuth-213, Actinium-225 Radium-223, Terbium-149, Fermium-255
(104) As used herein “Auger particles” refers to the low energy electrons emitted by radionuclides such as but not limited to, Gadolinium-67, Technicium-99, Indium-111, Iodine-123, Iodine-125, Tellurium-201. Auger electrons are advantageous as they have a short path of transit through tissue.
(105) As used herein a “scrambled peptide” or “scrambled mimic” refers to a peptide in which the amino acids have been exchanged in positions. Thus, ACDEF is an example of a scrambled peptide of FDCEA. A “scrambled peptide” or “scrambled mimic” also refers to a peptide in which an epitope mimic has been removed by substituting one or more amino acids.
(106) As used herein the term “Zika fetal syndrome” refers to one or more abnormalities in a fetus borne by a mother infected by Zika virus, or in a child resulting from such a pregnancy. Zika fetal syndrome includes, but is not limited to, spontaneous abortion, fetal death, fetal growth retardation, amniotic insufficiency, microcephaly, optical lesions, and neurologic defects detected post partum.
(107) As used herein the term “Neuropeptide Y” is used to refer to the full proneuropeptide of 69 amino acids as well as to the mature neuropeptide Y of 36 amino acids. Human neuropeptide Y is encoded as a prepropeptide comprising a signal peptide of 28 amino acids, a neuropeptide Y mature peptide of 36 amino acids, a 3 amino acid linker and a 30 amino acid carboxyterminal flanking peptide (CPON)[5]. In some embodiments, an epitope mimic for Zika is identified in the CPON component and for dengue 3 in the mature NPY component. In some embodiments the 3 amino acid cleavage sequence glycine-lysine-arginine is mutated to prevent cleavage and retain the full length 69 amino acid propeptide.
(108) As used herein “microcephaly associated protein” refers to a protein which contains the term microcephaly in the UniProt description of its functions or pathological associations. Microcephaly associated proteins include but are not limited to proteins encoded by the following genes: MCPH1, Microcephalin, MCPH2, WDR62, MCPH3, CDK5RAP2, MCPH4, CASC5, MCPH5, ASPM, MCPH6, CENPJ, MCPH7, STIL, MCPH8, CEP135, MCPH9, CEP152, MCPH10, ZNF335, MCPH11, PHC1, MCPH12, and CDK6.
(109) “Abnormal spindle like microcephaly associated protein” also known as “abnormal spindle like primary microcephaly protein” or “ASPM” refers to the protein designated as Uniprot Q8IZT6, and identified as having a role in mitotic spindle regulation.
(110) As used herein the proteins comprising the polyprotein of Zika virus may be abbreviated as follows Capsid as “caps” or “C”, Propeptide membrane as “PrM”, envelope as “Env” or “E” and the nonstructural proteins as NS1, NS2A, NS2B, NS3, NS4A, NS4B, and NS5.
(111) As used herein the term “pan flavivirus epitope” and “pan flavivirus antibody” refer to epitopes, and antibodies that are directed to them, which cross react between the serotypes of dengue, Zika and Yellow fever, and in some cases with other flaviviruses. These include but are not limited to epitopes located in the envelope protein fusion loop, in the region comprising amino acids DRGWGN.
(112) As used herein the term “Antibody dependent enhancement” or “ADE” refers to the phenomenon described by Halstead et al [6, 7] in which sub-neutralizing antibodies aid in uptake of virus and thus increase the replication of virus leading to more severed disease. ADE appears to depend largely on pan flavivirus antibodies [8].
(113) As used herein the term “malaria” refers to members of the apicomplexan genus Plasmodium, and in particular to those species which cause clinical disease in humans including but not limited to Plasmodium falciparum, P. vivax, P. malariae and P. ovale.
(114) As used herein all designations of malaria protein identification follow the Plasmodium Genomics Resource at plasmoDB.org and correspond to the identities shown as of 5 Aug. 2016, at which time Release 28 was in effect.
(115) As used herein “ADAMTS13” and “A disintegrin and metalloproteinase with thrombospondin motifs 13” are used interchangeably and refer to the protein described in UniProt as ATS13 at uniprot.org/uniprot/ATS13_HUMAN and as further described in comparison with other related disintegrin and metalloproteinases by Porter et al [17]
(116) As used herein “cardiovascular function proteins” are those curated in UniProt to have a role in the cardiovascular system structure and function, in blood flow, clotting, hemorrhage or expressed in any vascular cell, endothelial cell, platelet, or erythrocyte. More particularly the proteins encompassed in this category are those which are curated because they include a key word included in Table 28.
(117) The term “virus-like particle” as used herein, refers to a non-infective viral subunit either with, or without, viral proteins. For example, a virus-like particle may completely lack the DNA or RNA genome. Further, a virus-like particle comprising viral capsid proteins may undergo spontaneous self-assembly. Preparations of virus-like particles are contemplated in one embodiment, where the preparation is purified free of infectious virions (or at least substantially free, such that the preparation has insufficient numbers to be infectious). Thus, the term “virus-like particle” and “VLP” includes a non-replicating viral shell that resembles live virus in external conformation. Methods for producing and characterizing recombinantly produced VLPs have been described for VLPs from several viruses, including human papilloma virus type 1 (Hagnesee et al. (1991) J. Virol. 67:315), human papilloma virus type 16 (Kirnbauer et al. Proc. Natl. Acad. Sci. (1992)89:12180), HIV-1 (Haffer et al., (1990) J. Virol. 64:2653), and hepatitis A (Winokur (1991) 65:5029). Additional methods for expressing VLPs that contain Newcastle Disease virus proteins are provided by Pantua et al. (2006) J. Virol. 80:11062-11073.
DESCRIPTION OF THE INVENTION
(118) Zika virus is a flavivirus, first isolated in the Zika forest of Uganda in 1947 [18]. It is closely related to Spondewi virus, dengue, yellow fever, Japanese encephalitis virus, tick borne encephalitis virus, and West Nile virus [13]. In endemic areas, the Zika virus is transmitted by several species of Aedes mosquitoes, most particularly by Aedes aegypti and Aedes albopictus [18, 19]. Traditionally endemic in Africa and South East Asia [18], the Zika virus was isolated in French Polynesia in 2013 and 2014, where it was observed to be associated with cases of neonatal microencephaly and with Guillain Barré syndrome (GBS) [20]. In 2014 or late 2015 Zika virus was introduced into Brazil, a country where it had not previously been reported and where the population was fully naïve to infection [21]. It has since spread to most of Central and northern South America and the Caribbean (Centers for Disease Control and Prevention. Zika Virus, For Health Care Providers: Clinical Evaluation & Disease. 2015 Available from: cdc.gov/zika/hc-providers/clinicalevaluation.html. In August, 2016 autochthonous spread of Zika was confirmed in Florida and has now also been detected in Texas.
(119) Primary Zika infection in healthy individuals is a minor disease causing a rash and fever of few days duration, with no deaths reported [1]. When Zika infects pregnant women in the first or second trimester, from 6-25% of livebirths are of microencephalitic infants [22, 23]. In addition, a rapid rise in the number of GBS cases has occurred the epidemic area, in some areas with a high mortality reported [24, 25]. While other flaviviruses are neurotropic, especially WNV, JEV, and TBEV, microencephaly and GBS are not reported following infection by these viruses. GBS has been reported sporadically following dengue infection [26]. While the introduction of Zika virus into an immunologically naïve population may well result in clinical signs that differ from those in endemic areas, there has been no clear explanation for the pathogenesis observed. Microencephaly is reported in other viral infections such as cytomegalovirus and rubella, but not for other flavivirus infections.
(120) A particular puzzle has been why cases of severe Zika disease emerged as the virus spread outside the endemic zone of Africa and Southeast Asia, where the virus has been recognized for decades with no reports of microcephaly or GBS. These complications first appeared in French Polynesia. Microcephaly, encephalitis, and GBS have been reported in Martinique [27, 28]. Many reports of clinical Zika disease have come from patients returning home to northern countries (Europe, US etc.) from visits to endemic countries. In Brazil, severe Zika disease, and in particular microcephaly, has been clustered in the Northeastern part of the country [29] In one study an effort was made to pattern the distribution of Zika in Brazil relative to the inverse of where most intensive yellow fever vaccination has taken place [30].
(121) Clearly there is a compelling and urgent need for development of interventions and diagnostics for ZIKV. This must be done however in the light of understanding of the pathogenesis of Zika associated neurologic symptoms and microcephaly.
(122) Dengue is a major and rapidly expanding public health challenge in tropical and subtropical areas, responsible for hundreds of millions of infections and approaching 100 million clinical cases worldwide each year [31]. Caused by four closely related serotypes of flavivirus, it is a second infection with a different serotype which leads to the most severe cases of dengue, dengue hemorrhagic fever [8, 15]. Severe dengue and dengue hemorrhagic fever (DHF) is characterized by spontaneous hemorrhage, increased vascular permeability, hematuria and thrombocytopenia [5]. The severity of second infections has been attributed to the phenomenon of antibody dependent enhancement (ADE) in which prior antibody, which is not neutralizing, facilitates uptake of virus and enhances virus titer [3, 15]. The primary epitope conserved across all dengue envelope proteins is in the domain II of envelope protein, in the region known as the fusion loop [4]. While ADE undoubtedly contributes to the severity of dengue, it may not be the only factor. Recent studies of NS1, a non-structural protein which is shed into the extracellular space in large amounts in dengue, show that NS1 levels are a predictor of dengue severity [32] and that this may relate to the role of NS1 in focusing virus assembly [6, 7]. A puzzling aspect remains, which is that the severity of DHF peaks days after NS1 levels have diminished [8], indicating that other NS1 related factors may be in play.
(123) Usutu virus (USUV) is another emerging flavivirus, first identified in South Africa in 1959, but recently associated with clinical cases in southern Europe [9], and now considered a threat to Latin America [10]. While not associated with major disease outbreaks in endemic areas, Usutu virus has been linked to fever, rash, and meningioencephalitis [9]. This pattern of clinical signs may change as Usutu virus moves into new geographic areas and populations not previously exposed.
(124) Clearly there is a compelling and urgent need for development of preventive and therapeutic interventions and diagnostics for the emerging flaviviruses. The present invention builds on immunoinformatic analyses which have identified autoimmune pathogenesis, and which identify key epitopes and, hence, provide compositions and methods for design of countermeasures and diagnostics for dengue, Zika, and Usutu virus.
(125) In the present invention, immunoinformatic analysis of B cell binding, MHC binding, cathepsin cleavage patterns, and T cell motifs as described previously (PCT US2011/029192, PCT US2012/055038, and US2014/01452, and U.S. Provisional Appl. 62/306,262 (each of which is incorporated herein by reference in its entirety) was used to arrive at a characterization of the immunologic characteristics of the Zika virus proteins. Examples of some of the output of such analysis for ZIKV are shown in
(126) By such epitope mapping approaches, the present invention describes the identification of those epitopes within the structural proteins of ZIKV which are likely to be cross reactive with other flaviviruses, and those which are specific to ZIKV. The association of B cell epitopes with MHC binding leading to effective T cell help is described, identifying epitopes most likely to yield high titers of antibody. Comparison of such mapping applied to Zika isolates from around the world allowed the demonstration that Zika envelope proteins have largely been conserved in sequence, but differ significantly from other flaviviruses. By extraction of B cell epitope motifs, we then compared pentamer peptides comprising B cell epitopes to pentamers in the entire human proteome, by reference to a database of epitope motifs we established previously (see, e.g., WO 2014/200910; herein incorporated by reference in its entirety). This enabled identification of matches to pentamers in the proteomes. These were then curated to identify proteins with neurologic function. From this shortlist, human proteins were also analyzed to identify B cell epitopes which would cross react with ZIKV antibodies. Other flaviviruses were compared to identify mimics unique to ZIKV, and in the case of dengue a mimic which may also be associated with GBS in dengue type 3.
(127) Epitope mimics were identified in a number of areas in the ZIKV structural proteins. Domain III of the ZIKV protein contains a particularly critical motif which is unique, structurally exposed to antibodies, and which is associated with high MHC binding likely to result in high antibody titers. This epitope pentamer is homologous to a B cell epitope in neuropeptide Y (UniProtKB—P01303 (NPY_HUMAN)). Stimulation of high titers of antibody which bind/complex this neuropeptide at a critical stage of fetal development is consistent with the failure of brain development observed in the ZIKV affected infants and with the retinal lesions described in affected infants [33]. Antibodies cross the placenta and in first and second trimester can enter the developing brain in the absence of a fully formed blood brain barrier [34]. While exposure may only be for a few days or weeks and while fetal immunoglobulins may only reflect 10% of maternal titer [34], exposure at a critical time window is likely sufficient to affect cerebral development. There is precedent for this mode of intrauterine immunoglobulin mediated pathology [35, 36].
(128) Primary infection with ZIKV is a minor febrile disease with a rash. However, GBS may arise after primary Zika infection. Antibodies to Zika at high titers, specific to the epitope mimic in Domain III that matched NPY, and which bind NPY could progressively deplete this protein, until such time as the antibody wanes and ongoing NPY production exceeds its depletion. This is consistent with the transient nature of GBS. GBS is a broad autoimmune syndrome with many causal mechanisms described, including autoimmune reactions with myelin and but also antibody interactions with gangliosides. Interestingly GBS has been reported occasionally following dengue. Dengue 3 shares a mimic with NPY, although this motif GEDAP (SEQ ID NO.: 539) is not found in Zika virus. However, the B cell epitope in DEN3 envelope protein lacks MHC II binding except for a few alleles, possibly accounting for the sporadic occurrence of GBS.
(129) In this invention, we describe other mimics occurring in Zika virus which match other neural function proteins that may also play a role in pathogenesis. With the understanding that the pathogenesis of ZIKV neurologic effects, in particular GBS, are autoimmune and may arise from epitope mimics in the ZIKV proteins, it becomes imperative to design vaccines and therapeutics with this in mind. Failure to do so may result in further exacerbation of the disease pathogenesis.
(130) ADE is of concern for all flaviviruses. Most ADE arises from non-neutralizing antibodies reactive with epitopes in the fusion loop Domain II of the envelope protein [4] and to a lesser extent antibodies reactive with PrM proteins [15]. As the Domain II epitope of dengue is shared with ZIKV and USUV, ADE may occur in sequential infections of one of these viruses before or after dengue [37], as it is in sequential infections with different serotypes of dengue.
(131) In the case of Zika virus, a particular concern is that transplacental transfer of antibody is enabled by binding to the FcRn receptors on the placenta. In an embodiment of the present invention therefore it is particularly desirable to engineer an antibody devoid of Fc region to prevent or mitigate transplacental transfer.
(132) While ADE undoubtedly contributes to the severity of flavivirus infections, it may not be the only factor. In the present invention, we address cardiovascular manifestations of Zika infection, as well as dengue and Usutu infections. Infection with Zika virus has led to the development of deadly thrombocytopenia. [38, 39]. In even mild cases of ZIKV, USUV, or dengue infection, an erythremic rash is a typical clinical sign. Dengue is well known as a hemorrhagic disease, with dengue hemorrhagic fever occurring most typically following a second infection with a different serotype from the first infection. While for many years the role of ADE has been cited as a cause for this [15], there is increasing evidence that dengue does evoke an autoimmune response [40], that von Willebrand factor may be depleted [41], and that other clotting factors may be affected [42, 43]. Most recently the NS1 protein has been implicated as leading to vascular permeability in dengue [6, 7] and activating Toll receptor 4, and several possible direct viral pathogenic mechanisms have been described. However, the most serious vascular leakage in dengue hemorrhagic fever occurs after the peak of NS1 has declined, suggesting that a direct role of NS1 may not be the only factor [8]. In particular embodiments of the present invention, a subset of the human proteome was selected to include those proteins which have a function in the cardiovascular system, including structural proteins found in endothelium, platelets, erythrocytes, and enzymes expressed by these cells, and coagulation cascade proteins. In the present invention, we describe the role of NS1 in dengue in eliciting auto antibodies to various proteins with cardiovascular function, including but not limited to coagulation factor V and VIII, prothrombin, von Willebrand factor, ADAMTS13 (A disintegrin and metalloproteinase with thrombospondin motifs 13), platelet glycoprotein Ib beta, vascular endothelial growth factor, vascular endothelial growth factor receptor and platelet endothelial aggregation receptor. Notably no such epitope matches in cardiovascular function proteins clearly linked to hemorrhage and thrombocytopenia occur in the corresponding proteins of West Nile virus. In particular embodiments we describe the precise B cell epitopes which are mimics, thereby enabling the mutation or removal of such epitopes to reduce adverse effects in a vaccine.
(133) A number of human proteins have been identified as having an association with microcephaly, for instance when this occurs as an autosomal recessive familial trait [44]. In another embodiment of the present invention, we therefore also examined whether antibodies arising from flavivirus infection, and in particular ZIKV, may bind to epitope mimics in the microcephaly associated proteins. As a linear B cell epitope is a charged and protruding or exposed peptide sequence, identification of a B cell linear epitope also identifies peptides which are probable candidates as other ligand binders. Thus, while identifying epitope mimics in the virus, as defined, the same process also identifies virus peptides which may be bound by other ligands which would otherwise bind with a human protein. Essentially the virus peptide becomes a competitor in binding and may thus disrupt a human-human protein binding reaction. The present invention identifies a number of epitope mimics shared between ZIKV and human microcephaly associated proteins. It thus shows the possibility of virus peptides which compete with microcephaly associated proteins for binding of ligands, including but not limited to antibody.
(134) Accordingly, the present invention provides peptides, polypeptides and proteins, and nucleic acids sequences encoding the peptides, polypeptides and proteins as described in SEQ ID NOs: 1 to 1256. The sequences of the peptide, polypeptides, proteins and nucleic acids of the present invention are included in the accompanying Sequence ID listing. It will be understood to a person of skill in that the present invention encompasses the listed sequences as well as portions of the listed sequences. For example, in some cases, the listed sequences contain a polypeptide of interest (e.g., a viral or human sequence) in association with exogenous sequences such as signal peptide sequences and linker sequences. In these instances, it will be understood that the invention by defined by designated the portion of the sequence that is the viral polypeptide sequence in isolation from the associated exogenous sequences. The invention may also be defined by describing the viral polypeptide sequence in association with one or more of the exogenous sequences. For example, the invention may be defined by specifically designating a particular range of amino acids or nucleotides from the listed sequence corresponding to the polypeptide of interest or to the polypeptide of interest and one or more of the associated exogenous or flanking sequences.
(135) For example, in some embodiments, the present invention provides a synthetic Zika virus polypeptide comprising one or more B cell epitopes and one or more peptides that each bind with high affinity to three or more different WIC II molecules. In some embodiments, the polypeptide comprises B cell epitopes that are unique to Zika virus and do not elicit antibodies which cross react with a dengue virus. In some embodiments, the polypeptide comprises one or more altered or deleted epitope mimic sequences so that the sequence of the synthetic Zika virus polypeptide is altered in comparison to the corresponding wild type Zika virus polypeptide (e.g., the polypeptide comprising one or more altered or deleted epitope mimic sequences comprises a deletion or substitution mutation of one or more amino acids in the epitope mimic sequence so that the sequence of synthetic Zika virus polypeptide is altered in comparison to the corresponding wild type Zika virus polypeptide). In some embodiments, the epitope mimic sequence is found in a human neurologic protein (e.g., a human neurologic protein listed in tables 1, 6, 7, 8 or 9). In some embodiments, the epitope mimic sequences are selected from, for example, SEQ ID NOs: 1-34, 78-140, or 255-256. In some embodiments, the synthetic polypeptide comprises a Zika virus immunogen from an envelope polypeptide of Zika virus (e.g., Zika virus Domain I, Domain II, or Domain III polypeptides). In some embodiments, the Zika virus immunogen is an immunogen encoded by an amino acid sequence selected from, for example, amino acids 38-444 of SEQ ID NO: 142, amino acids 38-143 of SEQ ID NO: 144, amino acids 38-125 of SEQ ID NO: 146, amino acids 38-113 of SEQ ID NO: 148, amino acids 24-429 of SEQ ID NO: 150, amino acids 24-128 of SEQ ID NO: 152, amino acids 24-110 of SEQ ID NO: 154, amino acids 24-98 of SEQ ID NO: 156, amino acids 30-435 of SEQ ID NO: 158, amino acids 30-134 of SEQ ID NO: 160, amino acids 30-116 of SEQ ID NO: 162, amino acids 30-104 of SEQ ID NO: 164, amino acids 38-143 of SEQ ID NO: 166, amino acids 24-128 of SEQ ID NO: 168, amino acids 30-134 of SEQ ID NO: 170, or amino acids 38-444 of SEQ ID NO: 254. In some embodiments, the epitope mimic sequence is found in a human microcephaly associated protein (e.g., CDKRAP2, ASPM, or CEP135). In some embodiments, the epitope mimic sequence is selected from the group of epitope mimic sequences identified by SEQ ID NOs: 452-456. In some embodiments, the synthetic polypeptide comprises a Zika virus immunogen from a Zika virus protein selected from PrM, NS1, NS3, or NS4B. In some embodiments, the Zika virus immunogen is an NS1 immunogen encoded by an amino acid sequence selected from, for example, amino acids 21 to 384 of SEQ ID NO:441, amino acids 21 to 213 of SEQ ID NO:443 or amino acids 21 to 213 of SEQ ID NO:445.
(136) Further embodiments provide a synthetic flavivirus NS1 polypeptide comprising one or more B cell epitopes and that comprise peptides that bind with high affinity to three or more different MHC II molecules. In some embodiments, the polypeptide is selected from, for example, a dengue virus NS1 polypeptide, Zika virus NS1 polypeptide, West Nile virus NS1 polypeptide, Yellow fever virus NS1 polypeptide, Usutu virus NS1 polypeptide, Japanese encephalitis virus NS1 polypeptide, Tickborne encephalitis virus NS1 polypeptide, or St Louis encephalitis virus NS1 polypeptide. In some embodiments, the polypeptide comprises one or more altered or deleted epitope mimic sequences so that the sequence of the synthetic polypeptide is altered in comparison to the corresponding wild type virus polypeptide. In some embodiments, the polypeptide comprising one or more altered or deleted epitope mimic sequences comprises a deletion or substitution mutation of one or more amino acids in the epitope mimic sequence so that the sequence of the synthetic virus polypeptide is altered in comparison to the corresponding wild type virus polypeptide. In some embodiments, the epitope mimic sequence matches an epitope motif in a human cardiovascular protein (e.g., a human protein expressed in vascular endothelium or in platelets). In some embodiments, the human cardiovascular protein is selected from, for example, ADAMTS13, Coagulation factor V, Coagulation factor VIII, Plasminogen, Platelet glycoprotein Ib beta chain, Vascular endothelial growth factor A, Vascular endothelial growth factor B, Vascular endothelial growth factor receptor 1, Vascular endothelial growth factor receptor 2, von Willebrand factor or Platelet endothelial aggregation receptor 1. In some embodiments, the epitope mimic sequences are selected from the group of epitope mimic sequences identified by SEQ ID NOs:1106-1123. In some embodiments, the epitope mimic sequence matches an epitope motif in a human protein with neurologic function. In some embodiments, the epitope mimic sequences are selected from, for example, SEQ ID NOs:1124-1125 and 1138-1149. In some embodiments, the synthetic polypeptide comprises Zika PrM and Env proteins in operable linkage. In some embodiments, the polypeptide is encoded by amino acids 25 to 603 of SEQ ID NO:258, amino acids 25 to 603 of SEQ ID NO:260, or amino acids 25 to 603 of SEQ ID NO:262. In some embodiments, the synthetic polypeptide comprises one or more altered or deleted pan-flavivirus epitopes so that the sequence of the synthetic Zika virus polypeptide is altered in comparison to the corresponding wild type Zika virus polypeptide. In some embodiments, the pan-flavivirus epitope is DRGWG (SEQ ID NO:554).
(137) Further embodiments provide a fusion protein comprising the synthetic polypeptides described herein. In some embodiments, the fusion protein comprises a peptide sequence selected from a signal sequence, a linker sequence, a purification tag sequence and an immunoglobulin sequence in operable association with the synthetic polypeptide. In some embodiments, the peptide sequence is exogenous to the synthetic polypeptide sequence. In some embodiments, the immunoglobulin sequence is a constant region sequence.
(138) In other embodiments, the present invention provides a synthetic human neurological polypeptide comprising one or more altered or deleted epitope mimic sequences so that the sequence of the synthetic neurological polypeptide is altered in comparison to the corresponding wild type neurological polypeptide and wherein the epitope mimic sequence is shared with a B cell epitope in a Zika virus or dengue virus. In some embodiments, the polypeptide comprising one or more altered or deleted epitope mimic sequences comprises a deletion or substitution mutation of one or more amino acids in the epitope mimic sequence so that the sequence of synthetic neurological polypeptide is altered in comparison to the corresponding wild type neurological polypeptide. In some embodiments, the human neurological polypeptide is proneuropeptide Y or neuron navigator 2. In some embodiments, the polypeptide comprises an amino acid sequence selected from, for example, amino acids 35-104 of SEQ ID NO:174, amino acids 35-104 of SEQ ID NO:176, amino acids 35-104 of SEQ ID NO:178, amino acids 35-104 of SEQ ID NO: 180, amino acids 35-104 of SEQ ID NO:182, amino acids 30-270 of SEQ ID NO:236, amino acids 30-270 of SEQ ID NO:238, amino acids 30-270 of SEQ ID NO:240, amino acids 30-270 of SEQ ID NO:242, amino acids 30-280 of SEQ ID NO:244, amino acids 30 to 269 of SEQ ID NO.: 399, amino acids 30 to 269 of SEQ ID NO.:401, amino acids 30 to 269 of SEQ ID NO.:403, amino acids 30 to 269 of SEQ ID NO.:405, amino acids 30 to 279 of SEQ ID NO.:407, amino acids 268 to 507 of SEQ ID NO.:409, amino acids 268 to 507 of SEQ ID NO.:411, amino acids 268 to 507 of SEQ ID NO.:413, amino acids 268 to 507 of SEQ ID NO.:415, amino acids 268 to 507 of SEQ ID NO.:417, amino acids 30 to 100 of SEQ ID NO.:419, amino acids 30 to 100 of SEQ ID NO.:421, amino acids 30 to 100 of SEQ ID NO.:423, amino acids 30 to 100 of SEQ ID NO.:425, amino acids 30 to 110 of SEQ ID NO.:427, amino acids 268 to 338 of SEQ ID NO.:429, amino acids 268 to 338 of SEQ ID NO.:431, amino acids 268 to 338 of SEQ ID NO.:433, amino acids 268 to 338 of SEQ ID NO.:435, or amino acids 268 to 348 of SEQ ID NO.:437.
(139) Other embodiments provide a synthetic polypeptide derived from a human microcephaly associated protein comprising one or more altered or deleted epitope mimic sequences so that the sequence of the synthetic polypeptide is altered in comparison to the corresponding wild type human microcephaly associated protein and wherein the epitope mimic sequence is shared with a B cell epitope in a Zika virus or dengue virus. In some embodiments, the polypeptide comprising one or more altered or deleted epitope mimic sequences comprises a deletion or substitution mutation of one or more amino acids in the epitope mimic sequence so that the sequence of synthetic polypeptide is altered in comparison to the corresponding wild type human microcephaly associated protein (e.g., ASPM).
(140) As described above, in some preferred embodiments, the present invention provides synthetic or variant viral or human polypeptide sequences (or the corresponding nucleic acid sequences) that have a mutation such as a substitution mutation or deletion mutation in one or more epitope mimic sequences. In some embodiments, the mutation is a deletion mutation that removes all or part of the epitope mimic so that the polypeptide does not cross react with antibodies specific for the wild type epitope mimic. In some embodiments, the mutation is a substitution mutation or insertion mutation that alters the epitope mimic so that the polypeptide does not cross react with antibodies specific for the wild type epitope mimic. Thus, the sequences of the present invention may be described by reference to the wild type viral or human sequence and then specifying that a particular epitope mimic sequence (or sequences) in the wild type sequence is mutated to alter or delete the specified epitope mimic sequence. Those of skill in the art will recognize that there are a number of different ways the epitope mimic sequence may be altered or deleted by mutation and will recognize that the identity of the specified sequence may readily be determined by reference to the corresponding wild type sequence.
(141) In some embodiments, a peptide or polypeptide sequence (e.g., an epitope mimic sequence, altered epitope mimic sequence, or in some preferred embodiments a pentamer or other peptide sequence defined in the tables in the examples) of the present invention includes a flanking sequence extending beyond the region comprising the identified peptide. The flanking sequence may be included on either or both of the C and/or N terminals of the peptide and may be a native or wild type flanking sequence or a flanking sequence that is exogenous to the peptide (i.e., a flanking sequence that does not naturally occur with the peptide). Such a flanking sequence may be used in assuring a synthetic version of the peptide is displayed in such a way as to represent the topological arrangement in its native state. For instance, inclusion of a flanking sequence at each end and inclusion of a cysteine residue may be used to ensure a peptide is displayed on a loop. Flanking sequences may be included to allow multiple peptides to be arranged together to epitopes that occur adjacent to each other in a native protein. A flanking sequence may be used to facilitate expression as a fusion polypeptide, for instance linked to an immunoglobulin Fc region to ensure secretion. In such embodiments where flanking regions are included said flanking regions may comprise from 1-20, from 1-50, from 10-20, 20-30 or 40-50, or up to 100 amino acids on either or both of the N terminal end or the C terminal end of the epitope polypeptide. In some embodiments, these peptides and polypeptides find use as capture reagents in the diagnostic assays below, or find use a components of vaccines such as subunit vaccines.
(142) In some embodiments, the present invention provides sequences that are homologous or variants of the sequences described above. It will be recognized that the sequences described above can be altered, for example by substituting one or more amino acids in the sequences with a different amino acid. The substitutions may be made in the listed sequence or in the flanking regions. Such mutated or variant sequences are within the scope of the invention. It will further be recognized by those of skill in the art that where the sequence is identified as having an altered or deleted epitope mimic sequence, that the defined sequence may include mutations in other portions of the defined sequence. These sequences may be described by defining the sequence as having a particular identity or homology to the defined sequence, with the proviso that that the mutations that the alterations or deletions of the defined epitope mimic sequence are retained. In other words, where for example, the sequence is defined as having 95% identity or homology or some other percent identity or homology to a defined sequence having an altered epitope mimic sequence, it will be understood to a person of ordinary skill in the art that the sequence retains the alterations to the defined epitope mimic sequence so that the function of the defined epitope mimic sequence is not destroyed (i.e., the altered sequence does not bind to antibodies specific for the wild type epitope mimic sequence or the epitope mimic sequence is removed from the viral polypeptide) while having additional variations in the other portions of the sequence so that identity or homology to the defined sequence is at least 95% or some other percent identity.
(143) The substitutions may be conservative or non-conservative. Accordingly, in some embodiments, the present invention provides polypeptide sequences that share at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity with the listed sequence, relative to the epitope portion of the listed sequences (e.g., excluding non-epitope sequences). In some embodiments, variant sequences retain the epitope of the recited sequence. In some embodiments, the variant sequences have about 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid substitutions, or a range of substitutions from about 1 to about 10 substitutions, for example 1-4 substitutions, 2-4 substitutions, 3-5 substitutions, 5-10 substitutions, etc. The substitutions may be conservative or non-conservative.
(144) As used herein, a “conservative” amino acid substitution refers to the substitution of an amino acid in a peptide or polypeptide with another amino acid having similar chemical properties, such as size or charge. For purposes of the present disclosure, each of the following eight groups contains amino acids that are conservative substitutions for one another: 1) Alanine (A) and Glycine (G); 2) Aspartic acid (D) and Glutamic acid (E); 3) Asparagine (N) and Glutamine (Q); 4) Arginine (R) and Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), and Valine (V); 6) Phenylalanine (F), Tyrosine (Y), and Tryptophan (W); 7) Serine (S) and Threonine (T); and 8) Cysteine (C) and Methionine (M).
(145) Naturally occurring residues may be divided into classes based on common side chain properties, for example: polar positive (histidine (H), lysine (K), and arginine (R)); polar negative (aspartic acid (D), glutamic acid (E)); polar neutral (serine (S), threonine (T), asparagine (N), glutamine (Q)); non-polar aliphatic (alanine (A), valine (V), leucine (L), isoleucine (I), methionine (M)); non-polar aromatic (phenylalanine (F), tyrosine (Y), tryptophan (W)); proline and glycine; and cysteine. As used herein, a “semi-conservative” amino acid substitution refers to the substitution of an amino acid in a peptide or polypeptide with another amino acid within the same class.
(146) In some embodiments, unless otherwise specified, a conservative or semi-conservative amino acid substitution may also encompass non-naturally occurring amino acid residues that have similar chemical properties to the natural reside. These non-natural residues are typically incorporated by chemical peptide synthesis rather than by synthesis in biological systems. These include, but are not limited to, peptidomimetics and other reversed or inverted forms of amino acid moieties. Embodiments herein may, in some embodiments, be limited to natural amino acids, non-natural amino acids, and/or amino acid analogs.
(147) Non-conservative substitutions may involve the exchange of a member of one class for a member from another class.
(148) The present invention therefore embodies a number of embodiments that enable the development of safe and effective diagnostic, research, and medical interventions.
(149) Vectors and Recombinant Expression:
(150) In some embodiments, the present invention provides vectors and recombinant expression systems for expressing peptides and constructs described herein. The present invention is not limited to particular expression vectors. Exemplary vectors and expression methods are described herein.
(151) In some embodiments, peptides are expressed using any suitable vector and expression system. In some embodiments, peptides are expressed in bacterial or eukaryotic expression vectors (e.g., commercially available vectors). In some embodiments, peptides are expressed in retroviral (e.g., adeno, adeno-associated, or lenti-viral vectors). Suitable vectors are introduced into suitable host cells (e.g., bacterial or eukaryotic host cells), expression is induced, and peptides are isolated using any suitable method.
(152) The peptides, polypeptides, and proteins of the present invention may be produced by recombinant techniques. Thus, for example, a polynucleotide encoding a peptide, polypeptide or protein of the present invention may be included in any one of a variety of expression vectors for expressing a polypeptide. In some embodiments of the present invention, vectors include, but are not limited to, chromosomal, nonchromosomal and synthetic DNA sequences (e.g., derivatives of SV40, bacterial plasmids, phage DNA; baculovirus, yeast plasmids, vectors derived from combinations of plasmids and phage DNA, retroviral vectors and viral DNA such as vaccinia, adenovirus, fowl pox virus, and pseudorabies). It is contemplated that any vector may be used as long as it is replicable and viable in the host.
(153) In particular, some embodiments of the present invention provide recombinant constructs comprising one or more of the sequences as broadly described above. In some embodiments of the present invention, the constructs comprise a vector, such as a plasmid or viral vector, into which a sequence of the invention has been inserted, in a forward or reverse orientation. In still other embodiments, the heterologous structural sequence is assembled in appropriate phase with translation initiation and termination sequences. In preferred embodiments of the present invention, the appropriate DNA sequence is inserted into the vector using any of a variety of procedures. In general, the DNA sequence is inserted into an appropriate restriction endonuclease site(s) by procedures known in the art.
(154) Large numbers of suitable vectors are known to those of skill in the art, and are commercially available. Such vectors include, but are not limited to, the following vectors: 1) Bacterial—pQE70, pQE60, pQE-9 (Qiagen), pBS, pD10, phagescript, psiX174, pbluescript SK, pBSKS, pNH8A, pNH16a, pNH18A, pNH46A (Stratagene); ptrc99a, pKK223-3, pKK233-3, pDR540, pRIT5 (Pharmacia); 2) Eukaryotic—pWLNEO, pSV2CAT, pOG44, PXT1, pSG (Stratagene) pSVK3, pBPV, pMSG, pSVL (Pharmacia); and 3) Baculovirus—pPbac and pMbac (Stratagene). Any other plasmid or vector may be used as long as they are replicable and viable in the host. In some preferred embodiments of the present invention, mammalian expression vectors comprise an origin of replication, a suitable promoter and enhancer, and also any necessary ribosome binding sites, polyadenylation sites, splice donor and acceptor sites, transcriptional termination sequences, and 5′ flanking non-transcribed sequences. In other embodiments, DNA sequences derived from the SV40 splice, and polyadenylation sites may be used to provide the required non-transcribed genetic elements.
(155) In certain embodiments of the present invention, the DNA sequence in the expression vector is operatively linked to an appropriate expression control sequence(s) (promoter) to direct mRNA synthesis. Promoters useful in the present invention include, but are not limited to, the LTR or SV40 promoter, the E. coli lac or trp, the phage lambda P.sub.L and P.sub.R, T3 and T7 promoters, and the cytomegalovirus (CMV) immediate early, herpes simplex virus (HSV) thymidine kinase, and mouse metallothionein-I promoters and other promoters known to control expression of gene in prokaryotic or eukaryotic cells or their viruses. In other embodiments of the present invention, recombinant expression vectors include origins of replication and selectable markers permitting transformation of the host cell (e.g., dihydrofolate reductase or neomycin resistance for eukaryotic cell culture, or tetracycline or ampicillin resistance in E. coli).
(156) In some embodiments of the present invention, transcription of the DNA encoding the polypeptides of the present invention by higher eukaryotes is increased by inserting an enhancer sequence into the vector. Enhancers are cis-acting elements of DNA, usually about from 10 to 300 bp that act on a promoter to increase its transcription. Enhancers useful in the present invention include, but are not limited to, the SV40 enhancer on the late side of the replication origin bp 100 to 270, a cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers.
(157) In other embodiments, the expression vector also contains a ribosome binding site for translation initiation and a transcription terminator. In still other embodiments of the present invention, the vector may also include appropriate sequences for amplifying expression.
(158) In some embodiments, retroviral vectors are utilized for expression in a suitable host cell. The production of a recombinant retroviral vector carrying a gene of interest is typically achieved in two stages. First, the gene of interest is inserted into a retroviral vector which contains the sequences necessary for the efficient expression of the gene of interest (including promoter and/or enhancer elements which may be provided by the viral long terminal repeats [LTRs] or by an internal promoter/enhancer and relevant splicing signals), sequences required for the efficient packaging of the viral RNA into infectious virions (e.g., the packaging signal [Psi], the tRNA primer binding site [−PBS], the 3′ regulatory sequences required for reverse transcription [+PBS] and the viral LTRs). The LTRs contain sequences required for the association of viral genomic RNA, reverse transcriptase and integrase functions, and sequences involved in directing the expression of the genomic RNA to be packaged in viral particles. For safety reasons, many recombinant retroviral vectors lack functional copies of the genes that are essential for viral replication (these essential genes are either deleted or disabled); the resulting virus is said to be replication defective or incompetent.
(159) Second, following the construction of the recombinant vector, the vector DNA is introduced into a packaging cell line. Packaging cell lines provide viral proteins required in trans for the packaging of the viral genomic RNA into viral particles having the desired host range (i.e., the viral-encoded gag, pol and env proteins). The host range is controlled, in part, by the type of envelope gene product expressed on the surface of the viral particle. Packaging cell lines may express ecotrophic, amphotropic or xenotropic envelope gene products. Alternatively, the packaging cell line may lack sequences encoding a viral envelope (env) protein. In this case the packaging cell line will package the viral genome into particles that lack a membrane-associated protein (e.g., an env protein). In order to produce viral particles containing a membrane associated protein that will permit entry of the virus into a cell, the packaging cell line containing the retroviral sequences is transfected with sequences encoding a membrane-associated protein (e.g., the G protein of vesicular stomatitis virus [VSV]). The transfected packaging cell will then produce viral particles that contain the membrane-associated protein expressed by the transfected packaging cell line; these viral particles, which contain viral genomic RNA derived from one virus encapsidated by the envelope proteins of another virus are said to be pseudotyped virus particles.
(160) Commonly used recombinant retroviral vectors are derived from the amphotropic Moloney murine leukemia virus (MoMLV) (Miller and Baltimore, Mol. Cell. Biol., 6:2895 [1986]). The MoMLV system has several advantages: 1) this specific retrovirus can infect many different cell types, 2) established packaging cell lines are available for the production of recombinant MoMLV viral particles and 3) the transferred genes are permanently integrated into the target cell chromosome. The established MoMLV vector systems comprise a DNA vector containing a small portion of the retroviral sequence (the viral long terminal repeat or “LTR” and the packaging or “psi” signal) and a packaging cell line. The gene to be transferred is inserted into the DNA vector. The viral sequences present on the DNA vector provide the signals necessary for the insertion or packaging of the vector RNA into the viral particle and for the expression of the inserted gene. The packaging cell line provides the viral proteins required for particle assembly (Markowitz et al., J. Virol., 62:1120 [1988]).
(161) Other commonly used retrovectors are derived from lentiviruses including, but not limited to, human immunodeficiency virus (HIV) or feline immunodeficiency virus (FIV). Lentivirus vectors have the advantage of being able to infect non replicating cells.
(162) The low titer and inefficient infection of certain cell types by retro vectors has been overcome by the use of pseudotyped retroviral vectors which contain the G protein of VSV as the membrane associated protein. Unlike retroviral envelope proteins which bind to a specific cell surface protein receptor to gain entry into a cell, the VSV G protein interacts with a phospholipid component of the plasma membrane (Mastromarino et al., J. Gen. Virol., 68:2359 [1977]). Because entry of VSV into a cell is not dependent upon the presence of specific protein receptors, VSV has an extremely broad host range. Pseudotyped retroviral vectors bearing the VSV G protein have an altered host range characteristic of VSV (i.e., they can infect almost all species of vertebrate, invertebrate and insect cells). Importantly, VSV G-pseudotyped retroviral vectors can be concentrated 2000-fold or more by ultracentrifugation without significant loss of infectivity (Burns et al., Proc. Natl. Acad. Sci. USA, 90:8033 [1993]).
(163) The VSV G protein has also been used to pseudotype retroviral vectors based upon the human immunodeficiency virus (HIV) (Naldini et al., Science 272:263 [1996]). Thus, the VSV G protein may be used to generate a variety of pseudotyped retroviral vectors and is not limited to vectors based on MoMLV.
(164) The majority of retroviruses can transfer or integrate a double-stranded linear form of the virus (the provirus) into the genome of the recipient cell only if the recipient cell is cycling (i.e., dividing) at the time of infection. Retroviruses that have been shown to infect dividing cells exclusively, or more efficiently, include MLV, spleen necrosis virus, Rous sarcoma virus human immunodeficiency virus, and other lentiviral vectors.
(165) In some embodiments, peptides are synthesized de novo. A variety of peptide synthesis methods may be utilized. Examples include, but are not limited to, solid-phase peptide synthesis (SPPS), (R. B. Merrifield (1963). “Solid Phase Peptide Synthesis. I. The Synthesis of a Tetrapeptide”. J. Am. Chem. Soc. 85 (14): 2149-2154; Mitchell, A. R. K., S. B. H.; Engelhard, M.; Merrifield, R. B. (1978). “A new synthetic route to tert-butyloxycarbonylaminoacyl-4-(oxymethyl)phenylacetamidomethyl-resin, an improved support for solid-phase peptide synthesis”. J. Org. Chem. 43 (13): 2845-2852). Recent developments in synthesis methods are further described in Hojo, Curr Opin Struct Biol 2014, 26C, 16-23; Ramakers et al., Chem Soc Rev 2014, 43, 2743-2756 and Chandrudu et al., Molecules 2013, 18, 4373-4388.
(166) In a further embodiment, the present invention provides host cells containing the above-described constructs. In some embodiments of the present invention, the host cell is a higher eukaryotic cell (e.g., a mammalian or insect cell). In other embodiments of the present invention, the host cell is a lower eukaryotic cell (e.g., a yeast cell). In still other embodiments of the present invention, the host cell can be a prokaryotic cell (e.g., a bacterial cell). Specific examples of host cells include, but are not limited to, Escherichia coli, Salmonella typhimurium, Bacillus subtilis, and various species within the genera Pseudomonas, Streptomyces, and Staphylococcus, as well as Saccharomycees cerivisiae, Schizosaccharomycees pombe, Drosophila S2 cells, Spodoptera Sf9 cells, Chinese hamster ovary (CHO) cells, COS-7 lines of monkey kidney fibroblasts, (Gluzman, Cell 23:175 (1981)), C127, 3T3, 293, 293T, HeLa and BHK cell lines, T-1 (tobacco cell culture line), root cell and cultured roots in rhizosecretion (Gleba et al., (1999) Proc Natl Acad Sci USA 96:5973-5977).
(167) The constructs in host cells can be used in a conventional manner to produce the gene product encoded by the recombinant sequence. In some embodiments, introduction of the construct into the host cell can be accomplished by calcium phosphate transfection, DEAE-Dextran mediated transfection, or electroporation (See e.g., Davis et al. (1986) Basic Methods in Molecular Biology). Alternatively, in some embodiments of the present invention, the polypeptides of the invention can be synthetically produced by conventional peptide synthesizers.
(168) Proteins can be expressed in mammalian cells, yeast, bacteria, or other cells under the control of appropriate promoters. Cell-free translation systems can also be employed to produce such proteins using RNAs derived from the DNA constructs of the present invention. Appropriate cloning and expression vectors for use with prokaryotic and eukaryotic hosts are described by Sambrook, et al. (1989) Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor, N.Y.
(169) In some embodiments of the present invention, following transformation of a suitable host strain and growth of the host strain to an appropriate cell density, the selected promoter is induced by appropriate means (e.g., temperature shift or chemical induction) and cells are cultured for an additional period. In other embodiments of the present invention, cells are typically harvested by centrifugation, disrupted by physical or chemical means, and the resulting crude extract retained for further purification. In still other embodiments of the present invention, microbial cells employed in expression of proteins can be disrupted by any convenient method, including freeze-thaw cycling, sonication, mechanical disruption, or use of cell lysing agents.
(170) Vaccines:
(171) A first set of embodiments addresses development of vaccines to prevent Zika infection in those at risk of infection. In some particular embodiments, sequences of proteins included in Zika vaccines are selected based on understanding of epitope mimics, in order to direct antibody responses to preferred epitopes. In particular embodiments of the invention, the sub polypeptides of the ZIKV envelope protein have been engineered to remove or to mutate peptides which are identified as epitope mimics for human proteins. In some cases, said human proteins are proteins which affect neurologic function and development. In particular cases, said epitope mimics occur in human neuropeptide Y. In yet other embodiments said mimic is in another neural protein, including, but not limited to, neurotrophin 4, neural cell adhesion molecule, neuron navigator, neurogenic differentiation factor, optineurin, cochlin, glial fibrillary acidic protein, glycoprotein M6A and others. In some particular embodiments, the epitope mimics located in Domain III loop and comprising amino acid motifs shown herein, are mutated or removed. In yet other embodiments peptide motifs in Domain I are modified to eliminate potential mimics. In some particular embodiments, a mimic, comprising the pentamer PRAEA, is found in Domain I which corresponds to an epitope in optineurin. In another embodiment, a mimic in Domain II comprising the pentamer MSSGT is found to match a B cell epitope in brain derived neurotrophic factor and in cochlin. In some embodiments, synthetic polypeptides are expressed which comprise sequences from which amino acids are deleted or mutated relative to the sequences in the native protein, to abrogate the mimic motif.
(172) In yet other embodiments a polypeptide is selected from the structural proteins of ZIKV which avoids the identified problematic mimic motifs. For example, in some embodiments, the polypeptide comprises B cell epitopes that are unique to Zika virus and do not elicit antibodies which cross react with a dengue virus. In some embodiments, the polypeptide comprises one or more altered or deleted epitope mimic sequences so that the sequence of the synthetic Zika virus polypeptide is altered in comparison to the corresponding wild type Zika virus polypeptide. In some embodiments, the comprises one or more altered or deleted epitope mimic sequences comprising a deletion or substitution mutation of one or more amino acids in the epitope mimic sequence so that the sequence of the Zika virus polypeptide is altered in comparison to the corresponding wild type Zika virus polypeptide. In some embodiments, the polypeptide does not contain mimic from human proteins (e.g., human neurologic proteins such as those described in Tables 1, 6, 7, 8, and 9). Exemplary epitope mimetics are shown, for example, in SEQ ID NOs: 1-34, 78-140, and 255-256. In some embodiments, vaccines utilize variants of the described peptides or comprise flanking sequence as described above.
(173) In some embodiments of the present invention, a synthetic envelope polypeptide is engineered to avoid including the potentially cross reactive sequences in Domain II which could lead to ADE if a prior infection with dengue or other flaviruses has occurred or follows Zika infection.
(174) In addition to the embodiments described above, the identification of an epitope mimic GEDAP (SEQ ID NO.: 539) for dengue virus in neuropeptide Y raises concern that dengue virus vaccines may generate antibodies with deleterious neuropeptide binding properties unless modified to eliminate the epitope mimic. The motif GEDAP (SEQ ID NO.: 539) is found in most lineages of dengue serotype 3, including those circulating where ZIKV is currently endemic in Latin America. In a similar pattern, we have shown that Dengue serotype 1 carries a peptide mimic which matches an epitope in neural navigator protein 2. In this case, the motif TDKEK, found in domain III of dengue 1, is highly conserved. Hence modifications of envelope proteins or subunits thereof to remove such epitope mimics for dengue 1 and dengue 3 will lead to greater safety especially when such vaccines are used in an area co-endemic for Zika virus which also carries mimics for these two target proteins. It will be apparent to those skilled in the art that additional neurologic peptides within dengue virus, including dengue types 1, 2, 3 or 4, may be identified using the strategy described herein and that it will be desirable to mutate or remove the mimic peptides from vaccines in the interests of safety to avoid autoimmune reactions.
(175) A further set of embodiments addresses development of vaccines containing NS1 of dengue and other flaviviruses, in which one or more epitope mimics capable of eliciting an autoimmune reaction are removed or mutated. In particular embodiments, NS1 epitopes are mimics of B cell epitopes which occur in cardiovascular function proteins. Of particular note is an embodiment in which we identify a mimic epitope pentamer, in the C terminal loop of dengue viruses, conserved in serotypes 1-4, which matches a B cell epitope in ADAMTS13. Multiple stimulations by this epitope, whether through natural infection or vaccination, or vaccination followed by repeated natural exposure would increase the titer of antibodies binding this enzyme with potentially deleterious effects. We also identify a mimic for platelet glycoprotein Ib beta chain in ZIKV. ZIKV NS1 is also the location of an epitope motif which is mimics for the microcephaly associated protein, ASPM.
(176) In a further set of embodiments in the present invention we describe the epitopes and mimics thereof found in the structural proteins of Usutu virus, including envelope, PrM and capsid proteins.
(177) In each of the cases where a potentially deleterious mimic occurs, it is desirable to avoid inclusion of a mimic epitope in a vaccine and thus we provide embodiments of vaccine constructs in which mimic epitopes have been deleted or mutated. In some embodiments, the mutation is a deletion mutation that removes all or part of the epitope mimic so that the polypeptide utilized in the vaccine does not cross react with antibodies specific for the wild type epitope mimic. In some embodiments, mutation is a substitution mutation or insertion mutation that alters the epitope mimic so that the polypeptide used in the vaccine does not cross react with antibodies specific for the wild type epitope mimic.
(178) In some embodiments, the vaccine protein embodied in this invention may be expressed in a mammalian cell line, harvested, and delivered directly to the subject. In yet other embodiments, the vaccine polypeptide may be incorporated into a particular delivery vehicle, including but not limited to, a nanoparticle or virus like particle. In yet other embodiments, a ZIKV protein, engineered to delete or mutate epitope mimics may be incorporated as a chimera or pseudotype into a live virus vaccine where other proteins are derived from a heterologous flavivirus. In some particular embodiments, said heterologous flavivirus may be a yellow fever vaccine strain. In alternative embodiments, a viral vector, such as an adenoviral or poxvirus vector, may be used to deliver the synthetic vaccinal polypeptide. In yet other embodiments other modes of expression of the virus polypeptide are used which in some embodiments includes expression in a prokaryotic system. Those skilled in the art will be well aware of many alternative vaccine delivery vehicles as well as pharmaceutical compositions comprising adjuvants, so the above is not considered limiting.
(179) In the present invention, we provide examples of constructs suitable for expression in mammalian cell lines of polypeptides as are described above. In assembling vector constructs for the expression of proteins and polypeptides, the skilled artisan has many options for choices of linkers of fusion partners, restriction sites for cloning, purification tags, cleavage sites, and in the case of immunoglobulin fusions, choices in the isotype and species of immunoglobulin. It will therefore be understood that the particular constructs provide examples of sequences which may be used to implement the inventions and are not to be considered limiting, as other combinations of all of these components many be equally effective and desirable. In some embodiments, we describe use of mouse immunoglobulin as a fusion partner, in others we describe human. In the examples shown, we adopt an enterokinase cleavage site to release standalone polypeptides; other cleavage sites including, but not limited to, a Factor Xa site, a serine glycine chain and many other possible linkers and cleavable linkers may be used. His tags are included to facilitate purification; but the same polypeptides may be produced without a histag or with a different purification tag.
(180) In some embodiments, vaccines comprise peptides (e.g., those described herein). In some embodiments, vaccines are DNA vaccines comprising naked DNA encoding the peptides described herein or vectors or viral particles comprising nucleic acids encoding the peptides.
(181) As used herein, the term “vaccine” refers to any combination of nucleic acid, peptides or single peptide formulation. There are various reasons why one might wish to administer a vaccine of a combination of the nucleic acids or peptides of the present invention rather than a single peptide. Depending on the particular peptide that one uses, a vaccine might have superior characteristics as far as clinical efficacy, solubility, absorption, stability, toxicity and patient acceptability are concerned. It should be readily apparent to one of ordinary skill in the art how one can formulate a vaccine of any of a number of combinations of peptides of the present invention. There are many strategies for doing so, any one of which may be implemented by routine experimentation.
(182) In some embodiments, provided herein is a subunit vaccine comprising a flaviruses peptide or polypeptide described herein (e.g., a peptide described herein or a portion or variant thereof). A subunit vaccine presents an antigen to the immune system without introducing viral particles, whole or otherwise. In some embodiments, subunit vaccines are generated by recombinant expression of peptide using the methods described herein.
(183) In some embodiments, DNA vaccines comprise nucleic acids encoding an epitope polypeptide described herein in a vector suitable for expression of the nucleic acid. In some embodiments, the nucleic acid is expressed in an expression cassette. In particular embodiments, the expression cassette is a eukaryotic expression cassette. The term “eukaryotic expression cassette” refers to an expression cassette which allows for expression of the open reading frame in a eukaryotic cell. A eukaryotic expression cassette comprises regulatory sequences that are able to control the expression of an open reading frame in a eukaryotic cell, preferably a promoter and polyadenylation signal. Promoters and polyadenylation signals included in the recombinant DNA molecules are selected to be functional within the cells of the subject to be immunized. Examples of suitable promoters, especially for the production of a DNA vaccine for humans, include but are not limited to promoters from cytomegalovirus (CMV), such as the strong CMV immediate early promoter, Simian virus 40 (SV40), Mouse Mammary Tumor Virus (MMTV), Human Immunodeficiency Virus (HIV), such as the HIF Long Terminal Repeat (LTR) promoter, Moloney virus, Epstein Barr Virus (EBV), and from Rous Sarcoma Virus (RSV) as well as promoters from human genes such as human actin, human myosin, human hemoglobin, human muscle creatine, and human metallothionein. In a particular embodiment, the eukaryotic expression cassette contains the CMV promoter. In the context of the present invention, the term “CMV promoter” refers to the strong immediate-early cytomegalovirus promoter.
(184) Examples of suitable polyadenylation signals, especially for the production of a DNA vaccine for humans, include but are not limited to the bovine growth hormone (BGH) polyadenylation site, SV40 polyadenylation signals and LTR polyadenylation signals.
(185) Other elements can also be included in the recombinant DNA molecule. Such additional elements include enhancers. The enhancer can be, for example, the enhancer of human actin, human myosin, human hemoglobin, human muscle creatine and viral enhancers such as those from CMV, RSV and EBV.
(186) Regulatory sequences and codons are generally species dependent, so in order to maximize protein production, the regulatory sequences and codons are preferably selected to be effective in the species to be immunized. The person skilled in the art can produce recombinant DNA molecules that are functional in a given subject species.
(187) In some embodiments, vaccines are adenoviral vaccines (See e.g., Tatsis and Ertl, Mol Ther. 2004 October; 10(4):616-29; herein incorporated by reference). Adenoviral vectors are attractive candidates for transfer of foreign genes for a number of reasons. The adenoviral genome is well characterized and comparatively easy to manipulate. Most adenoviruses cause mild diseases in immunocompetent human adults and by deletion of crucial regions of the viral genome the vectors can be rendered replication-defective, which increases their predictability and reduces unwanted side effects. Adenoviruses have a broad tropism infecting a variety of dividing and nondividing cells. They can be grown to high titers in tissue culture. They can be applied systemically as well as through mucosal surfaces and their relative thermostability facilitates their clinical use.
(188) Thus far most efforts have focused on vectors derived from adenovirus of the human serotype 5 (AdHu5) for use as vaccines for humans, while bovine, porcine, and ovine adenoviruses have been explored for veterinary use. In some embodiments, the
(189) In some embodiments, vaccines comprise a live, attenuated chimeric flavivirus that comprises a Yellow Fever virus in which the pre-membrane and envelope proteins have been replaced with sequences of the peptides described herein. General methods for constructing and administering chimeric flaviviruses that can be used in the present invention are described in detail, for example, in U.S. patent application Ser. Nos. 09/007,664, 09/121,578 (issued as U.S. Pat. No. 6,962,708), and Ser. No. 09/452,638 issued as U.S. Pat. No. 6,696,281); International applications PCT/US98/03894 (WO 98/37911) and PCT/US00/32821 (WO 01/39802); and Chambers et al., J. Virol. 73:3095 3101, 1999, which are each incorporated by reference herein in their entirety.
(190) In some embodiments, vaccines comprise Virus-like particles (VLPs), structures similar or identical to mature virions but lacking the viral genome.
(191) The vaccines of the present invention may be administered as a single agent therapy or in addition to an established therapy. The appropriate dosage of the vaccines of the invention may depend on a variety of factors. Such factors may include, but are in no way limited to, a patient's physical characteristics (e.g., age, weight, sex), whether the compound is being used as single agent or adjuvant therapy, the type of WIC restriction of the patient, the progression (i.e., pathological state) of the infection or other epitope-sensitive condition, and other factors that may be recognized by one skilled in the art. In general, an epitope or combination of epitopes may be administered to a patient in an amount of from about 50 micrograms to about 5 mg; dosage in an amount of from about 50 micrograms to about 500 micrograms is especially preferred.
(192) For example, in some embodiments, the polypeptides comprising one or more epitopes are conjugated or otherwise attached to a carrier protein. Suitable carrier proteins include, but are not limited to keyhole limpet hemocyanin, bovine serum albumin, ovalbumin, and thyroglobulin. In yet other embodiments the polypeptide may be fused to an Fc region of an immunoglobulin for delivery to a mucosal site bearing corresponding receptors.
(193) One may administer a vaccine of the present invention by any suitable method, which may include, but is not limited to, systemic injections (e.g., subcutaneous injection, intradermal injection, intramuscular injection, intravenous infusion) mucosal administrations (e.g., nasal, ocular, oral, vaginal and anal formulations), topical administration (e.g., patch delivery), or by any other pharmacologically appropriate technique. Vaccination protocols using a spray, drop, aerosol, gel or sweet formulation are particularly attractive and may be also used. The vaccine may be administered for delivery at a particular time interval, or may be suitable for a single administration.
(194) Vaccines of the invention may be prepared by combining at least one nucleic acid, virus, polypeptide, or peptide with a pharmaceutically acceptable liquid carrier, a finely divided solid carrier, or both. As used herein, “pharmaceutically acceptable carrier” refers to a carrier that is compatible with the other ingredients of the formulation and is not toxic to the subjects to whom it is administered. Suitable such carriers may include, for example, water, alcohols, natural or hardened oils and waxes, calcium and sodium carbonates, calcium phosphate, kaolin, talc, lactose, combinations thereof and any other suitable carrier as will be recognized by one of skill in the art. In a most preferred embodiment, the carrier is present in an amount of from about 10 uL (micro-Liter) to about 100 uL.
(195) In some embodiments, the vaccine composition includes an adjuvant. Examples of adjuvants include, but are not limited to, mineral salts (e.g., aluminum hydroxide and aluminum or calcium phosphate gels); oil emulsions and surfactant based formulations (e.g., MF59 (microfluidized detergent stabilized oil-in-water emulsion), QS21 (purified saponin), Ribi Adjuvant Systems, AS02 [SBAS2] (oil-in-water emulsion+MPL+QS-21), Montanide ISA-51 and ISA-720 (stabilized water-in-oil emulsion); particulate adjuvants (e.g., virosomes (unilamellar liposomal vehicles incorporating influenza haemagluttinin), AS04 ([SBAS4] Al salt with MPL), ISCOMS (structured complex of saponins and lipids), polylactide co-glycolide (PLG); microbial derivatives (natural and synthetic), e.g., monophosphoryl lipid A (MPL), Detox (MPL+M. phlei cell wall skeleton), AGP [RC-529] (synthetic acylated monosaccharide), DC_Chol (lipoidal immunostimulators able to self organize into liposomes), OM-174 (lipid A derivative), CpG motifs (synthetic oligonucleotides containing immunostimulatory CpG motifs), modified LT and CT (genetically modified bacterial toxins to provide non-toxic adjuvant effects); endogenous human immunomodulators (e.g., hGM-CSF or hIL-12 (cytokines that can be administered either as protein or plasmid encoded), Immudaptin (C3d tandem array); and inert vehicles, such as gold particles. In various embodiments, vaccines according to the invention may be combined with one or more additional components that are typical of pharmaceutical formulations such as vaccines, and can be identified and incorporated into the compositions of the present invention by routine experimentation. Such additional components may include, but are in no way limited to, excipients such as the following: preservatives, such as ethyl-p-hydroxybenzoate; suspending agents such as methyl cellulose, tragacanth, and sodium alginate; wetting agents such as lecithin, polyoxyethylene stearate, and polyoxyethylene sorbitan mono-oleate; granulating and disintegrating agents such as starch and alginic acid; binding agents such as starch, gelatin, and acacia; lubricating agents such as magnesium stearate, stearic acid, and talc; flavoring and coloring agents; and any other excipient conventionally added to pharmaceutical formulations.
(196) Further, in various embodiments, vaccines according to the invention may be combined with one or more of the group consisting of a vehicle, an additive, a pharmaceutical adjunct, a therapeutic compound or agent useful in the treatment of the desired disease, and combinations thereof.
(197) Peptide and Peptidomimetic Drugs:
(198) A further set of embodiments, enabled by the present invention, address the use of peptides or peptidomimetics to bind antibodies generated in response to Zika virus. In some embodiments, small peptides comprising the mimic motif are incorporated into a substrate over which plasma from a subject infected with Zika or dengue is passed and to which antibodies in the plasma bind. To achieve such substrate binding it may be useful to generate the peptides in fusion with a histag, FLAG tag or other tag known to those skilled in the art that facilitates binding to the substrate.
(199) Diagnostics:
(200) A critical need in managing the ZIKV epidemic is the provision of diagnostic tools to physicians to enable in clinic diagnosis and hence the appropriate counselling of pregnant women and rapid initiation of GBS treatment. A particular consideration is that ZIKV co-circulates in the environment with dengue virus as well as yellow fever, and a number of non flavivirus co-endemic pathogens such as chikungunya and Plasmodium. Differentiating both acute febrile disease, and diagnosing GBS, requires a diagnostic test that separates ZIKV from dengue, and also identifies those dengue infections, thought to be only dengue type 3, which could sporadically also lead to GBS. In a particular embodiment, therefore, an immunodiagnostic kit is described which will differentiate Zika and dengue, and also infections with strains of dengue which may result in GBS. A second consideration is that determining the duration of Zika antibodies may determine when it is safe for a woman to conceive without risk of teratogenic sequalae. In another embodiment, therefore, an epitope specific immunoassay kit is described which shows antibody responses to an array of one or more Zika epitopes. In some particularly preferred embodiments, the peptide, polypeptide and protein sequences described above are used as capture reagents in an immunoassay. The present invention encompasses use of the capture reagents in a wide variety of immunoassay formats, including, but not limited to, ELISAs, chip-based assays and arrays, bead-based assays, flow through assays and the like as are known in the art.
(201) In one embodiment, the peptides identified as mimics are included in peptide arrays or presented as peptides for antibody binding within the context of the adjacent ZIKV sequences. In yet other embodiments a synthetic version of the neurologic target protein is incorporated in a diagnostic kit to enable demonstration of binding by antibodies to the mimic target.
(202) In a further embodiment, the present invention addresses the need for epitope specific diagnosis, and the need to differentiate between infections with Zika virus, and serotypes of dengue virus and yellow fever. As USUV spreads into dengue and ZIKV endemic areas it will be further necessary to differentiate from this flavivirus infection. In yet another embodiment, peptides of USUV structural proteins, which may be incorporated into a diagnostic peptide array alongside peptides from other flaviviruses, thereby enabling a peptide based diagnostic kit that provides for differentiation between USUV as well as ZIKV, dengue, yellow fever, West Nile virus, other arboviruses such as chikungunya virus, and other coendemic pathogens is provided.
(203) The present invention addresses diagnostic peptides derived from structural proteins, including envelope, capsid and PrM, and from non structural proteins, in particular but not limited to NS1 proteins, from ZIKV and other flaviviruses as further detailed below. In one embodiment of the present invention we address a peptide derived from the NS1 protein of each virus which can provide differentiation in detection of antibodies. By identifying high probability antibody binding peptides specific for each virus as a reagent for a diagnostic kit, the present invention enables differential serologic diagnosis based on epitopes of NS1 protein.
(204) In particular embodiments the peptides identified may be coupled to an anchor peptide to facilitate their attachment to a substrate, such anchor peptides include, but are not limited to, a his tag or a Flag tag. In yet additional embodiments, the peptides of interest may be fused to a label peptide such as luciferase or green fluorescent protein. These examples of label and anchor peptides should not be considered limiting as other alternatives are well known to those skilled in the art.
(205) A further diagnostic kit allows differentiation of Zika and related flaviviruses from other potentially co-endemic organisms such as, but not limited to Saint Louis Encephalitis virus, hepatitis C, Japanese encephalitis virus, parvovirus 19, enteroviruses, Ross River virus, Eastern equine encephalitis and Plasmodium spp.
(206) Any suitable diagnostic method may be employed in practice of the present invention. In some embodiments, the assay is an immunoassay. Illustrative non-limiting examples of immunoassays include, but are not limited to: immunoprecipitation; Western blot; ELISA; immunohistochemistry; immunocytochemistry; flow cytometry; and, immuno-PCR. Polyclonal or monoclonal antibodies detectably labeled using various techniques known to those of ordinary skill in the art (e.g., colorimetric, fluorescent, chemiluminescent or radioactive) are suitable for use in the immunoassays. The assays may be singleplex assays or multiplex assays. In some embodiments, the peptides, polypeptides and proteins described herein are used as capture reagents in the assays, i.e., the peptides, polypeptides and proteins described herein are configured in the assay system to capture antibodies specific for antigens in the peptides, polypeptides and/or proteins form a biological sample such as a serum or blood sample from a subject suspected of being infected by a flavivirus. The binding of the antibody or antibodies from the biological sample is then detected by methods known in the art (e.g., detection with a labelled second antibody and other methods described herein).
(207) In singleplex assays, an antigenic composition or capture reagent comprising one of the peptides described herein is utilized in the assay. In multiplex assays, a panel of antigenic compositions or capture reagents are utilized in the assay. In some embodiments, the panel comprises at least 2, 3, 5, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, 60, 70, 80, 90 or 100 or more of the peptides described herein.
(208) In some embodiments, the capture reagent of antigenic composition is brought in contact with, and allowed to bind to, a solid support or carrier, such as nitrocellulose or polystyrene or any other solid support known in the art (see below), allowing the antigens to adsorb and become immobilized to the solid support. This immobilized antigen is then allowed to interact with the biological fluid sample which is being tested for the presence of anti-flavivirus antibodies, such that any antibodies in the sample will bind to the immobilized antigen. The support to which the antibody is now bound may then be washed with suitable buffers after which a detectably labeled binding partner for the antibody is introduced. The binding partner binds to the immobilized antibody. Detection of the label is a measure of the immobilized antibody. In some embodiments, the immunoassay of this invention may be a “two-site” or “sandwich” assay. The fluid containing the antibody being assayed is allowed to contact a solid support. After addition of the antigen(s), a quantity of detectably labeled soluble antibody is added to permit detection and/or quantitation of the ternary complex formed between solid-phase antibody, antigen, and labeled antibody. Sandwich assays are described by Wide, Radioimmune Assay Method, Kirkham et al, Eds., E. & S. Livingstone, Edinburgh, 1970, pp 199-206.
(209) A preferred binding partner for these assays is an anti-immunoglobulin antibody (“second antibody”) produced in a different species. Thus to detect a nonhuman primate antibody, a detectably labeled goat anti-simian immunoglobulin “second” antibody may be used. The solid phase support may then be washed with the buffer a second time to remove unbound antibody. The amount of bound label on the solid support may then be detected by conventional means appropriate to the type of label used (see below).
(210) Such a “second antibody” may be specific for epitopes characteristic of a particular human immunoglobulin isotype, for example IgM, IgG.sub.1, IgG.sub.2a, IgA and the like, thus permitting identification of the isotype or isotypes of antibodies in the sample which are specific for the flavivirus antigen. Alternatively, the second antibody may be specific for an idiotype of the anti-flavivirus antibody of the sample.
(211) As alternative binding partners for detection of the sample antibody, other known binding partners for human immunoglobulins may be used. Examples are the staphylococcal immunoglobulin binding proteins, the best known of which is protein A. Also intended is staphylococcal protein G, or a recombinant fusion protein between protein A and protein G. Protein G of group G and group C streptococci binds to the Fc portion of Ig molecules as well as to IgG Fab fragment at the V.sub.H3 domain. Protein C of Peptococcus magnus binds to the Fab region of the immunoglobulin molecule. Any other microbial immunoglobulin binding proteins, for example from Streptococci, are also intended (for example, Langone, J. J., Adv. Immunol 32:157 (1982)).
(212) In another embodiment of this invention, a biological fluid suspected of containing antibodies specific for a flavivirus antigen may be brought into contact with a solid support or carrier which is capable of immobilizing soluble proteins. The support may then be washed with suitable buffers followed by treatment with flavivirus antigen reagent, which may be detectably labeled. Bound antigen is then measured by measuring the immobilized detectable label. If the flavivirus antigen reagent is not directly detectably labeled, a second reagent comprising a detectably labeled binding partner for the flavivirus antigen, generally a second anti-flavivirus antibody such as a murine mAb, is allowed to bind to any immobilized antigen. The solid phase support may then be washed with buffer a second time to remove unbound antibody. The amount of bound label on said solid support may then be detected by conventional means.
(213) By “solid phase support” or carrier is intended any support capable of binding a proteinaceous antigen or antibody molecules or other binding partners according to the present invention. Well-known supports, or carriers, include glass, polystyrene, polypropylene, polyethylene, polyvinylidene difluoride, dextran, nylon, magnetic beads, amylases, natural and modified celluloses, polyacrylamides, agaroses, and magnetite. The nature of the carrier can be either soluble to some extent or insoluble for the purposes of the present invention. The support material may have virtually any possible structural configuration so long as it is capable of binding to an antigen or antibody. Thus, the support configuration may be spherical, as in a bead, or cylindrical, as in the inside surface of a test tube, or the external surface of a rod. Alternatively, the surface may be flat such as a sheet, test strip, etc. Preferred supports include polystyrene beads, 96-well polystyrene microplates and test strips, all well-known in the art. Those skilled in the art will know many other suitable carriers for binding antibody or antigen, or will be able to ascertain the same by use of routine experimentation.
(214) Using any of the assays described herein, those skilled in the art will be able to determine operative and optimal assay conditions for each determination by employing routine experimentation. Furthermore, other steps as washing, stirring, shaking, filtering and the like may be added to the assays as is customary or necessary for the particular situation.
(215) In some embodiments, the present invention provides protein chip assays comprising one or more capture reagents or antigenic compositions comprising at least one the peptides described herein. In such an assay, the capture reagents or antigenic compositions are immobilized on a solid support such as a chip. In some embodiments, the protein chip assay utilizes a solid support coated with ultrathin or clear nitrocellulose. See, e.g., US PAT PUBL. 20090253586 and 20090075828, both of which are incorporated herein by reference in their entirety. In preferred embodiments, the capture reagents or antigenic compositions are arrayed on the solid support. In multiplexed assays, a panel of capture reagents or antigenic compositions as described above is arrayed on the solid support. See, e.g., US PAT PUBL. 20090253586 and 20090075828, both of which are incorporated herein by reference in their entirety. A sample from a subject is passed over the solid support. Bound antibodies from the sample are then detected using any suitable method. Other suitable protein chip assays are described, for example, in U.S. Pat. Nos. 6,197,599; 6,294,790 and US Patent Application US20010014461A1, each of which is herein incorporated by reference in its entirety).
(216) In some embodiments, a cytometric bead array assay is used (Quantum Plex kit, Bangs Laboratories; Cytometric Bead Array kit, BD Biosciences). These systems allow for multiple analyte detection with small volume samples. In other embodiments, a LUMINEX bead assay is used. See, e.g., U.S. Pat. Nos. 6,916,661; 6,939,720; 7,141,431; 7,445,844; 7,465,540; 8,038,734; and 8,088,629, all of which are incorporated herein by reference in their entirety.
(217) In some embodiments, the immunoassay used to detect an antibody specific for an flavivirus antigen according to the present invention is an enzyme-linked immunosorbent assay (ELISA) or more generically termed an enzyme immunoassay (EIA). In such assays, a detectable label bound to either an antibody-binding or antigen-binding reagent is an enzyme. When exposed to its substrate, this enzyme will react in such a manner as to produce a chemical moiety which can be detected, for example, by spectrophotometric, fluorometric or visual means. Enzymes which can be used to detectably label the reagents useful in the present invention include, but are not limited to, horseradish peroxidase, alkaline phosphatase, glucose oxidase, β-galactosidase, ribonuclease, urease, catalase, malate dehydrogenase, staphylococcal nuclease, asparaginase, delta-5-steroid isomerase, yeast alcohol dehydrogenase, α-glycerophosphate dehydrogenase, triose phosphate isomerase, glucose-6-phosphate dehydrogenase, glucoamylase and acetylcholinesterase. For descriptions of EIA procedures, see reference cited above or, additionally, Voller, A. et al., J. Clin. Pathol. 31:507-520 (1978); Butler, J. E., Meth. Enzymol. 73:482-523 (1981); Maggio, E. (ed.), Enzyme Immunoassay, CRC Press, Boca Raton, 1980.
(218) In some embodiments, the immunoassay devices of the present invention permit the performance of relatively inexpensive, disposable, membrane-based assays for the visual identification of the presence (or absence) of an analyte in a liquid sample. Such devices are usually formatted as freestanding dipsticks (e.g., test strips) or as devices having some sort of housing. Typically, an immunoassay device of the present invention can be used with as little as about 200 μl of liquid sample, and detection of an analyte in the sample can (but need not) be complete within 2-5 minutes. In preferred embodiments, no ancillary instrumentation is required to perform such tests, and such devices easily can be used in clinics, laboratories, field locations, and the home even by inexperienced persons.
(219) In some embodiments, the ELISA is an immunochromatographic “sandwich” assay. In general, sandwich immunochromatographic procedures call for mixing the sample that may contain the analyte to be assayed, for example, flavivirus antibodies, with an antigenic composition or capture reagent as described above. A detector reagent is utilized which is mobile and typically is linked to a label or another signaling reagent, such as dyed latex, a colloidal metal sol, or a radioisotope. This mixture is then applied to a chromatographic medium containing a band or zone of immobilized antigenic compositions that serve as antigens for flavivirus antibodies (i.e., the capture reagent). The chromatographic medium often is in the form of a strip that resembles a dipstick. When the complex of flavivirus antibody and the detector reagent reaches the zone of the immobilized capture antibody on the chromatographic medium, binding occurs and the detector reagent complex is localized at the zone. This indicates the presence of the molecule to be assayed. This technique can be used to obtain quantitative or semi-quantitative results. Examples of sandwich immunoassays performed on test strips are described in U.S. Pat. Nos. 4,168,146 and 4,366,241, each of which is incorporated herein by reference.
(220) In other embodiments, the ELISA is a solid phase immunoassay device that provides sensitive detection of analytes in biological fluid samples. Solid phase immunoassay devices incorporate a solid support to which one member of a ligand-receptor pair, usually an antibody, antigen, or hapten, is bound. Common early forms of solid supports were plates, tubes, or beads of polystyrene, which were known from the fields of radioimmunoassay and enzyme immunoassay. More recently, a number of porous materials such as nylon, nitrocellulose, cellulose acetate, glass fibers, and other porous polymers have been employed as solid supports. In other common forms of membrane-based immunoassays, as typified by some home pregnancy and ovulation detection kits, a test strip (or dipstick) is “dipped” into a sample suspected of containing the subject analyte. Enzyme-labeled detector reagent is then added, either simultaneously or after an incubation period. The device next is washed and then inserted into a second solution containing a substrate for the enzyme. The enzyme label, if present, interacts with the substrate, causing the formation of colored products, which either deposit as a precipitate onto the solid phase or produce a visible color change in the substrate solution. EP-A 0 125 118 describes such a sandwich type dipstick immunoassay. EP-A 0 282 192 describes a dipstick device for use in competition type assays.
(221) In other embodiments, the assay device of the present invention is a flow through immunoassay device. Flow-through immunoassay devices involve a capture reagent (such as an immunogenic composition comprising at least one of the peptides described herein) bound to a porous membrane or filter to which a liquid sample is added. As the liquid flows through the membrane, target analyte (such as an flavivirus antibody) binds to the capture reagent. The addition of sample is followed by (or made concurrent with) addition of detector reagent (e.g., labeled second antibody). Alternatively, the detector reagent may be placed on the membrane in a manner that permits the detector to mix with the sample and thereby label the analyte. The visual detection of detector reagent provides an indication of the presence of target analyte in the sample. Representative flow-through immunoassay devices are described in U.S. Pat. Nos. 4,246,339; 4,277,560; 4,632,901; 4,812,293; 4,920,046; and 5,279,935; and U.S. Patent Application Publication Nos. 20030049857 and 20040241876, all of which are incorporated by reference in their entirety. In some embodiments, the assay device is a migration assay device. Such devices usually incorporate within them reagents that have been attached to colored labels, thereby permitting visible detection of the assay results without addition of further substances. See, for example, U.S. Pat. No. 4,770,853; PCT Publication No. WO 88/08534 and European Patent No. EP-A 0 299 428, all of which are incorporated by reference in their entirety.
(222) In some embodiments, the assay device is lateral flow assay device. There are a number of commercially available lateral flow type tests and patents disclosing methods for the detection of analytes. See, e.g., U.S. Pat. Nos. 5,229,073; 5,591,645; 4,168,146; 4,366,241; 4,855,240; 4,861,711; 4,703,017; 5,451,504; 5,451,507; 5,798,273; 6,001,658; and 5,120,643; European Patent No. 0296724; WO 97/06439; and WO 98/36278, all of which are incorporated herein by reference.
(223) The lateral flow assay devices of the present invention include a strip of absorbent or porous material (such as a microporous membrane), which, in some instances, can be made of different substances each joined to the other in zones, which may be abutted and/or overlapped. In some examples, the absorbent strip can be fixed on a supporting non-interactive material (such as nonwoven polyester), for example, to provide increased rigidity to the strip. Zones within each strip may differentially contain the specific binding partner(s) and/or other reagents required for the detection and/or quantification of the particular analyte being tested for, for example, flavivirus antibodies. Thus these zones can be viewed as functional sectors or functional regions within the test device.
(224) In some embodiments, a fluid sample (or a sample suspended in a fluid) is introduced to the strip at the proximal end of the strip, for instance by dipping or spotting. A sample is collected or obtained using methods well known to those skilled in the art. The sample containing the flavivirus antibodies to be detected may be obtained from any biological source. Examples of biological sources include blood serum, blood plasma, urine, spinal fluid, saliva, fermentation fluid, lymph fluid, tissue culture fluid and ascites fluid of a human or animal. The sample may be diluted, purified, concentrated, filtered, dissolved, suspended or otherwise manipulated prior to immunoassay to optimize the immunoassay results. The fluid migrates distally through all the functional regions of the strip. The final distribution of the fluid in the individual functional regions depends on the adsorptive capacity and the dimensions of the materials used.
(225) In some embodiments, porous solid supports, such as nitrocellulose, described hereinabove are preferably in the form of sheets or strips. The thickness of such sheets or strips may vary within wide limits, for example, from about 0.01 to 0.5 mm, from about 0.02 to 0.45 mm, from about 0.05 to 0.3 mm, from about 0.075 to 0.25 mm, from about 0.1 to 0.2 mm, or from about 0.11 to 0.15 mm. The pore size of such sheets or strips may similarly vary within wide limits, for example from about 0.025 to 15 microns, or more specifically from about 0.1 to 3 microns; however, pore size is not intended to be a limiting factor in selection of the solid support. The flow rate of a solid support, where applicable, can also vary within wide limits, for example from about 12.5 to 90 sec/cm (i.e., 50 to 300 sec/4 cm), about 22.5 to 62.5 sec/cm (i.e., 90 to 250 sec/4 cm), about 25 to 62.5 sec/cm (i.e., 100 to 250 sec/4 cm), about 37.5 to 62.5 sec/cm (i.e., 150 to 250 sec/4 cm), or about 50 to 62.5 sec/cm (i.e., 200 to 250 sec/4 cm). In specific embodiments of devices described herein, the flow rate is about 62.5 sec/cm (i.e., 250 sec/4 cm). In other specific embodiments of devices described herein, the flow rate is about 37.5 sec/cm (i.e., 150 sec/4 cm).
(226) In some embodiments, the assay devices include a detector reagent. The detector reagent provides a means to detect the formation of a complex between an analyte (such as an flavivirus antibody or antibodies) and a capture reagent (such as an antigenic composition as described above). A detector may be integrated into an immunoassay device (for example included in a conjugate pad, as described below), or may be applied to the device from an external source.
(227) A detector may be a single reagent or a series of reagents that collectively serve the detection purpose. In some instances, a detector reagent is a labeled binding partner specific for the analyte. In other instances, a detector reagent collectively includes an unlabeled first binding partner specific for the analyte and a labeled second binding partner specific for the first binding partner and so forth. In each instance, a detector reagent specifically detects bound analyte of an analyte-capture reagent complex and, therefore, a detector reagent preferably does not substantially bind to or react with the capture reagent or other components localized in the analyte capture area. Such non-specific binding or reaction of a detector may provide a false positive result. Optionally, a detector reagent can specifically recognize a positive control molecule (such as a non-specific human IgG for a labeled Protein A detector, or a labeled Protein G detector, or a labeled anti-human Ab(Fc)) that is present in a secondary capture area.
(228) The flow-through devices of the present invention comprise a capture reagent (e.g., antigenic composition as described above) immobilized on a solid support such as a microtiter plate or a membrane (such as, nitrocellulose, nylon, or PVDF). Characteristics of useful membrane have been previously described; however, it is useful to note that in a flow-through assay capillary rise is not a particularly important feature of a membrane as the sample moves vertically through the membrane rather than across it as in a lateral flow assay. In a simple representative format, the membrane of a flow-through device is placed in functional or physical contact with an absorbent layer (see, e.g., description of “absorbent pad” below), which acts as a reservoir to draw a fluid sample through the membrane. Optionally, following immobilization of a capture reagent, any remaining protein-binding sites on the membrane can be blocked (either before or concurrent with sample administration) to minimize nonspecific interactions.
(229) In operation of a flow-through device, a fluid sample (such as a bodily fluid sample) is placed in contact with the membrane. Typically, a flow-through device also includes a sample application area (or reservoir) to receive and temporarily retain a fluid sample of a desired volume. The sample passes through the membrane matrix. In this process, an analyte in the sample (e.g., flavivirus antibody or antibodies) can specifically bind to the immobilized capture reagent. Where detection of an analyte-capture reagent complex is desired, a detector reagent (e.g., labeled Protein A, labeled second antibody) can be added with the sample or a solution containing a detector reagent can be added subsequent to application of the sample. If an analyte is specifically bound by capture reagent, a visual representative attributable to the particular detector reagent can be observed on the surface of the membrane. Optional wash steps can be added at any time in the process, for instance, following application of the sample, and/or following application of a detector reagent.
(230) A lateral flow device is an analytical device comprising a test strip, through which flows a test sample fluid that is suspected of containing an analyte of interest. The test fluid and any suspended analyte can flow along the strip to a detection zone in which the analyte (if present) interacts with a capture agent and a detection agent to indicate a presence, absence and/or quantity of the analyte. Many lateral flow devices are one-step lateral flow assays in which a biological fluid is placed in a sample area on a bibulous strip (though, non-bibulous materials can be used, and rendered bibulous, e.g., by applying a surfactant to the material), and allowed to migrate along the strip until the liquid comes into contact with a specific binding partner that interacts with an analyte in the liquid. Once the analyte interacts with the binding partner, a signal (such as a fluorescent or otherwise visible dye) indicates that the interaction has occurred. Multiple discrete binding partners can be placed on the strip (for example in parallel lines) to detect multiple analytes in the liquid. The test strips can also incorporate control indicators, which provide a signal that the test has adequately been performed, even if a positive signal indicating the presence (or absence) of an analyte is not seen on the strip.
(231) The construction and design of lateral flow devices is described, for example, in Millipore Corporation, A Short Guide Developing Immunochromatographic Test Strips, 2nd Edition, pp. 1-40, 1999, available by request at (800) 645-5476; and Schleicher & Schuell, Easy to Work with BioScience, Products and Protocols 2003, pp. 73-98, 2003, available by request at Schleicher & Schuell BioScience, Inc., 10 Optical Avenue, Keene, N.H. 03431, (603) 352-3810; both of which are incorporated herein by reference. Lateral flow devices have a wide variety of physical formats. Any physical format that supports and/or houses the basic components of a lateral flow device in the proper function relationship is contemplated by this disclosure.
(232) In some embodiments, lateral flow devices of the present invention comprise an elongated housing containing a bibulous lateral flow strip that extends substantially the entire length of housing. In some embodiments, the lateral flow strip is divided into a proximal sample application pad positioned below a sample introduction port, an intermediate test result membrane, and a distal absorbent pad. The flow strip is interrupted by a conjugate pad that contains labeled conjugate (such labeled second antibody). A flow path along the strip passes from the proximal pad, through conjugate pad, into a test result membrane, for eventual collection in absorbent pad. Selective binding agents (such as the antigenic compositions described above) are positioned on a proximal test line in the test result membrane. A control line is provided in the test result membrane slightly distal to the test line. A fluid sample containing an analyte of interest, such as flavivirus antibody or antibodies, is applied to the sample pad through the sample introduction port. In some embodiments, the sample may be applied to the sample introduction port dropwise or by dipping the end of the device containing the sample introduction port into the sample. From the sample pad, the sample passes, for instance by capillary action, to the conjugate pad. In the conjugate pad, the analyte of interest may bind (or be bound by) a mobilized or mobilizable detector reagent. For example, an flavivirus antibody may bind to a labeled (e.g., gold-conjugated) detector reagent (such as a second antibody contained in the conjugate pad. The analyte complexed with the detector reagent may subsequently flow to the test result membrane where the complex may further interact with a capture reagent, such as an antigenic composition as described above, which is immobilized at the proximal test line. The formation of the immunocomplex between flavivirus antibody, labeled (e.g., gold-conjugated) detector reagent, and immobilized antigenic composition can be detected by the appearance of a visible line at the proximal test line, which results from the accumulation of the label (e.g., gold) in the localized region of the proximal test line. The control line may contain an immobilized, detector-reagent-specific binding partner, which can bind the detector reagent in the presence or absence of the analyte. Such binding at the control line indicates proper performance of the test, even in the absence of the analyte of interest.
(233) The particular materials used in a particular lateral flow device will depend on a number of variables, including, for example, the analyte to be detected, the sample volume, the desired flow rate and others. In some embodiments, the sample pad receives the sample, and may serve to remove particulates from the sample. In some embodiments, the sample pad is cellulose. Sample pads may be treated with one or more release agents, such as buffers, salts, proteins, detergents, and surfactants. Such release agents may be useful, for example, to promote resolubilization of conjugate-pad constituents, and to block non-specific binding sites in other components of a lateral flow device, such as a nitrocellulose membrane. Representative release agents include, for example, trehalose or glucose (1%-5%), PVP or PVA (0.5%-2%), Tween 20 or Triton X-100 (0.1%-1%), casein (1%-2%), SDS (0.02%-5%), and PEG (0.02%-5%).
(234) The conjugate pad holds a detector reagent. In some embodiments, a detector reagent may be applied externally, for example, from a developer bottle, in which case a lateral flow device need not contain a conjugate pad (see, for example, U.S. Pat. No. 4,740,468). Detector reagent(s) contained in a conjugate pad is typically released into solution upon application of the test sample. A conjugate pad may be treated with various substances to influence release of the detector reagent into solution. For example, the conjugate pad may be treated with PVA or PVP (0.5% to 2%) and/or Triton X-100 (0.5%). Other release agents include, without limitation, hydroxypropylmethyl cellulose, SDS, Brij and β-lactose.
(235) The absorbent pad acts to increase the total volume of sample that enters the device. This increased volume can be useful, for example, to wash away unbound analyte from the membrane. Any of a variety of materials is useful to prepare an absorbent pad. In some device embodiments, an absorbent pad can be paper (i.e., cellulosic fibers). One of skill in the art may select a paper absorbent pad on the basis of, for example, its thickness, compressibility, manufacturability, and uniformity of bed volume. The volume uptake of an absorbent made may be adjusted by changing the dimensions (usually the length) of an absorbent pad.
(236) A wide variety of detectable labels are useful with the assays described above in addition to the described enzymatic labels.
(237) In another embodiment, the detectable label may be a gold or silver nanoparticle that can be enhanced with non-enzymatic silver deposition (SilverQuant™). Methods for detection with silver or gold nanoparticles are described in detail in U.S. Pat. No. 7,321,829, incorporated by reference herein its entirety, as well as in US PUBL. 20090253586, also incorporated herein by reference in its entirety.
(238) In another embodiment, the detectable label may be a Proximity Ligation Assay (PLA) reagent. Proximity ligation assay (PLA) is an approach for protein quantitation that can use two different binder molecules (proximity probes) to bind to a specific detection target (See for example Fredriksson, S. et al., Nat Biotechnol. 2002; 20(5): 473-77, Gullberg, M., et. al., Proc Natl Acad Sci USA. 2004; 101(22): 8420-24, Gullberg, M., et. al., Curr Opin Biotechnol. 2003; 14: 1-5, Pai, S., Ellington, A. D. and Levy, M., Nuc Acids Res. Oct. 19, 2005; 33(18): e162, Landegren, U. and Fredriksson, S., US Patent Application 20020064779, May 30, 2002, Fredriksson, S., US Patent Application 20050003361, all of which are incorporated by reference herein in their entirety. Typical binders include polyclonal or monoclonal antibody pairs. Each binder molecule can be conjugated to a specific oligonucleotide. One binder's oligonucleotide can form the “left” side of a real-time PCR amplicon, while the other binder can form the “right” side. When the two binders find and attach to the same target, the left and right oligomers are brought into close proximity. With the addition of a connector oligonucleotide (splint) and ligase enzyme, the left and right oligomers can become ligated and thereby allow for the formation of a complete target for a real-time PCR. Further addition of Taqman reaction components followed by thermocycling generates real-time sequence detection data output.
(239) In another embodiment, the detectable label may be a radiolabel, and the assay termed a radioimmunoassay (MA), as is well known in the art. The radioisotope can be detected by a gamma counter, a scintillation counter or by autoradiography. Isotopes which are particularly useful for the purpose of the present invention are .sup.125I, .sup.131I, .sup.35S, .sup.3H and .sup.14C.
(240) It is also possible to label the antigen or antibody reagents with a fluorophore. When the fluorescently labeled antibody is exposed to light of the proper wave length, its presence can then be detected due to fluorescence of the fluorophore. Among the most commonly used fluorophores are fluorescein isothiocyanate, rhodamine, phycoerythrin, phycocyanin, allophycocyanin, o-phthaldehyde, fluorescamine or fluorescence-emitting metals such as .sup.152Eu or other lanthanides. These metals are attached to antibodies using metal chelators.
(241) The antigen or antibody reagents useful in the present invention also can be detectably labeled by coupling to a chemiluminescent compound. The presence of a chemiluminescent-tagged antibody or antigen is then determined by detecting the luminescence that arises during the course of a chemical reaction. Examples of useful chemiluminescent labeling compounds are luminol, isoluminol, theromatic acridinium ester, imidazole, acridinium salt and oxalate ester. Likewise, a bioluminescent compound such as a bioluminescent protein may be used to label the antigen or antibody reagent useful in the present invention. Binding is measured by detecting the luminescence. Useful bioluminescent compounds include luciferin, luciferase and aequorin.
(242) Detection of the detectably labeled reagent according to the present invention may be accomplished by a scintillation counter, for example, if the detectable label is a radioactive gamma emitter, or by a fluorometer, for example, if the label is a fluorophore. In the case of an enzyme label, the detection is accomplished by colorimetry to measure the colored product produced by conversion of a chromogenic substrate by the enzyme. Detection may also be accomplished by visual comparison of the colored product of the enzymatic reaction in comparison with appropriate standards or controls.
(243) In some embodiments, the one or more of the peptides or conjugates described above (alone or in combination) are used as an antigen stimulation mixture for cell based assays including, but not limited to, cytokine release assays (particularly interferon gamma release and interleukin 12) as measured by ELISA, Elispot, or bead based methods. In other embodiments, the peptides or conjugates described above (alone or in combination) are used in T-cell capture assays. In still other embodiments, the peptides or conjugates described above (alone or in combination) are used as an antigenic substitute for tuberculin in the tuberculin skin test (TST).
(244) Immunovigilance:
(245) In a different embodiment of the present invention, the mapping of specific B cell and T cell epitopes is important to managing and understanding the Zika epidemic spread. The recognition that minor amino acid changes can generate novel epitope mimics means that ongoing vigilance the virus is needed to determine if any new epitope characteristics appear or disappear. This can be done by comparison of sequences for the location of B and T cell epitopes and the absence of possibly suppressive T cell motifs. By hierarchical clustering of sequences with those collected to date any new immunological outliers can be detected. It will be appreciated that for an infection whose primary clinical manifestation is autoimmune, rapid detection of new or changing epitopes is of the upmost importance.
(246) In some embodiments, the present invention provides linkage of epitope mimics to intrauterine pathology. In some embodiments, the present invention provides epitopes that find use in research applications (e.g., to further understanding of pathology of GBS).
(247) Surrogate Markers and Diagnostics:
(248) The clinical manifestations of Zika infection include neuropathologies that may be detected some-time after the initial viral infection. This includes GBS and other neural deficits detected in the weeks following acute infection. It also includes the array of teratologic neural abnormalities referred to as Zika fetal syndrome, which only become apparent on ultrasound or on the birth of the child. It is likely that further consequences of Zika fetal syndrome are detected as the children infected in utero grow up. This is the case in rubella infections. Given the delay to detection of such signs it is useful to have an indicator which can anticipate which individuals may be affected. Detection of antibodies to the human neurologic proteins bearing the mimics provides such a surrogate marker or indicator. Therefore, one embodiment of the present invention is the provision of synthetic versions of the neurologic proteins and control versions of the same in which the mimic motifs have been mutated or replaced. This enables the determination of antibodies which bind to the mimic epitopes of concern. Such synthetic polypeptides may be derived from NPY or from NAV2 or from any other human protein which carries a mimic with which anti Zika antibodies react. Such synthetic polypeptides may be included in an assay format for detection of serum antibodies. The assay format may be any format known to those skilled in the art including but not limited to Western blots, ELISA, gel diffusion, dot blots or others.
(249) Endemnicity of Zika Compared to Malaria:
(250) In conducting a bioinformatics analysis of ZIKV and other closely related flaviviruses to identify peptides that are B cell epitopes which may serve in differential diagnosis between the co-endemic flaviviruses, we also examined the potential cross reactivity with other pathogens. A high degree of B cell epitope identity with Plasmodium falciparum was noted indicative of probable cross reactivity. This was found in both envelope and NS1 proteins and was identified as to the specific sequences which have matching B cell epitopes, as further described in the Examples. When a similar comparison was conducted for P.vivax a similar number of potential cross reactive B cell epitopes was identified, in different proteins from those identified in P. falciparum. Particularly noticeable in the case of the B cell epitope matches between ZIKV and P falciparum was that P falciparum B cell epitopes occurred in erythrocyte and liver stage antigens of the malaria parasite, some of which are under investigation as potential malaria vaccines [45]. The presence of cross reactions between Zika NS1 and malaria was noted in a comment in Eurosurveillance [46] as a potential complication in interpretation of the Euroimmun diagnostic test.
(251) A comparison of the maps of P. falciparum distribution both in Brazil and globally makes abundantly clear that severe Zika disease is occurring where malaria is absent (
(252) B cell epitopes are bound by B cell receptors and by specific antibody variable regions. Recent work has determined that the binding of an antibody variable region or B cell receptor depends on a span of five amino acids [47]. The strategy developed and demonstrated herein for identifying B cell epitopes shared between Zika and other flaviviruses and Plasmodium therefore depends on identifying identical pentamers located in high probability B cell binding sequences. The probability of occurrence of any one B cell pentamer occurring in a protein is 20.sup.5 or 1 in 3.2 million possible pentamer configurations. Thus, finding a matching pentamer in two independent proteins is 3.2 million×3.2 million or 1 in 10.sup.12. In one particular embodiment, a hexamer peptide B cell epitope of the liver specific protein of P. falciparum (Pf3D7_1418100 LISP) matches a B cell epitope in the DE loop of Envelope domain III of Zika virus. A hexamer match is a rare chance of 4 in 10.sup.15. This Zika loop coincides with the protective epitope previously identified [48]. Another such hexamer match is found in the Domain 1 Zika envelope protein with PF3D7_1408700 conserved Plasmodium protein.
(253) In one series of embodiments of the present invention, therefore, we identify B cell epitopes of malaria proteins which are identical with B cell epitopes of Zika virus. Some of these correspond to epitopes on Zika envelope identified herein as eliciting protective antibodies and subsequently confirmed by others [48] and which can therefore provide cross protection. In some particular embodiments, these epitopes are in Plasmodium falciparum proteins; in yet others they are in P. vivax proteins. Another embodiment arising from this is a vaccine which comprises polypeptides or peptides from Plasmodium as an immunogen component of a vaccine intended to protect from Zika infection and/or disease.
(254) A concern with Zika disease is that the GBS autoimmune disease and other manifestations of clinical disease such as thrombocytopenia [39] may be driven by antibodies to epitope mimics matching human proteome proteins. A particular advantage of the use of malaria peptides and polypeptides is that they may offer protection, while not simultaneously providing flanking peptides which may elicit autoimmune antibodies. In one embodiment of the present invention we identify malaria peptides which avoid particular epitope mimics in the human proteome and provide compositions for use as ZIKV preventive vaccines.
(255) A further concern in flavivirus pathology is that sub neutralizing antibodies have been linked to enhanced virus titers on exposure to a second related flavivirus infection. This occurs between two dengue infections of different serotypes and between dengue and ZIKV [37]. Much of the ADE has been traced to a region of the envelope protein known as the fusion loop [4] forming the tip of the Domain 2 of the envelope. A peptide sequence DRGWGN (SEQ ID NO.: 1259) that contributes to this epitope in flaviviruses is absent from Plasmodium falciparum and P. vivax. This provides the opportunity, in one embodiment herein, to define immunogenic peptides or polypeptides of malaria proteins which avoid causing ADE. In yet another embodiment it allows differential diagnosis of flavivirus infections from malaria, given the absence from Plasmodium of the peptide motifs in flavivirus fusion loop which generate cross reactive antibodies common to dengue, ZIKV and Yellow fever. The two safety features cited above, avoidance of autoimmune mimics and ADE, are of particular importance in designing a vaccine.
(256) In a further set of embodiments of the present invention, we identify a diagnostic strategy which considers the cross reactivity of Plasmodium in design of a diagnostic kit for Zika.
(257) While the specific examples that follow in relation to Plasmodium mimics apply initially to Zika this is not intended to be restrictive as a similar overlap of B cell epitopes is identified for dengue and yellow fever and in further embodiments will allow design of vaccine polypeptides and peptides and diagnostic strategies for these flaviviruses also.
(258) B Cell Elimination:
(259) The adverse effects resulting from antibodies from Zika virus exposure which are directed to a human neurologic protein, or from dengue exposure, which are directed to a mimic epitope matching an epitope in a human protein of cardiovascular function, or indeed from autoimmune antibodies arising from any flavivirus exposure, may be mitigated by prior vaccination with a vaccine in which the epitopes of interest are mutated, or the antibodies may be reduced by plasmapheresis. During plasmapheresis, blood (which consists of blood cells and a clear liquid called plasma) is initially taken out of the body through a needle or previously implanted catheter. Plasma is then removed from the blood by a cell separator. In order to remove autoantibodies to Zika epitopes, blood plasma is removed and exchanged with blood products to be donated to the recipient. This type of plasmapheresis is called plasma exchange (PE or PEX) or plasma exchange therapy (PET). The removed plasma is discarded and the patient receives replacement donor plasma, albumin, or a combination of albumin and saline (usually 70% albumin and 30% saline). In some embodiments, auto-antibodies are removed from the isolated plasma by filtration on a specific substrate (e.g., comprising a peptide described herein). In some embodiments, a column is attached to the plasma line, selectively eliminating the pathogenic autoantibody and returning the patient's own plasma. Any suitable substrate may be utilized in plasmapheresis (e.g., particle, bead, filter, resin, etc.)
(260) However, a concern remains that as long as the B cell clonal populations which secrete the mimic-binding antibodies remain in the body, they may continue to secrete the antibodies and the clonal populations may expand again on re-exposure to the virus. In these circumstances, it may be useful to abrogate those B cell clonal lines which are generating the antibodies specific for these mimic epitopes. This can be achieved by “baiting” the B cells with the epitope mimic peptides fused to a cytocide or cytotoxin, so that as B cells specifically bind and incorporate the peptide they are also specifically exposed to the lethal cytocide or cytotoxin, many of which are known to those skilled in the art but which include RNAses (e.g., RNase A, RNase H, RNase III, RNase L, RNase P, RNase PhyM, RNase T1, RNase T2, RNase U2, and RNase V i), membrane active peptides (e.g., amyloid peptides, antimicrobial peptides, and cell-penetrating peptides), and diphtheria toxin. See also, WO 2010/083225, herein incorporated by reference in its entirety. Cytotoxins may also include radioactive alpha emitters or auger particles. In a particular embodiment herein therefore, the epitope peptide identified in the flavivirus is operatively linked to a cytotoxin or cytocide and administered to an affected subject.
EXPERIMENTAL
(261) The following examples are provided in order to demonstrate and further illustrate certain preferred embodiments and aspects of the present invention and are not to be construed as limiting the scope thereof.
Example 1
(262) Identification of Epitopes Unique to American Zika Virus and Comparison to Dengue and Yellow Fever.
(263) Rapid immunoinformatic analysis of the envelope protein of Zika, from ZikaSPH2015 (KU321639), indicates predicted B and T cell epitopes in peptides that are structurally consistent to those reported for dengue, YF and JEV (
Example 2 Identification of Epitope Mimics in Zika Virus Structural Proteins
(264) Following computation of master matrices of B cell and MHC binding predictions as previously described (PCT US2011/029192, PCT US2012/055038, and US2014/01452, each of which is incorporated herein by reference) a subset of peptides was identified which has predicted binding to B cell epitopes in the top 25%, i.e. those with binding of less than −0.6 standard deviation units below the mean for the protein. Peptides selected were pentamers, which is a conservative filter as B cells may bind to as few as 3 amino acids. This set of pentamers was joined to a precomputed database of pentamers in the human proteome (over 33 million peptides). This was in turn compiled with a list of Uniprot identities. The resulting subset of ˜2700 proteins was manually curated and searched using a key term search for proteins curated as containing “neur” “glial” and “synap”. A subset of proteins with neural function and match of pentamers to Zika B cell epitopes was thus arrived at Table 1.
(265) TABLE-US-00001 TABLE 1 Zika Env Pentamer Other aa motif Protein ID in Human proteome flavi? position SEQ 1 PVITE E7EMY4_HUMAN Neural cell adhesion molecule L1 (Fra 0 364 SEQ 2 EGAVH E7EP46_HUMAN Neurotrophin-4 OS = Homo sapiens 0 263 SEQ 3 STENS E7EP46_HUMAN Neurotrophin-4 OS = Homo sapiens 0 369 SEQ 4 PVITE E7EPI4_HUMAN Neural cell adhesion molecule L1 (Fra 0 364 SEQ 5 PVITE E7EVM4_HUMAN Neural cell adhesion molecule L1 (Fra 0 364 SEQ 6 PVITE E9PHJ4_HUMAN Neural cell adhesion molecule L1 (Fra 0 364 SEQ 7 KGRLS E9PNV5_HUMAN Neuron navigator 2 (Fragment) 1 282 SEQ 8 PVITE F5H025_HUMAN Neural cell adhesion molecule L1 1 364 SEQ 9 PVITE F5H1H0_HUMAN Neural cell adhesion molecule L1 1 364 SEQ 10 PVITE L1CAM_HUMAN Isoform 2 of Neural cell adhesion mole 1 364 SEQ 11 PVITE L1CAM_HUMAN Isoform 3 of Neural cell adhesion mole 1 364 SEQ 12 PVITE L1CAM_HUMAN Neural cell adhesion molecule L1 1 364 SEQ 13 AGADT M0QX38_HUMAN Neurogenic locus notch homolog 1 228 SEQ 14 KGRLS NAV2_HUMAN Isoform 10 of Neuron navigator 2 1 282 SEQ 15 KGRLS NAV2_HUMAN Isoform 11 of Neuron navigator 2 1 282 SEQ 16 KGRLS NAV2_HUMAN Isoform 12 of Neuron navigator 2 1 282 SEQ 17 KGRLS NAV2_HUMAN Isoform 13 of Neuron navigator 2 1 282 SEQ 18 KGRLS NAV2_HUMAN Isoform 2 of Neuron navigator 2 1 282 SEQ 19 KGRLS NAV2_HUMAN Isoform 3 of Neuron navigator 2 1 282 SEQ 20 KGRLS NAV2_HUMAN Isoform 4 of Neuron navigator 2 1 282 SEQ 21 KGRLS NAV2_HUMAN Isoform 5 of Neuron navigator 2 1 282 SEQ 22 KGRLS NAV2_HUMAN Isoform 8 of Neuron navigator 2 1 282 SEQ 23 KGRLS NAV2_HUMAN Isoform 9 of Neuron navigator 2 1 282 SEQ 24 KGRLS NAV2_HUMAN Neuron navigator 2 OS = Homo sapiens 1 282 SEQ 25 ATLGG NCAM1_HUMAN Isoform 3 of Neural cell adhesion mol 0 179 SEQ 26 ATLGG NCAM1_HUMAN Isoform 4 of Neural cell adhesion mol 0 179 SEQ 27 LSSGH NDF4_HUMAN Neurogenic differentiation factor 4 OS = 0 285 SEQ 28 GGALN NOTC1_HUMAN Neurogenic locus notch homolog 1 436 SEQ 29 QPENL NOTC2_HUMAN Neurogenic locus notch homolog 0 132 SEQ 30 AGADT NOTC3_HUMAN Neurogenic locus notch homolog 1 228 SEQ 31 ESTEN NPY_HUMAN Pro-neuropeptide Y OS = Homo sapiens 1 368 SEQ 32 AGTDG NUFP2_HUMAN Nuclear fragile X mental retardation-i 0 230 SEQ 33 ATLGG R4GMN9_HUMAN Neural cell adhesion molecule 1 0 179 SEQ 34 RAEAT SNP29_HUMAN Synaptosomal-associated protein 29 0 176 Column 3 indicates whether the same protein (by different motifs) is matched in other flaviruses, 1 = yes
(266) The same process was repeated for the envelopes of 18 flaviviruses comprising those shown in Table 2 which includes 15 non Zika viruses.
(267) TABLE-US-00002 TABLE 2 Gi or Flavivirus accession number Zika - SPH2015 Brazil 969945757 Zika - Cook Islands 631250743 631250743 Zika - ArD158084 Senegal 592746966 Dengue 3 and 4 (2 each) recent wildtypes GQ330473 JF808120 from Brazil JN848496 JQ513335 Dengue 1 and 2 (2 each, partial env) HQ184924 KP858105 recent wildtypes from Brazil KP858119 HQ184925 Yellow fever - 2007 Peru wildtype isolate GQ379163 YF 17D vaccine strain 130490 Dengue 1 and 2 reference strains 119364637 and 266813 (not South American) WNV 37999909 JEV 130490 TBEV 6226885
(268) In addition to identifying neural matches, a comparison of pentamer usage among the 18 flavivirus envelopes confirmed that of 8505 unique pentamers, 1144 were found exclusively in the 3 Zika viruses and that the distribution of unique motifs was as shown in Table 3 and the sharing patterns are shown in
(269) TABLE-US-00003 TABLE 3 Unique Zika Zika Zika pentamer Senegal Cook Is Brazil 329 + + + 45 + − − 48 − + + 5 − − +
Isolate identities as in Table 2
(270) Among the flaviviruses that are not Zika viruses, additional neural matches were found as shown in Table 4. Some pentamer matches occurred in multiple flaviviruses (score not shown in Table 4)
(271) TABLE-US-00004 TABLE 4 pentamer Human protein id SEQ 35 AGADT M0QX38_HUMAN Neurogenic locus notch, homolog protein SEQ 36 AGADT NOTC3_HUMAN Neurogenic locus notch homolog protein SEQ 37 DGSPC NOTC3_HUMAN Neurogenic locus notch homolog protein SEQ 38 GEDAP NPY_HUMAN Pro-neuropeptide Y OS = Homo sapiens GN = NP SEQ 39 GNETT F5H025_HUMAN Neural cell adhesion molecule L1 OS = H SEQ 40 GNETT F5H1H0_HUMAN Neural cell adhesion molecule L1 OS = H SEQ 41 GNETT L1CAM_HUMAN Isoform 2 of Neural cell adhesion mole SEQ 42 GNETT L1CAM_HUMAN isoform 3 of Neural cell adhesion mole SEQ 43 GNETT L1CAM_HUMAN Neural cell adhesion molecule L1 OS = Ho SEQ 44 KCPST F5H804_HUMAN Nuclear protein MDM1 OS = Homo sapiens SEQ 45 KNPVD F5H025_HUMAN Neural cell adhesion molecule L1 OS = H SEQ 46 KNPVD F5H1H0_HUMAN Neural cell adhesion molecule L1 OS = H SEQ 47 KNPVD L1CAM_HUMAN Isoform 2 of Neural cell adhesion mole SEQ 48 KNPVD L1CAM_HUMAN Isoform 3 of Neural cell adhesion, mole SEQ 49 KNPVD L1CAM_HUMAN Neural cell adhesion molecule L1 OS = Ho SEQ 50 LKGTT NOTC1_HUMAN Neurogenic locus notch homolog protein SEQ 51 STTLK F5H025_HUMAN Neural cell adhesion molecule L1 OS = H SEQ 52 STTLK F5H1H0_HUMAN Neural cell adhesion molecule L1 OS = H SEQ 53 STTLK L1CAM_HUMAN Isoform 2 of Neural cell adhesion mole SEQ 54 STTLK L1CAM_HUMAN Isoform 3 of Neural cell adhesion mole SEQ 55 STTLK L1CAM_HUMAN Neural cell adhesion molecule L1 OS = Ho SEQ 56 TDKEK E9PNV5_HUMAN Neuron navigator 2 (Fragment) OS = Hom SEQ 57 TDKEK NAV2_HUMAN Isoform 10 of Neuron navigator 2 OS = Hom SEQ 58 TDKEK NAV2_HUMAN Isoform 11 of Neuron navigator 2 OS = Hom SEQ 59 TDKEK NAV2_HUMAN Isoform 12 of Neuron navigator 2 OS = Hom SEQ 60 TDKEK NAV2_HUMAN Isoform 13 of Neuron navigator 2 OS = Hom SEQ 61 TDKEK NAV2_HUMAN Isoform 2 of Neuron navigator 2 OS = Homo SEQ 62 TDKEK NAV2_HUMAN Isoform 3 of Neuron navigator 2 OS = Homo SEQ 63 TDKEK NAV2_HUMAN Isoform 4 of Neuron navigator 2 OS = Homo SEQ 64 TDKEK NAV2_HUMAN Isoform 5 of Neuron navigator 2 OS = Homo SEQ 65 TDKEK NAV2_HUMAN Isoform 8 of Neuron navigator 2 OS = Homo SEQ 66 TDKEK NAV2_HUMAN Isoform 9 of Neuron navigator OS = Homo SEQ 67 TDKEK NAV2_HUMAN Neuron navigator 2 OS = Homo sapiens GN = N SEQ 68 TPQAP NAV2_HUMAN Isoform 10 of Neuron, navigator 2 OS = Hom SEQ 69 TPQAP NAV2_HUMAN Isoform 11 of Neuron navigator 2 OS = Hom SEQ 70 TPQAP NAV2_HUMAN Isoform 12 of Neuron navigator 2 OS = Hom SEQ 71 TPQAP NAV2_HUMAN Isoform 13 of Neuron navigator 2 OS = Hom SEQ 72 TPQAP NAV2_HUMAN Isoform 2 of Neuron navigator 2 OS = Homo SEQ 73 TPQAP NAV2_HUMAN Isoform 3 of Neuron navigator 2 OS = Homo SEQ 74 TPQAP NAV2_HUMAN Isoform 4 of Neuron navigator 2 OS = Homo SEQ 75 TPQAP NAV2_HUMAN Isoform 8 of Neuron navigator 2 OS = Homo SEQ 76 TPQAP NAV2_HUMAN Isoform 9 of Neuron navigator 2 OS = Homo SEQ 77 TPQAP NAV2_HUMAN Neuron navigator 2 OS = Homo sapiens
(272) While there is considerable commonality between the proteins in which matches occur in ZIKVa vs other flaviviruses, the actual pentamers and their positions in both virus and target human protein was different. Each motif and the associated epitope context was examined in both source (virus) and target (human neural protein). Most consideration was given to those which match a B cell epitope in the target protein as well as a B cell epitope in the source. Each neural protein was mapped, as were the envelope proteins. The associated MEW binding in the source viral protein was reviewed as an indicator of how strong an antibody response may be stimulated due to more/lessT helper cells.
(273) As an example of the findings, both dengue 3 and ZIKV have peptides which match a counterpart target motif in NPY. Coincidentally the dengue pentamer ˜GEDAP˜ (SEQ ID NO.: 38) is only found in dengue 3 isolates of >400 dengue isolates since 2005 from S America that we queried, not in other dengue types. The comparative features are shown in Table 5.
(274) TABLE-US-00005 TABLE 5 Virus Virus BEPI pentamer Envelope strength in MHC II in NPY Virus motif position Source virus Source virus position NPY Bepi? Zika (all ~ESTEN~ 368, Domain Moderate Very Strong Position 86 yes isolates) (SEQ ID III loop5* all DRB and BEPI centerd NO: 31) DP and DQ at position 88 alleles In CONAP C terminal peptide Dengue (only ~GEDAP~ 328, Domain Moderate Weak except Position 42, Yes DEN3 (SEQ ID III loop4* for DRB1: 0404 BEPI centered NO: 38) and DRB1: 1101 at 44. In helical mature peptide *envelope aa positions based on GenPep indications of regions in polyprotein.
(275)
(276) Similar comparative analysis of other neural proteins indicates that those specific to ZIKV may also play a contributing role in the pathogenesis. In one case, the pentamer PVITE (SEQ ID NO.: 1) overlaps with ESTEN (SEQ ID NO.: 580) and benefits from the same strong T cell helper response. PVITE (SEQ ID NO.: 1) finds an epitope mimic in LCAM1 neural adhesion molecules.
(277) One other area of the envelope sequence merited particular consideration as it was noted that the sequence with peptides initiating in positions 260-273 has a very high content of motifs with homologues in the human proteome. This region is a relatively weak B cell epitope. One neural match EGAVH (SEQ ID NO.: 2) was found for an epitope centered at position 263. However additional peptides in this region showed mimic-matches with Glial fibrillary acid protein (GFAP) and with Glycoprotein M6A (GPM6a), proteins with important roles in neural development. GFAP has been identified as a protein to which antibodies are found in the axonal form of GBS. and GPM6a plays a role in migration and differentiation of neurons. The corresponding pentamers are shown in Table 6
(278) TABLE-US-00006 TABLE 6 SEQ 78 LAGAL GFAP_HUMAN Isoform 2 of Glial fibrillary acidic protein SEQ 79 ALAGA NEURONAL MEMBRANE GLYCOPROTEIN M6-a
(279) Mimics of other neural proteins are found in the ZIKV capsid and PrM protein as shown in Table 6. However, these proteins are in fewer copy numbers in each virion and are partly concealed to the B cells by the outer layer of envelope proteins, so are less likely candidates to play a role in autoimmune pathogenesis.
(280) TABLE-US-00007 TABLE 7 Capsid protein-pentamer BEPI motifs in Zika capsids unique to Zika vs other flaviviruses. SEQ 80 KKEAM A3KFI4_HUMAN Neuroblastoma suppressor of tumorigen SEQ 81 KKEAM A3KFI5_HUMAN Neuroblastoma suppressor of tumorigen SEQ 82 EAMEI ESYT2_HUMAN Isoform 4 of Extended synaptotagmin-2 SEQ 83 EAMEI ESYT2_HUMAN Isoform 5 of Extended synaptotagmin-2 SEQ 84 EAMEI ESYT2_HUMAN Isoform 6 of Extended synaptotagmin-2 SEQ 85 EAMEI ESYT3_HUMAN Extended synaptotagmin-3 OS = Homo sapie SEQ 86 EAMEI ESYT3_HUMAN Isoform 2 of Extended synaptotagmin-3 SEQ 87 RKEKK A6NCR3_HUMAN Synaptopodin 2-like protein SEQ 88 RKEKK A6NCR4_HUMAN Synaptotagmin-8 OS = Homo sapiens SEQ 89 RKEKK NBPFL_HUMAN Neuroblastoma breakpoint family member SEQ 90 KEKKR A2BH96_HUMAN Neuroblastoma breakpoint family member SEQ 91 KEKKR A3KFI1_HUMAN Neuroblastoma suppressor of tumorigen SEQ 92 KEKKR NBAS_HUMAN Isoform 2 of Neuroblastoma-amplified seq SEQ 92 KEKKR NBAS_HUMAN Neuroblastoma-amplified sequence SEQ 93 EKKRR A2A2M9_HUMAN Synaptonemal complex protein 2 SEQ 94 EKKRR A2A340_HUMAN Synaptonemal complex protein 2 SEQ 95 EKKRR A2A341_HUMAN Synaptonemal complex protein 2 SEQ 96 EKKRR A2A3C1_HUMAN Brain-specific angiogenesis inhibitor SEQ 97 EKKRR FI68B_HUMAN Isoform 2 of Myelin-associated neurite SEQ 98 EKKRR FI68B_HUMAN Myelin-associated neurite-outgrowth SEQ 99 RRGAD A6NDV3_HUMAN Neuroblastoma breakpoint family member SEQ 100 GADTS A2A3C2_HUMAN Brain-specific angiogenesis inhibitor SEQ 101 GADTS A2A3C3_HUMAN Brain-specific angiogenesis inhibitor SEQ 102 GADTS A2A3C4_HUMAN Brain-specific angiogenesis inhibitor SEQ 103 GADTS A2A3C6_HUMAN Brain-specific angiogenesis inhibitor SEQ 104 ADTSV ESYT2_HUMAN Extended synaptotagmin-2 SEQ 105 ADTSV ESYT2_HUMAN Isoform 2 of Extended synaptotagmin-2 SEQ 106 KKEAM A3KFI2_HUMAN Neuroblastoma suppressor of tumorigen SEQ 107 KKEAM A3KFI3_HUMAN Neuroblastoma suppressor of tumorigen
(281) TABLE-US-00008 TABLE 8 PrM membrane protein - Pentamer BEPI motifs unique to Zika from other Flaviviruses tested which have neural matches SEQ 108 ARRSR H0YGA6_HUMAN Neuralized-like protein 2 (Fragment) SEQ 109 ARRSR NEUL2_HUMAN Neuralized-like protein 2 OS = Homo sapi SEQ 110 KLQTR SYT6_HUMAN Synaptotagmin-6 OS = Homo sapiens GN = SYT6 SEQ 111 KLQTR SYT6_HUMAN Synaptotagmin-6 OS = Homo sapiens GN = SYT6 SEQ 112 REYTK H0Y465_HUMAN Neurofibromin truncated (Fragment) OS SEQ 113 REYTK NF1_HUMAN Isoform 1 of Neurofibromin OS = Homo sapie SEQ 114 REYTK NF1_HUMAN Neurofibromin OS = Homo sapiens GN = NF1 PE= SEQ 115 REYTK H0Y465_HUMAN Neurofibromin truncated (Fragment) OS SEQ 116 REYTK NF1_HUMAN Isoform 1 of Neurofibromin OS = Homo sapie SEQ 117 REYTK NF1_HUMAN Neurofibromin OS = Homo sapiens GN = NF1 PE= SEQ 118 RKLQT LRRT2_HUMAN Leucine-rich repeat transmembrane neur SEQ 119 RKLQT LRRT2_HUMAN Leucine-rich repeat transmembrane neur SEQ 121 SHSTR F5GZS7_HUMAN Neuregulin-2 OS = Homo sapiens GN = NRG2 SEQ 122 SHSTR F5H0N2_HUMAN Neuregulin-2 OS = Homo sapiens GN = NRG2 SEQ 123 SHSTR NRG2_HUMAN Isoform 2 of Pro-neuregulin-2 SEQ 124 SHSTR NRG2_HUMAN Isoform 3 of Pro-neuregulin-2 SEQ 125 SHSTR NRG2_HUMAN Isoform 4 of Pro-neuregulin-2 SEQ 126 SHSTR NRG2_HUMAN Isoform DON-1B of Pro-neuregulin-2 SEQ 127 SHSTR NRG2_HUMAN Isoform DON-1R of Pro-neuregulin-2 SEQ 128 SHSTR NRG2_HUMAN Pro-neuregulin-2 SEQ 129 SHSTR F5GZS7_HUMAN Neuregulin-2 OS = Homo sapiens GN = NRG2 SEQ 130 SHSTR F5H0N2_HUMAN Neuregulin-2 OS = Homo sapiens GN = NRG2 SEQ 131 SHSTR NRG2_HUMAN Isoform 2 of Pro-neuregulin-2 SEQ 132 SHSTR NRG2_HUMAN Isoform 3 of Pro-neuregulin-2 SEQ 133 SHSTR NRG2_HUMAN Isoform 4 of Pro-neuregulin-2 SEQ 134 SHSTR NRG2_HUMAN Isoform DON-1B of Pro-neuregulin-2 SEQ 135 SHSTR NRG2_HUMAN Isoform DON-1R of Pro-neuregulin-2 SEQ 136 SHSTR NRG2_HUMAN Pro-neuregulin-2 SEQ 137 TLPSH NYAP2_HUMAN Neuronal tyrosine-phosphorylated phosp SEQ 138 TLPSH NYAP2_HUMAN Neuronal tyrosine-phosphorylated phosp SEQ 139 ARRSR H0YGA6_HUMAN Neuralized-like protein 2 (Fragment) SEQ 140 ARRSR NEUL2_HUMAN Neuralized-like protein 2 OS = Homo sapi
Example 3. Design and Expression of Synthetic Immunogens Comprising ZIKV Polypeptides
(282) ZIKV polypeptides of interest were identified in each domain of the envelope protein, based on the criteria that each polypeptide comprises one or more B cell epitopes and has associated predicted MEW I and MEW II binding peptides. In addition, consideration was given to the mimics identifies as described above. Vector constructs were prepared to incorporate polypeptides of Domain I, Domain II, and Domain III of the envelope protein (SEQS 141-164). Additional polypeptides were selected to exclude the mimic peptides identified (SEQ 165-168). In particular, a construct was prepared to mutate the ESTEN (SEQ ID NO.: 580) motif (SEQS 169-170). The vector constructs were designed to permit the expression of standalone synthetic polypeptides for each domain and additional constructs provided for the expression as a fusion protein with immunoglobulins. While the constructs shown herewith provide for fusion of immunoglobulins to the C terminal of Zika polypeptides, constructs enabling N terminal fusion were also prepared but are not shown. Constructs enabling expression of with either murine or human immunoglobulins were prepared as shown.
(283) A further vector construct was prepared to generate expression of the 34-mer B cell epitope region sequence, GRLITANPVITESTENSKMMLELDPPFGDSYIGE, which encompasses ESTEN (SEQ ID NO.: 171-172). As previously described (U.S. Pat. Nos. 8,703,134; 8,394,379; 7,566,447; and 20130230516; each of which is incorporated herein by reference in its entirety) these constructs are incorporated into retroviral vectors and transfected into CHO cells to create stable expressing protein production cell lines.
(284) A series of constructs were prepared to mutate out a mimic motif which is in Zika envelope Domain 1 and which reacts with Neural navigator proteins 2 (NAV2). The motif which forms a mimic is encoded by the pentamer KGRLS (SEQ ID NO.: 7). Therefore various forms of envelope domain 1 are designed which include mutants of KGRLS (SEQ ID NO.: 7) and which were found not to have other kinds of mimic matches in the proteome. In addition a “triple scramble” version of the soluble portion of the whole envelope protein was prepared which mutates the KGRLS (SEQ ID NO.: 7), the ESTEN (SEQ ID NO.: 580) motif and which in addition mutates out the peptide in Domain II thought to be associates with antibody dependent enhancement in other flavi viruses. This is at position 102 and comprises the motif DRGWGN (SEQ ID NO.: 1259). The sequences which embody these mutants are shown as SEQS 245-254. Many other options exist in configuring mutations or removing mimics by amino acid deletion, thus these SEQs are provided as examples and shall not be considered limiting. Throughout the application, the annotated sequences, peptides, polypeptides, nucleic acids etc., may be identified as SEQ.XXX which corresponds to SEQ ID NO:XXX in the accompanying Sequence ID Listing. For example, Seq.245 is SEQ ID NO:245 in the Sequence ID Listing.
(285) Seq.245. His-EKL-D1-LRKGS, Nucleotide Sequence, ID:501095n 1-69 Signal peptide 70-87 6× Histag 88-111 Enterokinase linker 112-567 Domain 1 extended mutant
(286) Seq.246. His-EKL-D1-LRKGS, Amino Acid Sequence, ID:501095p 1-23 Signal peptide 24-29 6× Histag 30-37 Enterokinase linker 38-189 Domain 1 extended mutant
(287) Seq.247. His-EKL-D1-RKGLS, Nucleotide Sequence 1-69 Signal peptide 70-87 6× Histag 88-111 Enterokinase linker 112-567 Domain 1 extended mutant
(288) Seq.248. His-EKL-D1-RKGLS, Amino Acid Sequence 1-23 Signal peptide 24-29 6× Histag 30-37 Enterokinase linker 38-189 Domain 1 extended mutant
(289) Seq.249. His-EKL-D1-KGRIT, Nucleotide Sequence 1-69 Signal peptide 70-87 6× Histag 88-111 Enterokinase linker 112-567 Domain 1 extended mutant
(290) Seq.250. His-EKL-D1-KGRIT, Amino Acid Sequence 1-23 Signal peptide 24-29 6× Histag 30-37 Enterokinase linker 38-189 Domain 1 extended mutant
(291) Seq.251. His-EKL-D1-GLSKR, Nucleotide Sequence 1-69 Signal peptide 70-87 6× Histag 88-111 Enterokinase linker 112-567 Domain 1 extended mutant
(292) Seq.252. His-EKL-D1-GLSKR, Amino Acid Sequence 1-23 Signal peptide 24-29 6× Histag 30-37 Enterokinase linker 38-189 Domain 1 extended mutant
(293) Seq.253. His-EKL-Soluble-3Mods, Nucleotide Sequence, ID:501089n 1-69 Signal peptide 70-87 6× Histag 88-111 Enterokinase linker 112-1332 Soluble peptide mutant
(294) Seq.254. His-EKL-Soluble-3Mods, Amino Acid Sequence, ID:501089p 1-23 Signal peptide 24-29 6× Histag 30-37 Enterokinase linker 38-444 Soluble peptide mutant
(295) Seq.141. His-EKL-Soluble, Nucleotide Sequence, ID:501066n 1-63 Signal peptide 70-87 6× His Tag 88-111 Enterokinase linker 112-1332 soluble peptide
(296) Seq.142. His-EKL-Soluble, Amino Acid Sequence, ID:501066p 1-21 Signal peptide 24-29 6× His Tag 30-37 Enterokinase linker 38-444 soluble peptide
(297) Seq.143. His-EKL-Domain3, Nucleotide Sequence, ID:501067n 1-63 Signal peptide 70-87 6× His Tag 88-111 Enterokinase linker 112-429 domain3 peptide
(298) Seq.144. His-EKL-Domain3, Amino Acid Sequence, ID:501067p 1-21 Signal peptide 24-29 6× His Tag 30-37 Enterokinase linker 38-143 domain3 peptide
(299) Seq.145. His-EKL-Domain2, Nucleotide Sequence, ID:501068n 1-63 Signal peptide 70-87 6× His Tag 88-111 Enterokinase linker 112-375 domain2 peptide
(300) Seq.146. His-EKL-Domain2, Amino Acid Sequence, ID:501068p 1-21 Signal peptide 24-29 6× His Tag 30-37 Enterokinase linker 38-125 domain2 peptide
(301) Seq.147. His-EKL-Domain1, Nucleotide Sequence, ID:501069n 1-63 Signal peptide 70-87 6× His Tag 88-111 Enterokinase linker 112-339 domain1 peptide
(302) Seq.148. His-EKL-Domain1, Amino Acid Sequence, ID:501069p 1-21 Signal peptide 24-29 6× His Tag 30-37 Enterokinase linker 38-113 domain1 peptide
(303) Seq.149. Soluble-EKL-hG1(CH2-CH3), Nucleotide Sequence, ID:501070n 1-63 Signal peptide 70-1287 soluble peptide 1288-1311 Enterokinase linker 1318-2016 hG1(CH2-CH3) constant region
(304) Seq.150. Soluble-EKL-hG1(CH2-CH3), Amino Acid Sequence, ID:501070p 1-21 Signal peptide 24-429 soluble peptide 430-437 Enterokinase linker 440-672 hG1(CH2-CH3) constant region
(305) Seq.151. Domain3-EKL-hG1(CH2-CH3), Nucleotide Sequence, ID:501071n 1-63 Signal peptide 70-384 domain3 peptide 385-408 Enterokinase linker 415-1113 hG1(CH2-CH3) constant region
(306) Seq.152. Domain3-EKL-hG1(CH2-CH3), Amino Acid Sequence, ID:501071p 1-21 Signal peptide 24-128 domain3 peptide 129-136 Enterokinase linker 139-371 hG1(CH2-CH3) constant region
(307) Seq.153. Domain2-EKL-hG1(CH2-CH3), Nucleotide Sequence, ID:501072n 1-63 Signal peptide 70-330 domain2 peptide 331-354 Enterokinase linker 361-1059 hG1(CH2-CH3) constant region
(308) Seq.154. Domain2-EKL-hG1(CH2-CH3), Amino Acid Sequence, ID:501072p 1-21 Signal peptide 24-110 domain2 peptide 111-118 Enterokinase linker 121-353 hG1(CH2-CH3) constant region
(309) Seq.155. Domain1-EKL-hG1(CH2-CH3), Nucleotide Sequence, ID:501073n 1-63 Signal peptide 70-294 domain1 peptide 295-318 Enterokinase linker 325-1023 hG1(CH2-CH3) constant region
(310) Seq.156. Domain1-EKL-hG1(CH2-CH3), Amino Acid Sequence, ID:501073p 1-21 Signal peptide 24-98 domain1 peptide 99-106 Enterokinase linker 109-341 hG1(CH2-CH3) constant region
(311) Seq.157. His-Soluble-EKL-mG2a(CH2-CH3), Nucleotide Sequence, ID:501074n 1-63 Signal peptide 70-87 6× Histag 88-1305 soluble peptide 1306-1329 Enterokinase linker 1336-2037 mG2a(CH2-CH3) constant region
(312) Seq.158. His-Soluble-EKL-mG2a(CH2-CH3), Amino Acid Sequence, ID:501074p 1-21 Signal peptide 24-29 6× Histag 30-435 soluble peptide 436-443 Enterokinase linker 446-679 mG2a(CH2-CH3) constant region
(313) Seq.159. His-Domain3-EKL-mG2a(CH2-CH3), Nucleotide Sequence, ID:501075n 1-63 Signal peptide 70-87 6× Histag 88-402 domain3 peptide 403-426 Enterokinase linker 433-1134 mG2a(CH2-CH3) constant region
(314) Seq.160. His-Domain3-EKL-mG2a(CH2-CH3), Amino Acid Sequence, ID:501075p 1-21 Signal peptide 24-29 6× Histag 30-134 domain3 peptide 135-142 Enterokinase linker 145-378 mG2a(CH2-CH3) constant region
(315) Seq.161. His-Domain2-EKL-mG2a(CH2-CH3), Nucleotide Sequence, ID:501076n 1-63 Signal peptide 70-87 6× Histag 88-348 domain2 peptide 349-372 Enterokinase linker 379-1080 mG2a(CH2-CH3) constant region
(316) Seq.162. His-Domain2-EKL-mG2a(CH2-CH3), Amino Acid Sequence, ID:501076p 1-21 Signal peptide 24-29 6× Histag 30-116 domain2 peptide 117-124 Enterokinase linker 127-360 mG2a(CH2-CH3) constant region
(317) Seq.163. His-Domain1-EKL-mG2a(CH2-CH3), Nucleotide Sequence, ID:501077n 1-63 Signal peptide 70-87 6× Histag 88-312 domain1 peptide 313-336 Enterokinase linker 343-1044 mG2a(CH2-CH3) constant region
(318) Seq.164. His-Domain1-EKL-mG2a(CH2-CH3), Amino Acid Sequence, ID:501077p 1-21 Signal peptide 24-29 6× Histag 30-104 domain1 peptide 105-112 Enterokinase linker 115-348 mG2a(CH2-CH3) constant region
(319) Seq.165. His-EKL-Mutated_Domain3, Nucleotide Sequence, ID:501078n 1-63 Signal peptide 70-87 6× His Tag 88-111 Enterokinase linker 112-429 mutated domain3 peptide
(320) Seq.166. His-EKL-Mutated_Domain3, Amino Acid Sequence, ID:501078p 1-21 Signal peptide 24-29 6× His Tag 30-37 Enterokinase linker 38-143 mutated domain3 peptide
(321) Seq.167. Mutated_Domain3-EKL-hG1(CH2-CH3), Nucleotide Sequence, ID:501079n 1-63 Signal peptide 70-384 mutated domain3 peptide 385-408 Enterokinase linker 415-1113 hG1(CH2-CH3) constant region
(322) Seq.168. Mutated_Domain3-EKL-hG1(CH2-CH3), Amino Acid Sequence, ID:501079p 1-21 Signal peptide 24-128 domain3 peptide 129-136 Enterokinase linker 139-371 hG1(CH2-CH3) constant region
(323) Seq.169. His-Mutated_Domain3-EKL-mG2a(CH2-CH3), Nucleotide Sequence, ID:501080n 1-63 Signal peptide 70-87 6× Histag 88-402 mutated domain3 peptide 403-426 Enterokinase linker 433-1134 mG2a(CH2-CH3) constant region
(324) Seq.170. His-Mutated_Domain3-EKL-mG2a(CH2-CH3), Amino Acid Sequence, ID:501080p 1-21 Signal peptide 24-29 6× Histag 30-134 domain3 peptide 135-142 Enterokinase linker 145-378 mG2a(CH2-CH3) constant region
(325) Seq.171. His-EKL-Loop-Peptide, Nucleotide Sequence, ID:501081n 1-63 Signal peptide 70-87 6× His Tag 88-111 Enterokinase linker 112-216 loop peptide
(326) Seq.172. His-EKL-Loop-Peptide, Amino Acid Sequence, ID:501081p 1-21 Signal peptide 24-29 6× His Tag 30-37 Enterokinase linker 38-72 loop peptide
(327) Seq.173. SPe-His-NPY, nucleotide sequence, ID:501078n 1-84 Signal peptide 85-102 6× Histag 103-312 Neuropeptide Y
(328) Seq.174. SPe-His-NPY, amino acid sequence, ID:501078p 1-28 Signal peptide 29-34 6× Histag 35-104 Neuropeptide Y
(329) Seq.175. SPe-his-NPY(PDAEG), Nucleotide Sequence, ID:501079n 1-84 Signal peptide 85-102 6× Histag 103-312 Neuropeptide Y
(330) Seq.176. SPe-his-NPY(PDAEG), Amino Acid Sequence, ID:501079p 1-28 Signal peptide 29-34 6× Histag 35-104 Neuropeptide Y
(331) Seq.177. SPe-his-NPY(NTSEE), Nucleotide Sequence, ID:501080n 1-84 Signal peptide 85-102 6× Histag 103-312 Neuropeptide Y
(332) Seq.178. SPe-his-NPY(NTSEE), Amino Acid Sequence, ID:501080p 1-28 Signal peptide 29-34 6× Histag 35-104 Neuropeptide Y
(333) Seq.179. SPe-his-NPY(PDAEG_STNDD), Nucleotide Sequence, ID:501081n 1-84 Signal peptide 85-102 6× Histag 103-312 Neuropeptide Y
(334) Seq.180. SPe-his-NPY(PDAEG_STNDD), Amino Acid Sequence, ID:501081p 1-28 Signal peptide 29-34 6× Histag 35-104 Neuropeptide Y
(335) Seq.181. SPe-his-NPY(PDAEG_Tetanus), Nucleotide Sequence, ID:501082n 1-84 Signal peptide 85-102 6× Histag 103-312 Neuropeptide Y
(336) Seq.182. SPe-his-NPY(PDAEG_Tetanus), Amino Acid Sequence, ID:501082p 1-28 Signal peptide 29-34 6× Histag 35-104 Neuropeptide Y
(337) Seq.183. His-EKL-D3(DSTDN), Nucleotide Sequence, ID:501083n 1-63 Signal peptide 64-87 6× Histag 88-111 Enterokinase linker 111-429 Domain 3 mutant
(338) Seq.184. His-EKL-D3(DSTDN), Amino Acid Sequence, ID:501083p 1-21 Signal peptide 22-29 6× Histag 30-37 Enterokinase linker 38-143 Domain 3 mutant
(339) Seq.185. His-EKL-D3(ETSEQ), Nucleotide Sequence, ID:501084n 1-63 Signal peptide 64-87 6× Histag 88-111 Enterokinase linker 111-429 Domain 3 mutant
(340) Seq.186. His-EKL-D3(ETSEQ), Amino Acid Sequence, ID:501084p 1-21 Signal peptide 22-29 6× Histag 30-37 Enterokinase linker 38-143 Domain 3 mutant
(341) Seq.187. His-EKL-D3(KSTEN), Nucleotide Sequence, ID:501085n 1-63 Signal peptide 64-87 6× Histag 88-111 Enterokinase linker 111-429 Domain 3 mutant
(342) Seq.188. His-EKL-D3(KSTEN), Amino Acid Sequence, ID:501085p 1-21 Signal peptide 22-29 6× Histag 30-37 Enterokinase linker 38-143 Domain 3 mutant
(343) Seq.189. His-EKL-D3(NSTEE), Nucleotide Sequence, ID:501086n 1-63 Signal peptide 64-87 6× Histag 88-111 Enterokinase linker 111-429 Domain 3 mutant
(344) Seq.190. His-EKL-D3(NSTEE), Amino Acid Sequence, ID:501086p 1-21 Signal peptide 22-29 6× Histag 30-37 Enterokinase linker 38-143 Domain 3 mutant
(345) Seq.191. His-EKL-D3(DSTEN), Nucleotide Sequence 1-63 Signal peptide 64-87 6× Histag 88-111 Enterokinase linker 111-429 Domain 3 mutant
(346) Seq.192. His-EKL-D3(DSTEN), Amino Acid Sequence 1-21 Signal peptide 22-29 6× Histag 30-37 Enterokinase linker 38-143 Domain 3 mutant
(347) Seq.193. His-EKL-D3(ESTEQ), Nucleotide Sequence 1-63 Signal peptide 64-87 6× Histag 88-111 Enterokinase linker 111-429 Domain 3 mutant
(348) Seq.194. His-EKL-D3(ESTEQ), Amino Acid Sequence 1-21 Signal peptide 22-29 6× Histag 30-37 Enterokinase linker 38-143 Domain 3 mutant
(349) Seq.195. His-EKL-D3(ETSEN), Nucleotide Sequence 1-63 Signal peptide 64-87 6× Histag 88-111 Enterokinase linker 111-429 Domain 3 mutant
(350) Seq.196. His-EKL-D3(ETSEN), Amino Acid Sequence 1-21 Signal peptide 22-29 6× Histag 30-37 Enterokinase linker 38-143 Domain 3 mutant
(351) Seq.197. His-EKL-D3(RSTEN), Nucleotide Sequence 1-63 Signal peptide 64-87 6× Histag 88-111 Enterokinase linker 111-429 Domain 3 mutant
(352) Seq.198. His-EKL-D3(RSTEN), Amino Acid Sequence 1-21 Signal peptide 22-29 6× Histag 30-37 Enterokinase linker 38-143 Domain 3 mutant
(353) Seq.199. D3(DSTDN)-EKL-hG1(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-384 Domain 3 mutant 385-408 Enterokinase linker 409-1113 hG1(CH2-CH3) constant region
(354) Seq.200. D3(DSTDN)-EKL-hG1(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 22-128 Domain 3 mutant 129-136 Enterokinase linker 137-371 hG1(CH2-CH3) constant region
(355) Seq.201. D3(DSTEN)-EKL-hG1(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-384 Domain 3 mutant 385-408 Enterokinase linker 409-1113 hG1(CH2-CH3) constant region
(356) Seq.202. D3(DSTEN)-EKL-hG1(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 22-128 Domain 3 mutant 129-136 Enterokinase linker 137-371 hG1(CH2-CH3) constant region
(357) Seq.203. D3(ESTEQ)-EKL-hG1(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-384 Domain 3 mutant 385-408 Enterokinase linker 409-1113 hG1(CH2-CH3) constant region
(358) Seq.204. D3(ESTEQ)-EKL-hG1(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 22-128 Domain 3 mutant 129-136 Enterokinase linker 137-371 hG1(CH2-CH3) constant region
(359) Seq.205. D3(ETSEN)-EKL-hG1(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-384 Domain 3 mutant 385-408 Enterokinase linker 409-1113 hG1(CH2-CH3) constant region
(360) Seq.206. D3(ETSEN)-EKL-hG1(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 22-128 Domain 3 mutant 129-136 Enterokinase linker 137-371 hG1(CH2-CH3) constant region
(361) Seq.207. D3(ETSEQ)-EKL-hG1(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-384 Domain 3 mutant 385-408 Enterokinase linker 409-1113 hG1(CH2-CH3) constant region
(362) Seq.208. D3(ETSEQ)-EKL-hG1(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 22-128 Domain 3 mutant 129-136 Enterokinase linker 137-371 hG1(CH2-CH3) constant region
(363) Seq.209. D3(KSTEN)-EKL-hG1(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-384 Domain 3 mutant 385-408 Enterokinase linker 409-1113 hG1(CH2-CH3) constant region
(364) Seq.210. D3(KSTEN)-EKL-hG1(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 22-128 Domain 3 mutant 129-136 Enterokinase linker 137-371 hG1(CH2-CH3) constant region
(365) Seq.211. D3(NSTEE)-EKL-hG1(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-384 Domain 3 mutant 385-408 Enterokinase linker 409-1113 hG1(CH2-CH3) constant region
(366) Seq.212. D3(NSTEE)-EKL-hG1(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 22-128 Domain 3 mutant 129-136 Enterokinase linker 137-371 hG1(CH2-CH3) constant region
(367) Seq.213. D3(RSTEN)-EKL-hG1(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-384 Domain 3 mutant 385-408 Enterokinase linker 409-1113 hG1(CH2-CH3) constant region
(368) Seq.214. D3(RSTEN)-EKL-hG1(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 22-128 Domain 3 mutant 129-136 Enterokinase linker 137-371 hG1(CH2-CH3) constant region
(369) Seq.215. His-D3(DSTDN)-EKL-mG2a(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-87 6× Histag 88-402 Domain 3 mutant 403-426 Enterokinase linker 427-1134 mG2a(CH2-CH3) constant region
(370) Seq.216. His-D3(DSTDN)-EKL-mG2a(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 22-29 6× Histag 30-134 Domain 3 mutant 135-142 Enterokinase linker 143-378 mG2a(CH2-CH3) constant region
(371) Seq.217. His-D3(DSTEN)-EKL-mG2a(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-87 6× Histag 88-402 Domain 3 mutant 403-426 Enterokinase linker 427-1134 mG2a(CH2-CH3) constant region
(372) Seq.218. His-D3(DSTEN)-EKL-mG2a(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 22-29 6× Histag 30-134 Domain 3 mutant 135-142 Enterokinase linker 143-378 mG2a(CH2-CH3) constant region
(373) Seq.219. His-D3(ESTEQ)-EKL-mG2a(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-87 6× Histag 88-402 Domain 3 mutant 403-426 Enterokinase linker 427-1134 mG2a(CH2-CH3) constant region
(374) Seq.220. His-D3(ESTEQ)-EKL-mG2a(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 22-29 6× Histag 30-134 Domain 3 mutant 135-142 Enterokinase linker 143-378 mG2a(CH2-CH3) constant region
(375) Seq.221. His-D3(ETSEN)-EKL-mG2a(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-87 6× Histag 88-402 Domain 3 mutant 403-426 Enterokinase linker 427-1134 mG2a(CH2-CH3) constant region
(376) Seq.222. His-D3(ETSEN)-EKL-mG2a(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 22-29 6× Histag 30-134 Domain 3 mutant 135-142 Enterokinase linker 143-378 mG2a(CH2-CH3) constant region
(377) Seq.223. His-D3(ETSEQ)-EKL-mG2a(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-87 6× Histag 88-402 Domain 3 mutant 403-426 Enterokinase linker 427-1134 mG2a(CH2-CH3) constant region
(378) Seq.224. His-D3(ETSEQ)-EKL-mG2a(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 22-29 6× Histag 30-134 Domain 3 mutant 135-142 Enterokinase linker 143-378 mG2a(CH2-CH3) constant region
(379) Seq.225. His-D3(KSTEN)-EKL-mG2a(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-87 6× Histag 88-402 Domain 3 mutant 403-426 Enterokinase linker 427-1134 mG2a(CH2-CH3) constant region
(380) Seq.226. His-D3(KSTEN)-EKL-mG2a(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 22-29 6× Histag 30-134 Domain 3 mutant 135-142 Enterokinase linker 143-378 mG2a(CH2-CH3) constant region
(381) Seq.227. His-D3(NSTEE)-EKL-mG2a(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-87 6× Histag 88-402 Domain 3 mutant 403-426 Enterokinase linker 427-1134 mG2a(CH2-CH3) constant region
(382) Seq.228. His-D3(NSTEE)-EKL-mG2a(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 22-29 6× Histag 30-134 Domain 3 mutant 135-142 Enterokinase linker 143-378 mG2a(CH2-CH3) constant region
(383) Seq.229. His-D3(RSTEN)-EKL-mG2a(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-87 6× Histag 88-402 Domain 3 mutant 403-426 Enterokinase linker 427-1134 mG2a(CH2-CH3) constant region
(384) Seq.230. His-D3(RSTEN)-EKL-mG2a(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 22-29 6× Histag 30-134 Domain 3 mutant 135-142 Enterokinase linker 143-378 mG2a(CH2-CH3) constant region
(385) In some embodiments control peptides (SEQ ID NOs: 231-234) are included which are derived from lysostaphin, as an unrelated irrelevant protein, and which may be detected by control antisera prepared to lysostaphin.
(386) Seq.231. SPe-his-NPY(PDAEG_GSTGYSTAP), Nucleotide Sequence, ID:501083n 1-84 Signal peptide 85-102 6× Histag 103-324 Neuropeptide Y mutant
(387) Seq.232. SPe-his-NPY(PDAEG_GSTGYSTAP), Amino Acid Sequence, ID:501083p 1-28 Signal peptide 29-34 6× Histag 35-108 Neuropeptide Y mutant
(388) Seq.233. SPe-his-NPY(PDAEG_VMKQDGHVM), Nucleotide Sequence, ID:501084n 1-84 Signal peptide 85-102 6× Histag 103-324 Neuropeptide Y mutant
(389) Seq.234. SPe-his-NPY(PDAEG_VMKQDGHVM), Amino Acid Sequence, ID:501084p 1-28 Signal peptide 29-34 6× Histag 35-108 Neuropeptide Y mutant
Example 4 Additional Neurologic Proteins Containing Mimics for Zika
(390) Searching of the human proteome database using an automated key word search argument revealed additional peptide motifs which are mimics in Zika (source) shared with neurologic protein (targets). The key word search was configured to identify proteins curated to contain “neur” “glial” and “synapt”. This revealed pentamer mimics in isoforms of optineurin and in brain derived neurotrophic factor. In both cases the pentamers are within B cell epitopes in both Zika envelope and B cell epitopes in the neurologic protein. In the source protein B cell epitope is defined as having a predicted binding affinity of <−0.6 standard deviation units relative to the protein as a whole and in the target as either high stringency (having a predicted binding affinity of <−0.6 standard deviation units relative to the protein as a whole) or low stringency (having a predicted binding affinity of <−0.3 standard deviation units relative to the protein as a whole).
(391) TABLE-US-00009 TABLE 9 SEQ Motif Target neurologic protein SEQ 255 PRAEA Optineurin (multiple isoforms) UniProtKB - Q96CV9 (OPTN_HUMAN) SEQ 256 MSGGT Brain derived neurotropic factor (multiple isoforms) UniProtKB - P23560 (BDNF_HUMAN); also Cochlin, UniProtKB G3V4C4_HUMAN
Example 5: Epitope Mimics in Dengue Virus Serotype 1
(392) Analysis of the neurologic proteins in which we found epitope mimics in the Zika envelope identified Zika envelope as having a pentamer B cell binding mimic (KGRLS (SEQ ID NO.: 7)) in many isoforms of neural navigator protein 2 (NAV2). Further analysis of NAV2 and other flaviviruses analyzed simultaneously demonstrated a mimic also occurs and is highly conserved in the Domain III loop of dengue type 1 strains. This mimic was present in all 146 South American dengue type 1 isolates analyzed. There is therefore concern that the double mimic which could occur when both Zika and dengue type 1 are co endemic could be adverse or that one or other of the mimics acting alone could have an adverse effect in producing antibodies reactive with this protein which is critical in neural elongation and in early neural tissue development [20, 21]. Thus the present invention includes vaccine proteins in which this mimic has been mutated.
(393) TABLE-US-00010 TABLE 10 Virus Virus BEPI pentamer Envelope strength in MHC II in NAV2 Virus motif position Source virus Source virus position NAV2 Bepi? Zika (all ~KGRLS~ 284, Domain I Moderate Moderate all Position 1013 yes isolates) (SEQ ID DRB and DP BEPI centered NO: 7) and DQ alleles at position 1015 Dengue (only ~TDKEK~ , Domain III Moderate Moderate, not Position 1185, Yes DEN3 (SEQ ID loop5* all MHC BEPI centered at NO: 56) alleles 1187. *as shown in FIG. 12, 13, 14, 15
(394) In order to test the reactivity of sera from ZIKV exposed and dengue exposed subjects to epitope mimics identifies in neural navigator 2 isoforms (NAV2) a series of recombinant polypeptides are prepared including the wild type motifs in NAV2 and scrambled peptide forms of the mimics shown in Table 10, as well as sequences derived from NAV2 which contain appropriate positive and negative controls based on yellow fever and tetanus. Sequences for these constructs are as follows (SEQ ID NOs: 235-244)
(395) Seq.235. His-NN2-KGRLS-TDKEK, Nucleotide Sequence, ID:501090n 1-63 Signal peptide 70-87 6× Histag 88-810 Neuron Navigator 2
(396) Seq.236. His-NN2-KGRLS-TDKEK, Amino Acid Sequence, ID:501090p 1-21 Signal peptide 23-29 6× Histag 30-270 Neuron Navigator 2
(397) Seq.237. His-NN2-LRKGS-TDKEK, Nucleotide Sequence, ID:501091n 1-63 Signal peptide 70-87 6× Histag 88-810 Neuron Navigator 2 mutant
(398) Seq.238. His-NN2-LRKGS-TDKEK, Amino Acid Sequence, ID:501091p 1-21 Signal peptide 23-29 6× Histag 30-270 Neuron Navigator 2 mutant
(399) Seq.239. His-NN2-KGRLS-DTREK, Nucleotide Sequence, ID:501092n 1-63 Signal peptide 70-87 6× Histag 88-810 Neuron Navigator 2 mutant
(400) Seq.240. His-NN2-KGRLS-DTREK, Amino Acid Sequence, ID:501092p 1-21 Signal peptide 23-29 6× Histag 30-270 Neuron Navigator 2 mutant
(401) Seq.241. His-NN2-STNDD-DTREK, Nucleotide Sequence, ID:501093n 1-63 Signal peptide 70-87 6× Histag 88-810 Neuron Navigator 2 mutant
(402) Seq.242. His-NN2-STNDD-DTREK, Amino Acid Sequence, ID:501093p 1-21 Signal peptide 23-29 6× Histag 30-270 Neuron Navigator 2 mutant
(403) Seq.243. His-NN2-SKDVQLKNITDYMYL-DTREK, nucleotide sequence, ID:501094n 1-63 Signal peptide 70-87 6× Histag 88-840 Neuron Navigator 2 mutant
(404) Seq.244. Light Chain Variable Region, Amino Acid Sequence, ID:501094p 1-21 Signal peptide 23-29 6× Histag 30-280 Neuron Navigator 2 mutant
Example 6 Selection of Peptides for Use in a Differential Diagnostic Kit
(405) Given the need to be able to differentially diagnose exposer the Zika virus and dengue viruses types 1-4 and the likely co-endemnicity of yellow fever plus the use of vaccines to both dengue and yellow fever in Zika endemic regions, we identified peptides for each virus envelope which are also in the top 10% of linear B cell binders. We utilized strains for dengue that have recently circulated in Brazil, but the peptides were also cross checked on reference strains of each dengue. The vaccine strain of Yellow fever 17D was included. These were then compared using a missing data array to select peptides (Table 11). A set of high binding B cell epitope pentamers specific for each virus was then assembled as show in Table 12.
(406) TABLE-US-00011 TABLE 11 SEQ 130529 (969945757 ID N YEFV Zika BEPIPent NO: Rows 17D virus) GQ330473_D3_BR_RP_Al95_2009_3 GQ379163_YFcase_#2) ADTGT 365 1 1 ADTQG 306 2 AEENE 263 2 1 1 AEPPF 533 4 1 AGTDG 32 1 1 APPSE 1262 1 APTSE 946 2 ASTND 264 2 1 1 ASTSQ 283 3 ATEVD 349 3 ATTET 324 2 1 CPSTG 265 2 1 1 CPTQG 707 9 1 1 DEKGV 284 3 DGQGK 325 2 1 DKCPS 266 2 1 1 DSGDG 350 3 DSRCP 1263 6 1 1 DTGHE 367 1 1 DTGHG 267 2 1 1 DTGKH 307 2 DTGTP 368 1 1 DTNDN 268 2 1 1 DTQGS 308 2 DTSNH 351 3 EDGQG 326 2 1 EENEG 269 2 1 1 EGAGA 352 3 EGDGS 309 2 EGDNA 270 2 1 1 EGTDA 285 3 EIQNS 327 2 1 EIQTS 286 3 EKGVT 287 3 ENEGD 271 2 1 1 ESTEN 31 1 1 ETDEN 370 1 1 ETPTW 328 2 1 ETTEH 288 3 EVDSG 353 3 EVSET 329 2 1 GADTG 720 1 1 GADTQ 310 2 CASTS 289 3 GATTE 330 2 1 GDGSP 311 2 GHETD 372 1 1 GKAHN 331 2 1 GKHGK 312 2 GNDTG 313 2 GNDTS 354 3 GNETQ 332 2 1 GNETT 39 3 GNQEG 868 2 1 1 GQGKA 333 2 1 GTDGP 777 1 1 GTPHW 576 1 1 GVTQN 291 3 HETDE 573 1 1 IASTN 272 2 1 1 IQNSG 334 2 1 IQTSG 292 3 ISNTT 293 3 ITPNS 1264 1 1 ITPQA 1265 5 1 ITPQS 314 2 ITPRS 355 3 KCPST 44 2 1 1 KDTND 274 2 1 1 KGEDA 335 2 1 KGRLS 7 1 1 KGVTQ 294 3 NDTGK 315 2 NDTSN 356 3 NEGDN 275 2 1 1 NETQG 336 2 1 NETTE 295 3 NPTDT 276 2 1 1 NQEGS 277 2 1 1 NSGGT 337 2 1 NSPRA 378 1 1 NSRNT 850 3 NTTTD 296 3 PHAKK 316 2 PNSPR 379 1 1 PPSE1 1266 1 PQAPP 1267 1 PQAPT 520 2 PQAST 792 2 1 PQSST 908 2 PRAEA 380 1 1 PRSPS 836 3 PSTGE 854 2 1 1 PTDTG 279 2 1 1 QAPPS 1268 1 QAPTS 1269 2 QASTT 339 2 1 QEGSL 280 2 1 1 QGKAH 340 2 1 QNSGG 341 2 1 QSSTT 318 2 QTSGT 297 3 QVGNE 790 5 1 RCPTQ 558 9 1 1 SETQH 342 2 1 SGAST 298 3 SGATT 343 2 1 SNTTT 299 3 SPRAE 381 1 1 SQETW 300 3 SRCPT 892 6 1 1 SRNTS 359 3 SSTTE 910 2 STEDG 344 2 1 STSQE 301 3 TDENR 715 1 1 TDTGH 281 2 1 1 TEDGQ 345 2 1 TEPPF 302 3 TESTE 383 1 1 TETPT 346 2 1 TEVDS 360 3 TGHET 384 1 1 TGKHG 320 2 TGTPH 385 1 1 TKDTN 282 2 1 1 TNDNN 875 2 1 1 TNSRN 361 3 TPNSP 386 1 1 TPQAP 303 3 TPQAS 347 2 1 TPQSS 907 2 TPRSP 362 3 TQGSN 322 2 TSNHG 363 3 TSQET 304 3 TTEAE 323 2 TTEHG 1270 3 TTETP 536 2 1 TTTDS 936 3 VDSGD 364 3 VGNDT 1271 5 VGNET 1272 5 1 VSETQ 538 2 1 YEGDG 919 2 YEGTD 955 3 SEQ HQ184924 JF808120_Den3 JQ513335 BEPIPent ID NO: _SPH306629_Den2) BR_AL95_2009) JN848496_SPH323844_Den4) H778494_Den4 ADTGT 365 ADTQG 306 1 AEENE 263 AEPPF 533 1 1 AGTDG 32 APPSE 1262 APTSE 946 ASTND 264 ASTSQ 283 ATEVD 349 1 1 ATTET 324 1 CPSTG 265 CPTQG 707 1 1 1 DEKGV 284 DGQGK 325 1 DKCPS 266 DSGDG 350 1 1 DSRCP 1263 1 DTGHE 367 DTGHG 267 DTGKH 307 1 DTGTP 368 DTNDN 268 DTQGS 308 1 DTSNH 351 1 1 EDGQG 326 1 EENEG 269 EGAGA 352 1 1 EGDGS 309 1 EGDNA 270 EGTDA 285 EIQNS 327 1 EIQTS 286 EKGVT 287 ENEGD 271 ESTEN 31 ETDEN 370 ETPTW 328 1 ETTEH 288 EVDSG 353 1 1 EVSET 329 1 GADTG 720 GADTQ 310 1 CASTS 289 GATTE 330 1 GDGSP 311 1 GHETD 372 GKAHN 331 1 GKHGK 312 1 GNDTG 313 1 GNDTS 354 1 1 GNETQ 332 1 GNETT 39 GNQEG 868 GQGKA 333 1 GTDGP 777 GTPHW 576 GVTQN 291 HETDE 573 IASTN 272 IQNSG 334 1 IQTSG 292 ISNTT 293 ITPNS 1264 ITPQA 1265 1 ITPQS 314 1 ITPRS 355 1 1 KCPST 44 KDTND 274 KGEDA 335 1 KGRLS 7 KGVTQ 294 NDTGK 315 1 NDTSN 356 1 1 NEGDN 275 NETQG 336 1 NETTE 295 NPTDT 276 NQEGS 277 NSGGT 337 1 NSPRA 378 NSRNT 850 1 1 NTTTD 296 PHAKK 316 1 PNSPR 379 PPSE1 1266 PQAPP 1267 PQAPT 520 PQAST 792 1 PQSST 908 1 PRAEA 380 PRSPS 836 1 1 PSTGE 854 PTDTG 279 QAPPS 1268 QAPTS 1269 QASTT 339 1 QEGSL 280 QGKAH 340 1 QNSGG 341 1 QSSTT 318 1 QTSGT 297 QVGNE 790 1 RCPTQ 558 1 1 1 SETQH 342 1 SGAST 298 SGATT 343 1 SNTTT 299 SPRAE 381 SQETW 300 SRCPT 892 1 SRNTS 359 1 1 SSTTE 910 1 STEDG 344 1 STSQE 301 TDENR 715 TDTGH 281 TEDGQ 345 1 TEPPF 302 TESTE 383 TETPT 346 1 TEVDS 360 1 1 TGHET 384 TGKHG 320 TGTPH 385 TKDTN 282 TNDNN 875 TNSRN 361 1 1 TPNSP 386 TPQAP 303 TPQAS 347 1 TPQSS 907 1 TPRSP 362 1 1 TQGSN 322 1 TSNHG 363 1 1 TSQET 304 TTEAE 323 1 TTEHG 1270 TTETP 536 1 TTTDS 936 VDSGD 364 1 1 VGNDT 1271 1 1 1 VGNET 1272 1 VSETQ 538 1 YEGDG 919 1 YEGTD SEQ KP858105_Den1_GO091_ KP858119_Den1_GO280_ HQ184925_den2_ BEPIPent ID NO: 2013_BR 2013_BR SPH306593_2 ADTGT 365 ADTQG 306 1 AEENE 263 AEPPF 533 1 AGTDG 32 APPSE 1262 1 APTSE 946 1 ASTND 264 ASTSQ 283 1 1 ATEVD 349 ATTET 324 CPSTG 265 CPTQG 707 1 1 DEKGV 284 1 1 DGQGK 325 DKCPS 266 DSGDG 350 DSRCP 1263 1 1 DTGHE 367 DTGHG 267 DTGKH 307 1 DTGTP 368 DTNDN 268 DTQGS 308 1 DTSNH 351 EDGQG 326 EENEG 269 EGAGA 352 EGDGS 309 1 EGDNA 270 EGTDA 285 1 1 EIQNS 327 EIQTS 286 1 1 EKGVT 287 1 1 ENEGD 271 ESTEN 31 ETDEN 370 ETPTW 328 ETTEH 288 1 1 EVDSG 353 EVSET 329 GADTG 720 GADTQ 310 1 CASTS 289 1 1 GATTE 330 GDGSP 311 1 GHETD 372 GKAHN 331 GKHGK 312 1 GNDTG 313 1 GNDTS 354 GNETQ 332 GNETT 39 1 1 GNQEG 868 GQGKA 333 GTDGP 777 GTPHW 576 GVTQN 291 1 1 HETDE 573 IASTN 272 IQNSG 334 IQTSG 292 1 1 ISNTT 293 1 1 ITPNS 1264 ITPQA 1265 1 1 ITPQS 314 1 ITPRS 355 KCPST 44 KDTND 274 KGEDA 335 KGRLS 7 KGVTQ 294 1 1 NDTGK 315 1 NDTSN 356 NEGDN 275 NETQG 336 NETTE 295 1 1 NPTDT 276 NQEGS 277 NSGGT 337 NSPRA 378 NSRNT 850 NTTTD 296 1 1 PHAKK 316 1 PNSPR 379 PPSE1 1266 1 PQAPP 1267 1 PQAPT 520 1 PQAST 792 PQSST 908 1 PRAEA 380 PRSPS 836 PSTGE 854 PTDTG 279 QAPPS 1268 1 QAPTS 1269 1 QASTT 339 QEGSL 280 QGKAH 340 QNSGG 341 QSSTT 318 1 QTSGT 297 1 QVGNE 790 1 RCPTQ 558 1 1 SETQH 342 SGAST 298 1 1 SGATT 343 SNTTT 299 1 1 SPRAE 381 SQETW 300 1 1 SRCPT 892 1 1 SRNTS 359 SSTTE 910 1 STEDG 344 STSQE 301 1 1 TDENR 715 TDTGH 281 TEDGQ 345 TEPPF 302 1 1 TESTE 383 TETPT 346 TEVDS 360 TGHET 384 TGKHG 320 1 TGTPH 385 TKDTN 282 TNDNN 875 TNSRN 361 TPNSP 386 TPQAP 303 1 1 TPQAS 347 TPQSS 907 1 TPRSP 362 TQGSN 322 1 TSNHG 363 TSQET 304 1 1 TTEAE 323 1 TTEHG 1270 1 1 TTETP 536 TTTDS 936 1 1 VDSGD 364 VGNDT 1271 1 VGNET 1272 1 1 VSETQ 538 YEGDG 919 1 YEGTD 955 1 1 SEQ BEPIPent ID NO: JN848499_Den4_SPH318527_4 KP858111_Den1_GO166_2013_BR) ADTGT 365 ADTQG 306 AEENE 263 AEPPF 533 AGTDG 32 APPSE 1262 APTSE 946 1 ASTND 264 ASTSQ 283 1 ATEVD 349 1 ATTET 324 CPSTG 265 CPTQG 707 1 1 DEKGV 284 1 DGQGK 325 DKCPS 266 DSGDG 350 1 DSRCP 1263 1 DTGHE 367 DTGHG 267 DTGKH 307 DTGTP 368 DTNDN 268 DTQGS 308 DTSNH 351 1 EDGQG 326 EENEG 269 EGAGA 352 1 EGDGS 309 EGDNA 270 EGTDA 285 1 EIQNS 327 EIQTS 286 1 EKGVT 287 1 ENEGD 271 ESTEN 31 ETDEN 370 ETPTW 328 ETTEH 288 1 EVDSG 353 1 EVSET 329 GADTG 720 GADTQ 310 CASTS 289 1 GATTE 330 GDGSP 311 GHETD 372 GKAHN 331 GKHGK 312 GNDTG 313 GNDTS 354 1 GNETQ 332 GNETT 39 1 GNQEG 868 GQGKA 333 GTDGP 777 GTPHW 576 GVTQN 291 1 HETDE 573 IASTN 272 IQNSG 334 IQTSG 292 1 ISNTT 293 1 ITPNS 1264 ITPQA 1265 1 ITPQS 314 ITPRS 355 1 KCPST 44 KDTND 274 KGEDA 335 KGRLS 7 KGVTQ 294 1 NDTGK 315 NDTSN 356 1 NEGDN 275 NETQG 336 NETTE 295 1 NPTDT 276 NQEGS 277 NSGGT 337 NSPRA 378 NSRNT 850 1 NTTTD 296 1 PHAKK 316 PNSPR 379 PPSE1 1266 PQAPP 1267 PQAPT 520 1 PQAST 792 PQSST 908 PRAEA 380 PRSPS 836 1 PSTGE 854 PTDTG 279 QAPPS 1268 QAPTS 1269 1 QASTT 339 QEGSL 280 QGKAH 340 QNSGG 341 QSSTT 318 QTSGT 297 1 QVGNE 790 1 RCPTQ 558 1 1 SETQH 342 SGAST 298 1 SGATT 343 SNTTT 299 1 SPRAE 381 SQETW 300 1 SRCPT 892 1 SRNTS 359 1 SSTTE 910 STEDG 344 STSQE 301 1 TDENR 715 TDTGH 281 TEDGQ 345 TEPPF 302 1 TESTE 383 TETPT 346 TEVDS 360 1 TGHET 384 TGKHG 320 TGTPH 385 TKDTN 282 TNDNN 875 TNSRN 361 1 TPNSP 386 TPQAP 303 1 TPQAS 347 TPQSS 907 TPRSP 362 1 TQGSN 322 TSNHG 363 1 TSQET 304 1 TTEAE 323 TTEHG 1270 1 TTETP 536 TTTDS 936 1 VDSGD 364 1 VGNDT 1271 1 VGNET 1272 1 VSETQ 538 YEGDG 919 YEGTD 955 1
(407) TABLE-US-00012 TABLE 12 SEQ SEQ SEQ Cross SEQ SEQ Yellow ID ID ID SEQ ID SEQ ID SEQ ID reactive ID Not ID fever NO Den1 NO Den2 NO Den3 NO Den4 NO Zika NO DEN1-4 NO Zika NO AEENE SEQ ASTSQ SEQ ADTQG SEQ ATTET SEQ 324 ATEVD SEQ 349 ADTGT SEQ 365 EPPFG SEQ GSSIG SEQ 263 283 306 387 391 ASTND SEQ DEKGV SEQ DTGKH SEQ DGQGK SEQ 325 DSGDG SEQ 350 AGTDG SEQ 366 ETQHG SEQ 264 284 307 388 CPSTG SEQ EGTDA SEQ DTQGS SEQ EDGQG SEQ 326 DTSNH SEQ 351 DTGHE SEQ 367 KGSSI SEQ 265 285 308 389 DKCPS SEQ EIQTS SEQ EGDGS SEQ EIQNS SEQ 327 EGAGA SEQ 352 DTGTP SEQ 368 QEGAM SEQ 266 286 309 390 DTGHG SEQ EKGVT SEQ GADTQ SEQ ETPTW SEQ 328 EVDSG SEQ 353 ESTEN SEQ 369 267 287 310 DTNDN SEQ ETTEH SEQ GDGSP SEQ EVSET SEQ 329 GNDTS SEQ 354 ETDEN SEQ 370 268 288 311 EENEG SEQ GASTS SEQ GKHGK SEQ GATTE SEQ 330 ITPRS SEQ 355 GADTG SEQ 371 269 289 312 EGDNA SEQ GNETT SEQ GNDTG SEQ GKAHN SEQ 331 NDTSN SEQ 356 GHETD SEQ 372 270 290 313 ENEGD SEQ GVTQN SEQ ITPQS SEQ GNETQ SEQ 332 NSRNT SEQ 357 GTDGP SEQ 373 271 291 314 IASTN SEQ IQTSG SEQ NDTGK SEQ GQGKA SEQ 333 PRSPS SEQ 358 GTPHW SEQ 374 272 292 315 KCPST SEQ ISNTT SEQ PHAKK SEQ IQNSG SEQ 334 SRNTS SEQ 359 HETDE SEQ 375 273 293 316 KDTND SEQ KGVTQ SEQ PQSST SEQ KGEDA SEQ 335 TEVDS SEQ 360 ITPNS SEQ 376 274 294 317 NEGDN SEQ NETTE SEQ QSSTT SEQ NETQG SEQ 336 TNSRN SEQ 361 KGRLS SEQ 377 275 295 318 NPTDT SEQ NTTTD SEQ SSTTE SEQ NSGGT SEQ 337 TPRSP SEQ 362 NSPRA SEQ 378 276 296 319 NQEGS SEQ QTSGT SEQ TGKHG SEQ PQAST SEQ 338 TSNHG SEQ 363 PNSPR SEQ 379 277 297 320 PSTGE SEQ SGAST SEQ TPQSS SEQ QASTT SEQ 339 VDSGD SEQ 364 PRAEA SEQ 380 278 298 321 PTDTG SEQ SNTTT SEQ TQGSN SEQ QGKAH SEQ 340 SPRAE SEQ 381 279 299 322 QEGSL SEQ SQETW SEQ TTEAE SEQ QNSGG SEQ 341 TDENR SEQ 382 280 300 323 TDTGH SEQ STSQE SEQ SETQH SEQ 342 TESTE SEQ 383 281 301 TKDTN SEQ TEPPF SEQ SGATT SEQ 343 TGHET SEQ 384 282 302 TPQAP SEQ STEDG SEQ 344 TGTPH SEQ 385 303 TSQET SEQ TEDGQ SEQ 345 TPNSP SEQ 386 304 TTDS SEQ TETPT SEQ 346 305 TPQAS SEQ 347 YKGED SEQ 348
(408) These peptides can be synthesized chemically with or without the contextual flanking regions of up to five amino acids each side and with or without histags or FLAG tags. As reagents they are used attached to a solid (paper or plastic, among other possibilities know to those skilled in the art) or semisolid (for example, but not limited to, agarose, nitrocellulose) medium or utilized in suspension in a capture mode. In addition, a secondary immunoglobulin binding colorimetric secondary antibody can facilitate test readout. By recording the pattern of binding to an array of peptides it is possible to differentiate between prior exposure of a subject to each or multiple of the viruses. An array may be very simple with only 1-5 of the peptides shown for each virus, or a subset thereof, or may incorporate up to all of the peptides in Table 12. The peptides may be used for simple clinical differential diagnosis. They may also be utilized to determine the duration of antibody titers to each peptide, in which case many or all of the peptides will be employed. For instance, the duration of antibody titers to mimics such as the pentamer ESTEN (SEQ ID NO.: 31) in Zika (or others described herein, so this example is not considered limiting) are important in determining when a pregnancy may be safe without risking transplacental antibody transfer adverse to fetal development. Similarly, the test kit may be used to assess vaccine efficacy in raising appropriate protective antibodies rather than those targeting mimics.
Example 7: An Engineered Zika Vaccine Component with Multiple Mutations
(409) In order to generate a vaccine candidate envelope protein in which antibody mediated mimicry is mitigated, we generated an envelope protein amino acid sequence in which the pentamer mimic motifs ESTEN (SEQ ID NO.: 31), LGRLS (SEQ ID NO.: 1273), PRAEA (SEQ ID NO.: 380), and GADTG (SEQ ID NO.: 720) were each replaced with a pentamer of different amino acids. In addition, the pentamer DRGWG (SEQ ID NO.: 554) was replaced as this motif is associated with potential cross reactivity with other flaviviruses leading to antibody dependent enhancement. As a result of introduction of new pentamer motifs the new sequence was reexamined to determine that the location of B and T cell motifs has not been disrupted and that the new pentamers, and those arising in the flanks of each new pentamer did not give rise to new problematic mimics. Hence for each pentamer replaced a minimum of 9 new pentamers were evaluated for new mimics. Therefore, the analysis of B cell epitope mimics was repeated with the novel sequences. Sequences 392 to 397 provide the sequences for a preferred envelope protein with the mimics replaced. It will be evident to those skilled in the art that other replacement pentamers may be equally suitable and thus these sequences provide examples which are not considered limiting. The envelope proteins comprising the mimics may be incorporated into vaccines using one of many delivery vehicles known to the art as previously discussed, including but not limited to Fc fusions, virus like particles, vectored via adeno or poxviruses, chimeras, or as DNA. Thus the inclusion of Fc fusion examples in the sequences shown is not considered limiting.
(410) Seq.392. His-EKL-Soluble-Nucleotide Sequence 1-63 Signal peptide 70-87 6× His Tag 88-111 Enterokinase linker 112-1332 Soluble envelope with 5 mutations
(411) Seq.393. His-EKL-Soluble-Amino Acid Sequence 1-21 Signal peptide 22-29 6× His Tag 30-37 Enterokinase linker 38-444 Soluble envelope with 5 mutations
(412) Seq.394. Soluble Nucleotide Sequence 1-63 Signal peptide 69-1287 Soluble envelope with 5 mutations 1288-1311 Enterokinase linker 1312-2016 hG1(CH2-CH3) constant region
(413) Seq.395. Soluble Amino Acid Sequence 1-21 Signal peptide 23-429 Soluble envelope with 5 mutations 430-437 Enterokinase linker 438-672 hG1(CH2-CH3) constant region
(414) Seq.396. His-Soluble Nucleotide Sequence 1-63 Signal peptide 72-87 6× His Tag 88-1305 Soluble envelope with 5 mutations 1306-1329 Enterokinase Linker 1336-2037 mG2a(CH2-CH3) constant region
(415) Seq.397. His-Soluble Amino Acid Sequence 1-21 Signal peptide 24-29 6× His Tag 30-435 Soluble envelope with 5 mutations 436-443 Enterokinase Linker 446-679 mG2a(CH2-CH3) constant region
(416) In addition to preparing components of the envelope as standalone ZIKV envelope domain sequences and as immunoglobulin fusions, subviral particles were also constructed comprising PrMEnv. This was conducted generally following the methods of Merino-Ramos et al (PLoS ONE 9(9): e108056. doi:10.1371. Sub viral particles were constructed which comprised mutant versions of four of the above referenced mimic peptides (PRAEA (SEQ ID NO.: 575), AGADT (SEQ ID NO.: 719), KGRLS (SEQ ID NO.: 724), ESTEN (SEQ ID NO.: 31)) and also with only the Domain II pan flavi cross reactive motif DRGWG (SEQ ID NO.: 554). In addition, control sequences which contained no motif changes from the wild type were constructed also as subviral particles. These are shown below as SEQS 257-262. The sequences were transfected into Vero and CHO cells and subviral particles expressed for testing of their immunogenicity in mice.
(417) Seq.257. jeSP-prME(NGWGRD), Nucleotide Sequence 1-72 Signal peptide 77-1809 ZikV prME with NGWGRD mutation
(418) Seq.258. jeSP-prME(NGWGRD), Amino Acid Sequence 1-24 Signal peptide 25-603 ZikV prME with NGWGRD mutation
(419) Seq.259. jeSP-prME(PEARA-GEKAP-LRKGS-NTSEE), Nucleotide Sequence 1-72 Signal peptide 77-1809 ZikV prME with PEARA-GEKAP-LRKGS-NTSEE mutations
(420) Seq.260. jeSP-prME(PEARA-GEKAP-LRKGS-NTSEE), Amino Acid Sequence 1-24 Signal peptide 25-603 ZikV prME with PEARA-GEKAP-LRKGS-NTSEE mutations
(421) Seq.261. jeSP-prME, Nucleotide Sequence 1-72 Signal peptide 77-1809 ZikV prME
(422) Seq.262. ZikV prME, Amino Acid Sequence 1-24 Signal peptide 25-603 ZikV prME
Example 8: Synthetic and Engineered Neurologic Proteins
(423) The human proteins of neurologic function which contain epitope mimics for Zika virus have been identified above. In order to evaluate the role of such mimic epitopes in the pathogenesis of Zika virus and dengue we developed recombinant versions of the neurologic proteins of interest in which the wild type epitope motif is retained and versions in which one or more of the epitope mimics for Zika or dengue is replaced. In addition, control motifs are included for yellow fever and tetanus toxin. Sequences 173-182 provide an example of such sequences for neuropeptide Y. A further set of recombinant proteins was developed which are based on NAV 2 and which include the wild type and replacement pentamers for the predicted mimics, KGRLS (SEQ ID NO.: 577) (Zika) and TDKEK (SEQ ID NO.: 56) (dengue 1). Given the size of NAV2, over 2800 amino acids, we elected in this example to only use the central portion of the protein spanning both Zika and dengue 1 mimics. This is shown in Sequence 235 to 244. A similar approach is taken with other human proteins containing mimic epitopes for Zika or dengue and thus the examples shown for NAV2 and NPY are not limiting.
(424) In a further embodiment the synthetic neurologic proteins are expressed as a fusion with an immunoglobulin Fc region. In yet another embodiment the synthetic polypeptide derived from neuropeptide Y is mutated to prevent the cleavage of mature NPY from the CPON component. These modifications of the proteins are shown in SEQS 398 to 437.
(425) Seq.398. His-NAV2(KGRLS-TDKEK)-EKL-mG2a(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-87 6× His Tag 88-807 Neuron Navigator 2 808-831 Enterokinase Linker 838-1539 mG2a(CH2-CH3) constant region
(426) Seq.399. His-NAV2(KGRLS-TDKEK)-EKL-mG2a(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 22-29 6× His Tag 30-269 Neuron Navigator 2 270-277 Enterokinase Linker 278-513 mG2a(CH2-CH3) constant region
(427) Seq.400. His-NAV2(LRKGS-TDKEK)-EKL-mG2a(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-87 6× His Tag 88-807 Neuron Navigator 2 808-831 Enterokinase Linker 838-1539 mG2a(CH2-CH3) constant region
(428) Seq.401. His-NAV2(LRKGS-TDKEK)-EKL-mG2a(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 22-29 6× His Tag 30-269 Neuron Navigator 2 270-277 Enterokinase Linker 278-513 mG2a(CH2-CH3) constant region
(429) Seq.402. His-NAV2(KGRLS-DTREK)-EKL-mG2a(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-87 6× His Tag 88-807 Neuron Navigator 2 808-831 Enterokinase Linker 838-1539 mG2a(CH2-CH3) constant region
(430) Seq.403. His-NAV2(KGRLS-DTREK)-EKL-mG2a(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 22-29 6× His Tag 30-269 Neuron Navigator 2 270-277 Enterokinase Linker 278-513 mG2a(CH2-CH3) constant region
(431) Seq.404. His-NAV2(STNDD-DTREK)-EKL-mG2a(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-87 6× His Tag 88-807 Neuron Navigator 2 808-831 Enterokinase Linker 838-1539 mG2a(CH2-CH3) constant region
(432) Seq.405. His-NAV2(STNDD-DTREK)-EKL-mG2a(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 22-29 6× His Tag 30-269 Neuron Navigator 2 270-277 Enterokinase Linker 278-513 mG2a(CH2-CH3) constant region
(433) Seq.406. His-NAV2(SL15-DTREK)-EKL-mG2a(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-87 6× His Tag 88-837 Neuron Navigator 2 838-861 Enterokinase Linker 868-1569 mG2a(CH2-CH3) constant region
(434) Seq.407. Heavy Chain Variable Region, Amino Acid Sequence, ID:500p 1-21 Signal peptide 22-29 6× His Tag 30-279 Neuron Navigator 2 280-287 Enterokinase Linker 288-523 mG2a(CH2-CH3) constant region
(435) Seq.408. mG2a(CH2-CH3)-EKL-NAV2(KGRLS-TDKEK)-his, Nucleotide Sequence 1-63 Signal peptide 70-768 mG2a(CH2-CH3) constant region 778-801 Enterokinase Linker 802-1521 Neuron Navigator 2 1522-1539 6× His Tag
(436) Seq.409. mG2a(CH2-CH3)-EKL-NAV2(KGRLS-TDKEK)-his, Amino Acid Sequence 1-21 Signal peptide 22-256 mG2a(CH2-CH3) constant region 260-267 Enterokinase Linker 268-507 Neuron Navigator 2 508-513 6× His Tag
(437) Seq.410. mG2a(CH2-CH3)-EKL-NAV2(LRKGS-TDKEK)-his, Nucleotide Sequence 1-63 Signal peptide 70-768 mG2a(CH2-CH3) constant region 778-801 Enterokinase Linker 802-1521 Neuron Navigator 2 1522-1539 6× His Tag
(438) Seq.411. mG2a(CH2-CH3)-EKL-NAV2(LRKGS-TDKEK)-his, Amino Acid Sequence 1-21 Signal peptide 22-256 mG2a(CH2-CH3) constant region 260-267 Enterokinase Linker 268-507 Neuron Navigator 2 508-513 6× His Tag
(439) Seq.412. mG2a(CH2-CH3)-EKL-NAV2(KGRLS-DTREK)-his, Nucleotide Sequence 1-63 Signal peptide 70-768 mG2a(CH2-CH3) constant region 778-801 Enterokinase Linker 802-1521 Neuron Navigator 2 1522-1539 6× His Tag
(440) Seq.413. mG2a(CH2-CH3)-EKL-NAV2(KGRLS-DTREK)-his, Amino Acid Sequence 1-21 Signal peptide 22-256 mG2a(CH2-CH3) constant region 260-267 Enterokinase Linker 268-507 Neuron Navigator 2 508-513 6× His Tag
(441) Seq.414. mG2a(CH2-CH3)-EKL-NAV2(STNDD-DTREK)-his, Nucleotide Sequence 1-63 Signal peptide 70-768 mG2a(CH2-CH3) constant region 778-801 Enterokinase Linker 802-1521 Neuron Navigator 2 1522-1539 6× His Tag
(442) Seq.415. mG2a(CH2-CH3)-EKL-NAV2(STNDD-DTREK)-his, Amino Acid Sequence 1-21 Signal peptide 22-256 mG2a(CH2-CH3) constant region 260-267 Enterokinase Linker 268-507 Neuron Navigator 2 508-513 6× His Tag
(443) Seq.416. mG2a(CH2-CH3)-EKL-NAV2(SL15-DTREK)-his, Nucleotide Sequence 1-63 Signal peptide 70-768 mG2a(CH2-CH3) constant region 778-801 Enterokinase Linker 802-1551 Neuron Navigator 2 1552-1569 6× His Tag
(444) Seq.417. mG2a(CH2-CH3)-EKL-NAV2(SL15-DTREK)-his, Amino Acid Sequence 1-21 Signal peptide 22-256 mG2a(CH2-CH3) constant region 260-267 Enterokinase Linker 268-517 Neuron Navigator 2 518-523 6× His Tag
(445) Seq.418. His-hNPYmod(GEDAP-ESTEN)-EKL-mG2a(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-87 6× His Tag 88-300 hNPY modified 301-324 Enterokinase Linker 331-1029 mG2a(CH2-CH3) Constant region
(446) Seq.419. His-hNPYmod(GEDAP-ESTEN)-EKL-mG2a(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 24-29 6× His Tag 30-100 hNPY modified 101-108 Enterokinase Linker 111-343 mG2a(CH2-CH3) Constant region
(447) Seq.420. His-hNPYmod(PDAEG-ESTEN)-EKL-mG2a(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-87 6× His Tag 88-300 hNPY modified 301-324 Enterokinase Linker 331-1029 mG2a(CH2-CH3) Constant region
(448) Seq.421. His-hNPYmod(PDAEG-ESTEN)-EKL-mG2a(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 24-29 6× His Tag 30-100 hNPY modified 101-108 Enterokinase Linker 111-343 mG2a(CH2-CH3) Constant region
(449) Seq.422. His-hNPYmod(GEDAP-NTSEE)-EKL-mG2a(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-87 6× His Tag 88-300 hNPY modified 301-324 Enterokinase Linker 331-1029 mG2a(CH2-CH3) Constant region
(450) Seq.423. His-hNPYmod(GEDAP-NTSEE)-EKL-mG2a(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 24-29 6× His Tag 30-100 hNPY modified 101-108 Enterokinase Linker 111-343 mG2a(CH2-CH3) Constant region
(451) Seq.424. His-hNPYmod(PDAEG-STNDD)-EKL-mG2a(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-87 6× His Tag 88-300 hNPY modified 301-324 Enterokinase Linker 331-1029 mG2a(CH2-CH3) Constant region
(452) Seq.425. His-hNPYmod(PDAEG-STNDD)-EKL-mG2a(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 24-29 6× His Tag 30-100 hNPY modified 101-108 Enterokinase Linker 111-343 mG2a(CH2-CH3) Constant region
(453) Seq.426. His-hNPYmod(PDAEG-tetSL15)-EKL-mG2a(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-87 6× His Tag 88-330 hNPY modified 331-354 Enterokinase Linker 361-1059 mG2a(CH2-CH3) Constant region
(454) Seq.427. His-hNPYmod(PDAEG-tetSL15)-EKL-mG2a(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 24-29 6× His Tag 30-110 hNPY modified 111-118 Enterokinase Linker 121-353 mG2a(CH2-CH3) Constant region
(455) Seq.428. mG2a(CH2-CH3)-EKL-hNPYmod(GEDAP-ESTEN)-his, Nucleotide Sequence 1-63 Signal peptide 70-768 mG2a(CH2-CH3) Constant Region 778-801 Enterokinase Linker 802-1014 hNPY modified 1015-1032 6× His Tag
(456) Seq.429. mG2a(CH2-CH3)-EKL-hNPYmod(GEDAP-ESTEN)-his, Amino Acid sequence 1-21 Signal peptide 24-256 mG2a(CH2-CH3) Constant Region 260-267 Enterokinase Linker 268-338 hNPY modified 339-344 6× His Tag
(457) Seq.430. mG2a(CH2-CH3)-EKL-hNPYmod(PDAEG-ESTEN)-his, Nucleotide Sequence 1-63 Signal peptide 70-768 mG2a(CH2-CH3) Constant Region 778-801 Enterokinase Linker 802-1014 hNPY modified 1015-1032 6× His Tag
(458) Seq.431. mG2a(CH2-CH3)-EKL-hNPYmod(PDAEG-ESTEN)-his, Amino Acid Sequence 1-21 Signal peptide 24-256 mG2a(CH2-CH3) Constant Region 260-267 Enterokinase Linker 268-338 hNPY modified 339-344 6× His Tag
(459) Seq.432. mG2a(CH2-CH3)-EKL-hNPYmod(GEDAP-NTSEE)-his, Nucleotide Sequence 1-63 Signal peptide 70-768 mG2a(CH2-CH3) Constant Region 778-801 Enterokinase Linker 802-1014 hNPY modified 1015-1032 6× His Tag
(460) Seq.433. mG2a(CH2-CH3)-EKL-hNPYmod(GEDAP-NTSEE)-his, Amino Acid Sequence 1-21 Signal peptide 24-256 mG2a(CH2-CH3) Constant Region 260-267 Enterokinase Linker 268-338 hNPY modified 339-344 6× His Tag
(461) Seq.434. mG2a(CH2-CH3)-EKL-hNPYmod(PDAEG-STNDD)-his, Nucleotide Sequence 1-63 Signal peptide 70-768 mG2a(CH2-CH3) Constant Region 778-801 Enterokinase Linker 802-1014 hNPY modified 1015-1032 6× His Tag
(462) Seq.435. mG2a(CH2-CH3)-EKL-hNPYmod(PDAEG-STNDD)-his, Amino Acid Sequence 1-21 Signal peptide 24-256 mG2a(CH2-CH3) Constant Region 260-267 Enterokinase Linker 268-338 hNPY modified 339-344 6× His Tag
(463) Seq.436. mG2a(CH2-CH3)-EKL-hNPYmod(PDAEG-tetSL15)-his, Nucleotide Sequence 1-63 Signal peptide 70-768 mG2a(CH2-CH3) Constant Region 778-801 Enterokinase Linker 802-1044 hNPY modified 1045-1062 6× His Tag
(464) Seq.437. mG2a(CH2-CH3)-EKL-hNPYmod(PDAEG-tetSL15)-his, Amino Acid Sequence 1-21 Signal peptide 24-256 mG2a(CH2-CH3) Constant Region 260-267 Enterokinase Linker 268-348 hNPY modified 349-354 6× His Tag
(465) Retrovector constructs containing each of the SEQS 173-182, SEQs 235-244 and SEQs 398-437 are then used to transfect CHO cells and achieve stable integration and expression as previously described (U.S. Pat. Nos. 8,703,134; 8,394,379; 7,566,447; and 20130230516; each of which is incorporated herein by reference in its entirety). Other methods of expression known to the art may be used.
(466)
(467) A particular application of these constructs derived from NPY and NAV2, and from other mimic epitope bearing human proteins, in addition to being applied in validation of epitope mimic predictions, is to serve as a detection system for anti-Zika antibodies which have binding to these human proteins with potential adverse effect. As such the engineered human proteins with mimics and scrambled mimics serve as a tool in the detection of antibodies as a surrogate marker of probability of development of GBS or fetal syndrome or other adverse neuropathology arising from Zika infection.
(468) The method of detection of binding of anti-Zika antibodies to the synthetic polypeptides may be any assay well known to those skilled in the art including but not limited to ELISA assays, or Western blots.
Example 9: Mimic Peptides in Non-Structural Proteins of Zika Virus
(469) We analyzed the predicted B cell epitopes of Zika proteins in comparison with human proteome proteins which are identified as having an association with microcephaly. A sub set of the human proteome was selected based on the presence of the term “microcephaly” anywhere in the Uniprot descriptor. Based on this approach a number of matches of pentamer motifs found in flaviviruses were identified. Some matches are found very widely in all flaviviruses; these were discounted. High probability epitope mimics found in Zika virus SPH2015 are shown in Table 13
(470) TABLE-US-00013 TABLE 13 Zika SEQ Mimic protein ID NO: motif Human protein target PrM SEQ 1334 SSTSQ CDKRap2 (UniProt B1AMJ5) NS1 SEQ 702 STTAS ASPM NS3 SEQ 1335 RREEE CDKRap2 (UniProt B1AMJ5) NS4B SEQ 1336 AAQKR ASPM NS4B SEQ 1337 GESSS CEP135
(471) Zika virus NS1 was found to have a particularly unique match to Abnormal spindle like microcephaly associated protein (ASPM), mutations of which are highly associated with microcephaly (
(472) NS1 is Immunogenic in Flaviviruses
(473) NS1 is secreted from flaviviral infected cells as a dimer, it is released into circulation but some also remains associated with the plasma membrane of the cells. NS1 may be secreted at very high levels into serum, depending on flaviviral strain, with up to 50 ug/ml having been reported in the serum of dengue type 2 patients [55-57]. In most well understood flaviviral infections patients, non structural protein 1 (NS1) induces high levels of antibodies [58]. The presence of antibody mimic epitopes in dengue NS1 is well documented, with antibodies elicited by NS1 binding to endothelium and clotting factors [59, 60].
(474) When we compare flaviviral predicted B cell epitopes to human proteins involved in cardiovascular functions, our observations confirm the presence of epitope mimics in dengue NS1 including B cell epitopes which elicit antibodies matching B cell epitopes in coagulation factors VII, VIII, X, vascular endothelial growth factors (VEGF), plasminogen, thrombospondin and von Willebrand (VWF) factor and others.
(475) NS1 Contains a B Cell Epitope which Comprises the Motif STTAS (SEQ ID NO.: 702) and which has Strong T Cell Help
(476) Zika virus however is different from other flaviviruses in that while its NS1 does have a lesser set of mimics for VEGF and VWF than dengue, it also has a particular B cell epitope which comprises the motif STTAS (SEQ ID NO.: 702), centered at amino acid position 303 of NS1 (
(477) NS1 proteins of Zika virus are therefore proteins which are likely secreted in large amounts, are highly immunogenic, and have a domain B cell epitope which elicits antibodies that are predicted to bind a B cell epitope on ASPM. In addition, the presence of the matching peptide motif in NS1 during replication in neurons may bind and compromise functions of ASPM directly.
(478) Although examination of Zika virus isolates over the years shows multiple mutations in NS1, the loop comprising the motifs of interest is highly conserved, lying in a loop between multiple disulphide bonds [61].
(479) ASPM is Associated with Microcephaly
(480) Abnormal spindle microcephaly associated protein ASPM, otherwise known as MCPH5, is a major determinant of cortical size [62]. Homozygous recessive mutations of ASPM are the defect most commonly associated with genetic based microcephaly. Mutations in ASPM are the most frequent cause of microcephaly [63]. ASPM is preferentially expressed in the developing brain [64]. ASPM is a large protein, 3477 amino acids long which comprises two distinct regions, a N terminal region of ˜869 amino acids followed by a number of higher order repeated sequences configured as IQXXXRGXXXR, which vary between isoforms and between species and occupy the C terminal half of the protein. The number of repeats appears to be linked to brain size. ASPM locates bound to the spindle with the first 960 amino acids being the tubule binding domain. The STTAS (SEQ ID NO.: 702) motif is located within this region (
(481) ASPM is closely associated with the mitotic spindle and may control the symmetry of proliferation in progenitor cells. It appears to control chromosomal segregation and is essential to allow fetal stem cells to produce neurons[64]. ASPM may also control neuronal migration [65]. The role of ASPM in non-neuronal cells is less clear. No defects other than microcephaly are found in patients carrying mutations of this ASPM. Hence it only appears essential for neuronal mitogenesis.
(482) The presence of antibodies binding ASPM would likely compromise or inhibit its function, thereby compromising its role in spindle formation and chromosome segregation, especially in neuronal cells. It is also possible that an excess of NS1 bearing the homologous peptide motif may compromise interactions with other spindle proteins.
(483) STTAS in ASPM is Located in the Conserved Spindle Binding Region
(484) STTAS (SEQ ID NO.: 702), the motif which corresponds to a B cell epitope in Zika NS1 is centered at amino acid 567. Notably the motif RGPAA (SEQ ID NO.: 1274), found in WNV is centered at amino acid position 27, very close to the N terminal. The motif SSTAS is also found in a B cell epitope in ASPM.
(485) Only full length isoforms of human ASPM carry the motif uniprot.org/uniprot/Q8IZT6. STTAS (SEQ ID NO.: 702) is found in ASPM of Gorilla and chimpanzee and several other species of Old World Monkeys but not in other mammals. Macaques and Aotus carry a near neighbor motif LTTAS (SEQ ID NO.: 1275). Mice and other commonly used lab rodents do not have a similar motif, precluding direct testing of the impact of NS1 or antibodies thereto.
(486) Uniprot Lists the Known Functions of ASPM as the Following: cerebral cortex development developmental growth forebrain neuroblast division maintenance of centrosome location male gonad development mitotic nuclear division negative regulation of asymmetric cell division negative regulation of neuron differentiation neuronal stem cell population maintenance neuron migration oogenesis positive regulation of canonical Wnt signaling pathway positive regulation of neuroblast proliferation regulation of meiotic cell cycle spermatogenesis spindle assembly involved in meiosis spindle localization spindle organization
(487) Diagnostics Based on the NS1 Mimic Motifs:
(488) Identification of antibodies in a pregnant woman following Zika infection, wherein said antibodies are directed to ASPM is therefore likely indicative of risk of the fetus developing microcephaly. In one embodiment therefore we provide a diagnostic test comprising the peptide STTAS (SEQ ID NO.: 702) or an extended peptide comprising this motif, comprising GPSLRSTTASGRVIE (SEQ ID NO.: 645). In addition, we provide a recombinant form of NS1 firstly comprising the wildtype motif STTAS (SEQ ID NO.: 702) and an alternate version in which this is replaced by MTTVM (SEQ ID NO.: 1276). This allows the demonstration of epitope specific binding to the motif of interest.
(489) We further provide a synthetic polypeptide derived from ASPM which may identify antibodies elicited in response to Zika NS1. As controls we also provide two such polypeptides, one with a scrambled motif and one in which the Zika motif is replaced by a Yellow fever motif. It will be recognized by those skilled in the art that the immediate context of the mimic motifs is of importance but that the length of the surrounding polypeptide is selected for convenience and that various mutant or scrambled motifs may be designed. Hence the examples in Table 14 below are not considered limiting.
(490) TABLE-US-00014 TABLE 14 Synthetic peptides and polyproteins of utility in detection of antibodies to NS1: SEQ ID NO: Sequence Utility 1239 STTAS detection 1240 GPSLRSTTASGRVIE detection 1241 GPSLRMTMVSGRVIE Control 1242 SAVGEHEKVINNQKEKEDFHSYLPIIDPILSKSKSYKNEVTPSSTTA ASPM detection SVARKRKSDGMEDANVRVAITEHTEVREIKRIHFSPSEP 1243 SAVGEHEKVINNQKEKEDFHSYLPIIDPILSKSKSYKNEVTPSMTM ASPM control VSVARKRKSDGMEDANVRVAITEHTEVREIKRIHFSPSEP 1244 SAVGEHEKVINNQKEKEDFHSYLPIIDPILSKSKSYKNEVTPSSTTD Yellow fever SVARKRKSDGMEDANVRVAITEHTEVREIKRIHFSPSEP control
(491) NS1 Based Vaccines
(492) The majority of vaccines designed to combat flaviviruses have utilized the envelope and membrane proteins. However, concerns regarding incomplete understanding of antibody interactions between serotypes of dengue have led to the evaluation of dengue vaccines comprising the NS1 protein [66, 67]. These have included DNA vaccines which have demonstrated capability to raise high levels of anti-NS1 antibody in mice, which is itself partially protective following passive transfer. Similar observations of passive protection by antibodies to NS1 are reported for West Nile virus [68]. The presence of adverse motifs in NS1 is therefore of concern and must be understood before vaccine comprising NS1 of Zika is developed.
(493) To overcome this concern, in one embodiment of the present invention we provide synthetic versions of NS1, or apportion thereof, in which the STTAS (SEQ ID NO.: 702) mimic is replaced. Such polypeptides may be designed to contain other motifs, hence the example shown is not limiting. Furthermore, such a NS1 based vaccine may be formulated as a protein, a protein fusion, a component of a chimera, a virus like particle or as a nucleotide sequence. In one particular embodiment shown below we express the synthetic polypeptide of NS1 as an immunoglobulin Fc-fusion.
(494) Seq.438. NS1-EKL-hG1(CH2-CH3), Nucleotide Sequence 1-60 Signal peptide 61-1152 NS1 1153-1176 Enterokinase Linker 1177-1881 hG1(CH2-CH3) Constant region
(495) Seq.439. NS1-EKL-hG1(CH2-CH3), Amino Acid Sequence 1-20 Signal peptide 21-384 NS1 385-392 Enterokinase Linker 393-627 hG1(CH2-CH3) Constant region
(496) Seq.440. NS1_M4-EKL-hG1(CH2-CH3), Nucleotide Sequence 1-60 Signal peptide 61-1152 NS1 M4 mutant 1153-1176 Enterokinase Linker 1177-1881 hG1(CH2-CH3) Constant region
(497) Seq.441. NS1_M4-EKL-hG1(CH2-CH3), Amino Acid Sequence 1-20 Signal peptide 21-384 NS1 M4 mutant 385-392 Enterokinase Linker 393-627 hG1(CH2-CH3) Constant region
(498) Seq.442. NS1_Partial-EKL-hG1(CH2-CH3), Nucleotide Sequence 1-60 Signal peptide 61-639 NS1 partial 640-663 Enterokinase Linker 664-1368 hG1(CH2-CH3) Constant region
(499) Seq.443. NS1_Partial-EKL-hG1(CH2-CH3), Amino Acid Sequence 1-20 Signal peptide 21-213 NS1 partial 214-221 Enterokinase Linker 222-456 hG1(CH2-CH3) Constant region
(500) Seq.444. NS1_M4_Partial-EKL-hG1(CH2-CH3), Nucleotide Sequence 1-60 Signal peptide 61-639 NS1_M4 partial 640-663 Enterokinase Linker 664-1368 hG1(CH2-CH3) Constant region
(501) Seq.445. NS1_M4_Partial-EKL-hG1(CH2-CH3), Amino Acid Sequence 1-20 Signal peptide 21-213 NS1_M4 partial 214-221 Enterokinase Linker 222-456 hG1(CH2-CH3) Constant region
Example 10: Development of Serodiagnostic Kits to Differentiate Flavivirus Infections
(502) As a broader understanding of the spread and co-endemnicity of Zika virus has emerged, the need for a specific serologic diagnostic kit which can differentiate not only antibodies from infection with Zika from those arising from infections with dengue serotypes and yellow fever, but also from chikungunya and West Nile virus has become apparent. There is also utility to being able to differentiate IgG and IgM responses. With this goal we further evaluated the high probability B cell epitopes in exemplars each of these viruses and selected 6-15 pentamer B cell epitopes for each envelope protein and each NS1 protein. The 15 mer peptides within which these pentamers form the central five amino acids were also recorded. In the case of chikungunya 8 15mer peptides, each comprising a high probability B cell epitope pentamers were selected from the E2 protein. These peptides (the “diagnostic set”) can be used singly in an array, or as a pool for each virus, to identify antibodies to each of these viruses and to differentiate from antibodies to the other viruses in the diagnostic set.
(503) For each virus a representative a set of isolates was then assembled, comprising 20.fwdarw.200 isolates for each virus. These included both polyproteins and envelope sequences, and polyproteins and NS1 proteins as shown in Table 15, as well as 30 isolates of chikungunya virus. These sets of proteins sequences were curated to ensure they were complete, or near complete, sequences and to exclude any duplicate isolates. The resultant database of sequences for each virus was interrogated by the diagnostic set of epitope pentamers to determine how conserved each of the selected pentamers is across all isolates of the same or other flaviviruses and chikungunya and to identify any potential cross reactions. This process was repeated for both pentamers derived from the envelope proteins and for pentamers derived from NS1. The results are shown in Table 16 and 17 and in
(504) TABLE-US-00015 TABLE 15 Tally of envelope and NS1 searched for cross reacting motifs Downloaded Species of from VIPR Source origin Curated * Dengue 254 polyprotein S America Human 192 envelope type1 and Envelope 95 74NS1 polyprotein and NS1 Dengue 357 polyprotein S America Human 215 envelope type 2 and Envelope 129 107 NS1 polyprotein and NS1 Dengue 309 polyprotein S America Human 208 envelope type 3 and Envelope 203 160 NS1 polyprotein and NS1 Dengue 495 polyprotein S America Human 433 envelope type 4 and Envelope 39 29 NS1 polyprotein and NS1 Yellow 71 polyprotein All All 48 envelope fever and Envelope 82 countries isolates 72 NS1 polyprotein and NS1 WNV 714 polyprotein North and Human 51 envelope and Envelope 82 South 52 NS1 polyprotein and NS1 America Zika 154 polyprotein Americas Human 41 envelope and Envelope 61 French 47 NS1 polyprotein and NS1 Polynesia Chikungunya 46 E2 protein Americas All 30 E2
(505) In addition to providing specific differentiation between antibodies arising from an infection with Zika and the related flaviviruses, it is important to differentiate binding by antibodies to other potentially co-circulating microorganisms. We thus assembled datasets of sequences from several other organisms of interest including Saint Louis encephalitis virus, Japanese encephalitis, hepatitis C, human parvovirus 19, human enteroviruses groups A-J, Ross River virus, Easter equine encephalitis, and malaria. The sequences were curated to ensure complete or near complete sequences and no duplication of isolates. The numbers of curated sequences are shown in the initial rows of Tables 18 and 19. We then interrogated these datasets with the diagnostic set of pentamer peptides to determine if the pentamers are also found in these organisms. A determination was made of presence or absence of the pentamers, but not a determination of whether the peptide of interest in the target protein occurred in a B cell epitope within that protein. In addition, we did not evaluate the timing/life stage of protein transcription for each organism. Hence an overestimate of potential antibody cross reactions was made. Very few cross reactions were found except for a few for dengue with the other flaviviruses. Some potential cross reactivity due to pentamers in common with Plasmodium falciparum was noted. Plasmodium comprises a large, >5300 protein, proteome. The results are shown in Tables 18 and 19 and in
(506) These analyses were subsequently extended to include Usutu virus as shown in Table 33 below
(507) TABLE-US-00016 TABLE 16 Specificity of selected envelope peptides between flaviviruses and chikungunya Column BEPI pos Flanks BEPIpent DEN1 DEN2 DEN3 DEN4 YF WNV ZIKV CHIK DEN1 −1.04 51 ELLKTEVTNPAVLRK SEQ 446 EVTNP SEQ 519 186 0 0 0 0 0 0 0 DEN1 −1.84 168 IATITPQAPTSEIQL SEQ 447 PQAPT SEQ 520 187 0 0 0 0 0 0 0 DEN1 −2.09 227 WTSGASTSQETWNRQ SEQ 448 STSQE SEQ 521 188 0 0 0 0 0 0 0 DEN1 −1.57 272 TGATEIQTSGTTTIF SEQ 449 IQTSG SEQ 522 192 0 3 0 0 0 0 0 DEN1 −1.55 329 VQVKYEGTDAPCKIP SEQ 450 EGTDA SEQ 523 190 0 0 0 0 0 0 0 DEN1 −1.77 344 FLTQDEKGVTQNGRL SEQ 451 EKGVT SEQ 524 185 0 0 0 0 0 0 0 DEN1 −0.99 361 ANPIVTDKEKPVNIE SEQ 452 TDKEK SEQ 525 191 0 0 0 0 0 0 0 DEN1 −1.55 371 PVNIETEPPFGESYI SEQ 453 TEPPF SEQ 526 191 0 0 0 0 0 0 0 DEN2 −1.65 226 WLPGADTQGSNWIQK SEQ 454 DTQGS SEQ527 0 215 0 0 0 0 0 0 DEN2 −1.13 228 PGADTQGSNWIQKET SEQ 455 QGSNW SEQ 528 0 215 0 0 0 0 0 0 DEN2 −1.44 244 VTFKNPHAKKQDVVV SEQ 456 PHAKK SEQ 529 0 215 0 0 0 0 0 0 DEN2 −1.74 328 IRVQYEGDGSPCKIP SEQ 457 EGDGS SEQ 530 0 215 0 0 0 0 0 0 DEN2 −1.27 330 VQYEGDGSPCKIPFE SEQ 458 DGSPC SEQ 531 0 215 0 0 0 0 0 0 DEN2 −1.28 362 PIVTEKDSPVNIEAE SEQ459 KDSPV SEQ 532 0 212 0 0 0 0 0 0 DEN2 −1.53 370 PVNIEAEPPFGDSYI SEQ 460 AEPPF SEQ 533 1 215 208 0 0 0 0 0 DEN2 −1.14 372 NIEAEPPFGDSYIIV SEQ 461 PPFGD SEQ 534 0 215 0 433 48 0 0 0 DEN3 −1.49 154 QHQVGNETQGVTAEI SEQ 462 NETQG SEQ 535 0 0 206 0 0 0 0 0 DEN3 −2.03 224 WTSGATTETPTWNRK SEQ 463 TTETP SEQ 536 0 0 205 0 0 0 0 0 DEN3 −1.63 269 TGATEIQNSGGTSIF SEQ 464 IQNSG SEQ 537 0 0 203 0 0 0 0 0 DEN3 −1.63 311 VLKKEVSETQHGTIL SEQ 465 VSETQ SEQ 538 0 0 208 0 0 0 0 0 DEN3 −1.24 327 KVEYKGEDAPCKIPF SEQ 466 GEDAP SEQ 539 0 0 145 0 0 0 0 0 DEN3 −1.02 327 KVEYKGEDVPCKIPF SEQ 467 GEDVP SEQ 540 0 0 62 0 0 0 0 0 DEN3 −1.31 336 PCKIPFSTEDGQGKA SEQ 468 FSTED SEQ 541 0 0 208 0 0 0 0 0 DEN3 −1.17 360 PVVTKKEEPVNIEAE SEQ 469 KEEPV SEQ 542 0 0 191 0 0 0 0 0 DEN3 −1.57 369 VNIEAEPPFGESNIV SEQ 470 EPPFG SEQ 543 192 215 208 433 0 0 0 0 DEN4 −1.18 48 DFELTKTTAKEVALL SEQ 471 KTTAK SEQ 544 0 0 0 431 0 0 0 0 DEN4 −1.68 155 HAVGNDTSNHGVTAT SEQ 472 DTSNH SEQ 545 0 0 0 430 0 0 0 0 DEN4 −1.59 166 VTATITPRSPSVEVE SEQ 473 TPRSP SEQ 546 0 0 0 433 0 0 0 0 DEN4 −1.62 272 GATEVDSGDGNHMFA SEQ 474 DSGDG SEQ 547 0 0 0 424 0 0 0 0 DEN4 −1.29 315 DKEMAETQHGTTVVK SEQ 475 ETQHG SEQ 548 192 215 208 433 0 0 0 0 DEN4 −1.44 328 VKVKYEGAGAPCKVP SEQ 476 EGAGA SEQ 549 0 0 0 431 0 0 0 0 DEN4 −1.06 358 ISSIPLAENTNSVTN SEQ 477 LAENT SEQ 550 0 0 0 431 0 0 0 0 DEN4 −1.05 362 PLAENTNSVTNIELE SEQ 478 TNSVT SEQ 551 0 0 0 423 0 0 0 0 PAN 313 ETQHG SEQ 552 192 215 208 433 0 0 0 0 DEN PAN 369 EPPFG SEQ 553 192 215 208 433 0 51 0 0 DEN PAN 99 DRGWG SEQ 554 192 215 208 433 48 50 41 0 DEN PAN 185 SPRTG SEQ 555 192 215 207 0 0 0 0 0 DEN PAN 404 TARGA SEQ 556 192 0 207 0 0 0 0 0 DEN PAN 394 GSSIG SEQ 557 192 214 208 433 48 51 0 0 DEN PAN 74 RCPTQ SEQ 558 192 215 208 433 0 0 41 0 DEN PAN 370 PPFGD SEQ 559 0 215 0 433 48 51 41 0 DEN YF −1.04 52 ETVAIDRPAEVRKVC SEQ 479 DRPAE SEQ 560 0 0 0 0 4 0 0 0 YF −1.25 150 HVGAKQENWNTDIKT SEQ 480 QENWN SEQ 561 0 0 0 0 39 0 0 0 YF −1.22 165 LKFDALSGSQEVEFI SEQ 481 LSGSQ SEQ 562 0 0 0 0 48 0 0 0 YF −1.08 218 DLTLPWQSGSGGVWR SEQ 482 WQSGS SEQ 563 0 0 0 0 48 0 0 0 YF −1.50 250 VLALGNQEGSLKTAL SEQ 483 NQEGS SEQ 564 0 0 0 0 44 0 0 0 YF −1.73 267 AMRVTKDTNDNNLYK SEQ 484 KDTND SEQ 565 0 0 0 0 25 0 0 0 YF −2.21 311 FFVKNPTDTGHGTVV SEQ 485 PTDTG SEQ 566 0 0 0 0 47 0 0 0 YF −1.30 358 VNPIASTNDDEVLIE SEQ 486 STNDD SEQ 567 0 0 0 0 46 0 0 0 YF −1.61 356 VTVNPIASTNDDEVL SEQ 487 IASTN SEQ 568 0 0 0 0 48 0 0 0 YF −1.03 369 VLIEVNPPFGDSYII SEQ 488 NPPFG SEQ 569 0 0 0 0 48 0 0 0 WNV −1.52 38 TIMSKDKPTIDVKMM SEQ 489 DKPTI SEQ 1247 0 0 0 0 0 49 0 0 WNV −1.11 148 FVHGPTTVESHGKIG SEQ 490 TTVES SEQ 1248 0 0 0 0 0 51 0 0 WNV −1.21 188 VTVDCEPRSGIDTSA SEQ 491 EPRSG SEQ 1249 0 0 0 433 0 51 0 0 WNV −1.07 253 SVVALGSQEGALHQA SEQ 492 GSQEG SEQ 1250 192 215 208 432 0 51 40 0 WNV −0.81 295 EKLQLKGTTYGVCSK SEQ 493 KGTTY SEQ 1251 0 0 0 0 0 51 0 0 WNV −1.86 312 KFARTPADTGHGTVV SEQ 494 PADTG SEQ 1252 0 0 0 0 0 51 0 0 WNV −1.50 327 LELQYTGTDGPCKVP SEQ 495 TGTDG SEQ 1253 0 0 0 0 0 49 0 0 WNV −0.90 385 YIVVGRGEQQINHHW SEQ 496 RGEQQ SEQ 1254 0 0 0 0 0 51 0 0 ZIKV −0.62 16 DFVEGMSGGTWVDIV SEQ 497 MSGGT SEQ 1255 0 0 0 0 0 0 41 0 ZIKV −1.21 38 TVMAQDKPTVDIELV SEQ 498 DKPTV SEQ 1256 0 0 0 0 0 0 41 0 ZIKV −1.41 86 AYLDKQSDTQYVCKR SEQ 499 QSDTQ SEQ 570 0 0 0 0 0 0 41 0 ZIKV −1.37 128 SKKMTGKSIQPENLE SEQ 500 GKSIQ SEQ 571 0 0 0 0 0 0 41 0 ZIKV −0.84 145 IMLSVHGSQHSGMIV SEQ 501 HGSQH SEQ 572 0 0 0 0 0 0 41 0 ZIKV −2.20 159 VNDTGHETDENRAKV SEQ 502 HETDE SEQ 573 0 0 0 0 0 0 41 0 ZIKV −2.01 172 KVEITPNSPRAEATL SEQ 503 PNSPR SEQ 574 0 0 0 0 0 0 41 0 ZIKV −1.70 175 ITPNSPRAEATLGGF SEQ 504 PRAEA SEQ 575 0 0 0 0 0 0 41 0 ZIKV −1.55 233 AGADTGTPHWNNKEA SEQ 505 GTPHW SEQ 576 0 0 0 0 0 0 41 0 ZIKV −1.47 282 EMDGAKGRLSSGHLK SEQ 506 KGRLS SEQ 577 0 0 0 0 0 0 41 0 ZIKV −1.56 335 EVQYAGTDGPCKVPA SEQ 507 GTDGP SEQ 578 0 0 0 0 0 50 40 0 ZIKV −1.14 365 ITANPVITESTENSK SEQ 508 VITES SEQ 579 0 0 0 0 0 0 41 0 ZIKV −1.51 368 NPVITESTENSKMML SEQ 509 ESTEN SEQ 580 0 0 0 0 0 0 41 0 ZIKV −1.05 370 VTTESTENSKMMLEL SEQ 510 TENSK SEQ 581 0 0 0 0 0 0 41 0 CHIK −1.14 40 ALERIRNEATDGTLK SEQ 511 RNEAT SEQ 582 0 0 0 0 0 0 0 30 CHIK −1.21 144 GREKFHSRPQHGKEL SEQ 512 HSRPQ SEQ 583 0 0 0 0 0 0 0 30 CHIK −1.18 249 VPRNAELGDRKGKIH SEQ 513 EFGDR SEQ 584 0 0 0 0 0 0 0 30 CHIK −1.46 274 RVPKARNPTVTYGKN SEQ 514 RNPTV SEQ 585 0 0 0 0 0 0 0 30 CHIK −1.14 276 PKARNPTVTYGKNQV SEQ 515 PTVTY SEQ 586 0 0 0 0 0 0 0 30 CHIK −1.27 303 SYRNMGEEPNYQEEW SEQ 516 GEEPN SEQ 587 0 0 0 0 0 0 0 30 CHIK −0.70 334 EVTWGNNEPYKYWPQ SEQ 517 NNEPY SEQ 588 0 0 0 0 0 0 0 30 CHIK −1.33 347 PQLSTNGTAHGHPHE SEQ 518 NGTAH SEQ 589 0 0 0 0 0 0 0 30
(508) TABLE-US-00017 TABLE 17 Specificity of selected NS1 peptides between flaviviruses and chikungunya Column Pep # BEPI pos Flanks BepiPent DEN1 DEN2 DEN3 DEN4 WNV YF ZIKV DEN1 1 −1.45 38 YKFQADSPKRLSAAI SEQ 590 DSPKR SEQ 647 74 0 160 0 0 0 0 DEN1 2 −0.75 104 AQGKKMIRPQPMEHK SEQ 591 MIRPQ SEQ 648 70 0 0 0 0 0 0 DEN1 3 −1.84 141 IDGPDTPECPDGQRA SEQ 592 TPECP SEQ 649 73 0 160 0 0 0 0 DEN1 4 −1.27 144 PDTPECPDGQRAWNI SEQ 593 CPDGQ SEQ 650 43 0 0 0 0 0 0 DEN1 5 −0.94 190 MSAAIKDSKAVHADM SEQ 594 KDSKA SEQ 651 74 0 0 0 0 0 0 DEN1 6 −1.17 206 YWIESEKNETWKLAR SEQ 595 EKNET SEQ 652 74 0 0 0 0 0 0 DEN1 7 −1.46 294 DEHCGNRGPSLRTTT SEQ 596 NRGPS SEQ 653 47 108 0 0 0 0 0 DEN1 8 −0.81 301 GPSLRTTTVTGKIIH SEQ 597 TTTVT SEQ 654 74 0 0 0 0 0 0 DEN2 1 −1.50 39 KFQPESPSKLASAIQ SEQ 598 SPSKL SEQ 655 0 107 0 0 0 0 0 DEN2 2 −2.00 105 AGKRSLRPQPTELKY SEQ 599 LRPQP SEQ 656 0 105 0 0 0 0 0 DEN2 3 −1.15 126 KAKMLSTESHNQTFL SEQ 600 STESH SEQ 657 0 97 0 0 0 0 0 DEN2 4 −1.43 142 DGPETAECPNTNRAW SEQ 601 AECPN SEQ 658 0 106 0 0 0 0 0 DEN2 5 −0.83 191 SAAIKDNRAVHADMG SEQ 602 DNRAV SEQ 659 0 106 0 0 0 0 0 DEN2 6 −1.03 248 IIPKNFAGPVSQHNY SEQ 603 FAGPV SEQ 660 0 105 0 0 0 0 0 DEN2 7 −1.02 262 YRPGYHTQTAGPWHL SEQ 604 HTQTA SEQ 661 0 105 159 0 0 0 0 DEN2 8 −1.37 291 VVVTEDCGNRGPSLR SEQ 605 DCGNR SEQ 662 0 106 0 0 0 0 0 DEN3 1 −1.40 37 QYKFQADSPKRLATA SEQ 606 ADSPK SEQ 663 74 0 160 0 0 0 0 DEN3 2 −1.33 103 LKQGKRTLTPQPMEL SEQ 607 RTLTP SEQ 664 0 0 158 0 0 0 0 DEN3 3 −1.80 140 IIDGPNTPECPSASR SEQ 608 NTPEC SEQ 665 1 0 157 0 0 0 0 DEN3 4 −0.90 190 MSAAVKDERAVHADM SEQ 609 KDERA SEQ 666 0 0 159 0 0 0 0 DEN3 5 −1.32 207 WIESQKNGSWKLEKA SEQ 610 KNGSW SEQ 667 0 0 160 0 0 0 0 DEN3 6 −1.11 257 ISQHNHRPGYHTQTA SEQ 611 HRPGY SEQ 668 0 0 141 0 0 0 0 DEN3 7 −0.86 290 TVVITENCGTRGPSL SEQ 612 ENCGT SEQ 669 0 0 160 0 0 0 0 DEN3 8 −0.86 301 GPSLRTTTVSGKLIH SEQ 613 TTTVS SEQ 670 0 0 160 0 0 0 0 DEN4 1 −1.18 39 KFQPESPARLASAIL SEQ 614 SPARL SEQ 671 0 0 0 29 0 0 0 DEN4 2 −1.63 104 TKGKRALTPPVSDLK SEQ 615 ALTPP SEQ 672 0 0 0 26 0 0 0 DEN4 3 −1.07 125 GKAKIFTPEARNSTF SEQ 616 FTPEA SEQ 673 0 0 0 28 0 0 0 DEN4 4 −1.81 140 LIDGPDTSECPNERR SEQ 617 DTSEC SEQ 674 0 0 0 29 0 0 0 DEN4 5 −1.25 207 WIESSKNQTWQIEKA SEQ 618 KNQTW SEQ 675 0 0 0 29 0 0 0 DEN4 6 −1.20 248 LIPKSYAGPFSQHNY SEQ 619 YAGPF SEQ 676 0 0 0 28 0 0 0 DEN4 7 −1.01 260 HNYRQGYATQTVGPW SEQ 620 GYATQ SEQ 677 0 0 0 29 0 0 0 DEN4 8 −1.19 292 TIQEDCDHRGPSLRT SEQ 621 CDHRG SEQ 678 0 0 0 29 0 0 0 WNV 1 −1.69 38 RYKYYPETPQGLAKI SEQ 622 PETPQ SEQ 679 0 0 0 0 52 0 0 WNV 2 −1.16 102 GMYKSAPKRLTATTE SEQ 623 APKRL SEQ 680 0 0 0 0 51 0 0 WNV 3 −1.43 144 GPETKECPTQNRAWN SEQ 624 ECPTQ SEQ 681 0 0 0 0 51 0 0 WNV 4 −1.74 177 KVRESNTTECDSKII SEQ 625 NTTEC SEQ 682 0 0 0 0 52 0 0 WNV 5 −1.47 261 HNRRPGYKTQNQGPW SEQ 626 GYKTQ SEQ 683 0 0 0 0 52 0 0 WNV 6 −1.90 266 GYKTQNQGPWDEGRV SEQ 627 NQGPW SEQ 684 0 0 0 0 52 0 0 WNV 7 −1.67 297 SCGHRGPATRTTTES SEQ 628 GPATR SEQ 685 0 0 0 0 52 0 0 WNV 8 −1.54 303 PATRTTTESGKLITD SEQ 629 TTESG SEQ 686 0 0 0 0 51 0 0 YF 1 −1.21 35 LNKYSYYPEDPVKLA SEQ 630 YYPED SEQ 687 0 0 0 0 0 72 0 YF 2 −1.41 140 IIDGKSRKECPFSNR SEQ 631 SRKEC SEQ 688 0 0 0 0 0 72 0 YF 3 −2.21 193 AVNGKKSAHGSPTFW SEQ 632 KSAHG SEQ 689 0 0 0 0 0 72 0 YF 4 −1.12 234 LTHTIGTSVEESEMF SEQ 633 GTSVE SEQ 690 0 0 0 0 0 72 0 YF 5 −1.05 264 PGYKVQTNGPWMQVP SEQ 634 QTNGP SEQ 691 0 0 0 0 0 72 0 YF 6 −2.05 295 GNCDGRGKSTRSTTD SEQ 635 RGKST SEQ 692 0 0 0 0 0 71 0 YF 7 −2.15 301 GKSTRSTTDSGKVIP SEQ 636 STTDS SEQ 693 0 0 0 0 0 72 0 YF 8 −1.15 338 PMEIRPRKTHESHLV SEQ 637 PRKTH SEQ 694 0 0 0 0 0 50 0 ZIKV 1 −1.55 14 VDFSKKETRCGTGVF SEQ 638 KETRC SEQ 695 0 0 0 0 0 0 47 ZIKV 2 −1.62 38 DRYKYHPDSPRRLAA SEQ 639 HPDSP SEQ 696 0 0 0 0 0 0 47 ZIKV 3 −1.06 130 HFVRAAKTNNSFVVD SEQ 640 AKTNN SEQ 697 0 0 0 0 0 0 47 ZIKV 4 −1.23 193 GTAVKGKEAVHSDLG SEQ 641 GKEAV SEQ 698 0 0 0 0 0 0 44 ZIKV 5 −1.23 209 WIESEKNDTWRLKRA SEQ 642 KNDTW SEQ 699 0 0 0 0 0 0 47 ZIKV 6 −1.36 259 LSHHNTREGYRTQMK SEQ 643 TREGY SEQ 700 0 0 0 0 0 0 45 ZIKV 7 −0.86 291 TKVHVEETCGTRGPS SEQ 644 EETCG SEQ 701 0 0 0 0 0 0 47 ZIKV 8 −1.56 303 GPSLRSTTASGRVIE SEQ 645 STTAS SEQ 702 0 0 0 0 0 0 46 ZIKV 9 −1.85 341 MEIRPRKEPESNLVR SEQ 646 RKEPE SEQ 703 0 0 0 0 0 0 46
(509) TABLE-US-00018 TABLE 18 Specificity of selected envelope peptides between flaviviruses and other microorganisms SEQ SEQ Plasmo- ID ID dium fal- Column BEPI pos Flanks NO.: BEPIpent NO.: SLE HepC JAEV Parvo19 Entero RossRiver EEE ciparum Iso- 3 539 11 90 12 4 1 lates pro- 24 539 11 225 990 109 44 5392 teins DEN1 −1.04 51 ELLKTEVTNPAVLRK 446 EVTNP 519 0 0 0 0 0 0 0 0 DEN1 −1.84 168 IATITPQAPTSEIQL 447 PQAPT 520 0 0 0 0 0 0 0 0 DEN1 −2.09 227 WTSGASTSQETWNRQ 448 STSQE 521 0 0 0 0 0 0 0 1 DEN1 −1.57 272 TGATEIQTSGTTTIF 449 IQTSG 522 0 0 0 0 0 0 0 0 DEN1 −1.55 329 VQVKYEGTDAPCKIP 450 EGTDA 523 0 0 0 0 0 0 0 0 DEN1 −1.77 344 FLTQDEKGVTQNGRL 451 EKGVT 524 0 0 0 0 0 0 0 5 DEN1 −0.99 361 ANPIVTDKEKPVNIE 452 TDKEK 525 0 0 0 0 0 0 0 10 DEN1 −1.55 371 PVNIETEPPFGESYI 453 TEPPF 526 0 0 0 0 0 0 0 0 DEN2 −1.65 226 WLPGADTQGSNWIQK 454 DTQGS 527 0 0 0 0 0 0 0 0 DEN2 −1.13 228 PGADTQGSNWIQKET 455 QGSNW 528 0 0 0 0 0 0 0 0 DEN2 −1.44 244 VTFKNPHAKKQDVVV 456 PHAKK 529 0 0 0 0 0 0 0 1 DEN2 −1.74 328 IRVQYEGDGSPCKIP 457 EGDGS 530 0 0 0 0 0 0 0 4 DEN2 −1.27 330 VQYEGDGSPCKIPFE 458 DGSPC 531 0 0 0 0 0 0 0 1 DEN2 −1.28 362 PIVTEKDSPVNIEAE 459 KDSPV 532 0 0 0 0 0 0 0 0 DEN2 −1.53 370 PVNIEAEPPFGDSYI 460 AEPPF 533 0 0 0 0 0 0 0 0 DEN2 −1.14 372 NIEAEPPFGDSYIIN 461 PPFGD 534 0 3 11 0 0 0 0 0 DEN3 −1.49 154 QHQVGNETQGVTAEI 462 NETQG 535 0 0 0 0 0 0 0 0 DEN3 −2.03 224 WTSGATTETPTWNRK 463 TTETP 536 0 0 0 0 0 0 0 2 DEN3 −1.63 269 TGATEIQNSGGTSIF 464 IQNSG 537 0 0 0 0 0 0 0 3 DEN3 −1.63 311 VLKKEVSETQHGTIL 465 VSETQ 538 0 0 0 0 0 0 0 4 DEN3 −1.24 327 KVEYKGEDAPCKIPF 466 GEDAP 539 0 0 0 0 0 0 0 0 DEN3 −1.02 327 KVEYKGEDVPCKIPF 467 GEDVP 540 0 0 0 0 0 0 0 0 DEN3 −1.31 336 PCKIPFSTEDGQGKA 468 FSTED 541 0 0 0 0 0 0 0 1 DEN3 −1.17 360 PVVTKKEEPVNIEAE 469 KEEPV 542 0 0 0 0 0 0 0 3 DEN3 −1.57 369 VNIEAEPPFGESNIV 470 EPPFG 543 24 3 11 0 0 0 0 0 DEN4 −1.18 48 DFELTKTTAKEVALE 471 KTTAK 544 0 0 0 0 0 0 0 1 DEN4 −1.68 155 HAVGNDTSNHGVTAT 472 DTSNH 545 0 0 0 0 0 0 0 2 DEN4 −1.59 166 VTATTTPRSPSVEVE 473 TPRSP 546 0 0 0 0 0 0 0 0 DEN4 −1.62 272 GATEVDSGDGNHMFA 474 DSGDG 547 0 0 0 0 0 0 0 3 DEN4 −1.29 315 DKEMAETQHGTTVVK 475 ETQHG 548 0 0 0 0 0 0 0 0 DEN4 −1.44 328 VKVKYEGAGAPCKVP 476 EGAGA 549 0 0 0 0 0 0 0 1 DEN4 −1.06 358 ISSIPLAENTNSVTN 477 LAENT 550 0 0 0 0 0 0 0 2 DEN4 −1.05 362 PLAENTNSVTNIELE 478 TNSVT 551 0 0 0 4 0 0 0 2 PAN 313 ETQHG 552 0 0 0 0 0 0 0 0 DEN PAN 369 EPPFG 553 24 3 11 0 0 0 0 0 DEN PAN 99 DRGWG 554 24 3 11 0 0 0 0 0 DEN PAN 185 SPRTG 555 0 0 0 0 0 0 0 0 DEN PAN 404 TARGA 556 0 1 0 0 0 0 0 0 DEN PAN 394 GSSIG 557 24 3 0 0 0 0 0 1 DEN PAN 74 RCPTQ 558 0 0 0 0 0 0 0 0 DEN PAN 370 PPFGD 559 24 3 11 0 0 0 0 0 DEN YF −1.04 52 ETVAIDRPAEVRKVC 479 DRPAE 560 0 0 0 0 0 0 0 0 YF −1.25 150 HVGAKQENWNTDIKT 480 QENWN 561 0 0 0 0 0 0 0 0 YF −1.22 165 LKFDALSGSQEVEFI 481 LSGSQ 562 0 0 0 0 0 0 0 2 YF −1.08 218 DLTLPWQSGSGGVWR 482 WQSGS 563 0 0 0 0 68 0 0 0 YF −1.50 250 VLALGNQEGSLKTAL 483 NQEGS 564 0 0 0 0 0 0 0 1 YF −1.73 267 AMRVTKDTNDNNLYK 484 KDTND 565 0 0 0 0 0 0 0 11 YF −2.21 311 FFVKNPTDTGHGTVV 485 PTDTG 566 12 1 0 0 0 0 0 0 YF −1.30 358 VNPIASTNDDEVLIE 486 STNDD 567 0 0 0 0 0 0 0 6 YF −1.61 356 VTVNPIASTNDDEVL 487 IASTN 568 0 0 2 0 12 0 0 3 YF −1.03 369 VLIEVNPPFGDSYII 488 NPPFG 569 0 0 0 0 0 0 0 0 WNV −1.52 38 TIMSKDKPTIDVKMM 489 DKPTI 1247 0 0 0 0 0 0 0 0 WNV −1.11 148 FVHGPTTVESHGKIG 490 TTVES 1248 0 0 0 0 0 0 0 0 WNV −1.21 188 VTVDCEPRSGIDTSA 491 EPRSG 1249 0 0 11 0 0 0 0 0 WNV −1.07 253 SVVALGSQEGALHQA 492 GSQEG 1250 24 3 0 0 0 0 0 0 WNV −0.81 295 EKLQLKGTTYGVCSK 493 KGTTY 1251 24 3 11 0 0 0 0 0 WNV −1.86 312 KFARTPADTGHGTVV 494 PADTG 1252 12 2 11 0 0 0 0 0 WNV −1.50 327 LELQYTGTDGPCKVP 495 TGTDG 1253 0 0 2 0 0 0 0 0 WNV −0.90 385 YIVVGRGEQQINHHW 496 RGEQQ 1254 0 0 0 0 0 0 0 0 ZIKV −0.62 16 DFVEGMSGGTWVDIV 497 MSGGT 1255 0 0 0 0 0 0 0 1 ZIKV −1.21 38 TVMAQDKPTVDIELV 498 DKPTV 1256 0 0 0 0 0 0 0 0 ZIKV −1.41 86 AYLDKQSDTQYVCKR 499 QSDTQ 570 0 0 0 0 0 0 0 0 ZIKV −1.37 128 SKKMTGKSIQPENLE 500 GKSIQ 571 0 0 0 0 0 0 0 5 ZIKV −0.84 145 IMLSVHGSQHSGMIV 501 HGSQH 572 0 0 0 0 0 0 0 0 ZIKV −2.20 159 VNDTGHETDENRAKV 502 HETDE 573 0 0 0 0 0 0 0 3 ZIKV −2.01 172 KVEITPNSPRAEATL 503 PNSPR 574 0 0 0 0 0 0 0 0 ZIKV −1.70 175 ITPNSPRAEATLGGF 504 PRAEA 575 0 0 0 0 0 0 0 0 ZIKV −1.55 233 AGADTGTPHWNNKEA 505 GTPHW 576 0 0 0 0 0 0 0 0 ZIKV −1.47 282 EMDGAKGRLSSGHLK 506 KGRLS 577 0 0 0 0 0 0 0 5 ZIKV −1.56 335 EVQYAGTDGPCKVPA 507 GTDGP 578 0 0 2 0 0 0 0 0 ZIKV −1.14 365 ITANPVITESTENSK 508 VITES 579 0 0 0 0 0 0 0 3 ZIKV −1.51 368 NPVITESTENSKMML 509 ESTEN 580 0 0 0 0 0 0 0 4 ZIKV −1.05 370 VITESTENSKMMLEL 510 TENSK 581 0 0 0 0 0 0 0 4 0 CHIK −1.14 40 ALERIRNEATDGTLK 511 RNEAT 583 0 0 0 0 0 0 0 1 CHIK −1.21 144 GREKFHSRPQHGKEL 512 HSRPQ 584 0 0 0 0 0 0 0 0 CHIK −1.18 249 VPRNAELGDRKGKIH 513 EFGDR 585 0 0 0 0 0 0 0 0 CHIK −1.46 274 RVPKARNPTVTYGKN 514 RNPTV 586 0 0 0 0 0 0 0 0 CHIK −1.14 276 PKARNPTVTYGKNQV 515 PTVTY 587 0 1 0 0 0 0 0 0 CHIK −1.27 303 SYRNMGEEPNYQEEW 516 GEEPN 588 0 0 0 0 0 0 0 0 CHIK −0.70 334 EVTWGNNEPYKYWPQ 517 NNEPY 589 0 0 0 0 0 0 0 3 CHIK −1.33 347 PQLSTNGTAHGHPHE 518 NGTAH 583 0 0 0 0 0 0 0 1
(510) TABLE-US-00019 TABLE 19 Specificity of selected NS1 peptides between flaviviruses and other microorganisms Plasmo- SEQ SEQ dium ID ID fal- Column BEPI pos BepiPent NO.: Flanks NO.: SLE HepC JAEV Parvo19 Entero RossRiver EEE ciparum Iso- 3 539 11 90 12 4 1 lates pro- 24 539 11 225 990 109 44 5392 teins DEN1 −1.45 38 DSPKR 647 YKFQADSPKRLSAAI 590 0 0 0 0 0 0 0 0 DEN1 −0.75 104 MIRPQ 648 AQGKKMIRPQPMEHK 591 0 0 0 0 0 0 0 0 DEN1 −1.84 141 TPECP 649 IDGPDTPECPDGQRA 592 0 0 0 0 0 0 0 0 DEN1 −1.27 144 CPDGQ 650 PDTPECPDGQRAWNI 593 0 0 0 0 0 0 0 0 DEN1 −0.94 190 KDSKA 651 MSAAIKDSKAVHADM 594 0 0 0 0 0 0 0 1 DEN1 −1.17 206 EKNET 652 YWIESEKNETWKLAR 595 0 0 0 0 0 0 0 29 DEN1 −1.46 294 NRGPS 653 DEHCGNRGPSLRTTT 596 0 0 0 0 0 0 0 0 DEN1 −0.81 301 TTTVT 654 GPSLRTTTVTGKIIH 597 0 4 0 0 0 0 0 3 DEN2 −1.50 39 SPSKL 655 KFQPESPSKLASAIQ 598 0 0 0 0 0 0 0 5 DEN2 −2.00 105 LRPQP 656 AGKRSLRPQPTELKY 599 0 0 0 0 0 0 0 0 DEN2 −1.15 126 STESH 657 KAKMLSTESHNQTFL 600 0 0 0 0 0 0 0 1 DEN2 −1.43 142 AECPN 658 DGPETAECPNTNRAW 601 0 0 0 0 0 0 0 0 DEN2 −0.83 191 DNRAV 659 SAAIKDNRAVHADMG 602 0 0 0 0 0 0 0 1 DEN2 −1.03 248 FAGPV 660 IIPKNFAGPVSQHNY 603 0 0 0 0 0 0 0 0 DEN2 −1.02 262 HTQTA 661 YRPGYHTQTAGPWHL 604 0 0 0 0 0 0 0 0 DEN2 −1.37 291 DCGNR 662 VVVTEDCGNRGPSLR 605 0 0 0 0 0 0 0 0 DEN3 −1.40 37 ADSPK 663 QYKFQADSPKRLATA 606 0 0 0 0 0 0 0 0 DEN3 −1.33 103 RTLTP 664 LKQGKRTLTPQPMEL 607 0 0 0 0 0 0 0 1 DEN3 −1.80 140 NTPEC 665 IIDGPNTPECPSASR 608 0 0 0 0 0 0 0 0 DEN3 −0.90 190 KDERA 666 MSAAVKDERAVHADM 609 0 0 0 0 0 0 0 1 DEN3 −1.32 207 KNGSW 667 WIESQKNGSWKLEKA 610 0 0 0 0 0 0 0 0 DEN3 −1.11 257 HRPGY 668 ISQHNHRPGYHTQTA 611 0 0 0 0 0 0 0 0 DEN3 −0.86 290 ENCGT 669 TVVITENCGTRGPSL 612 0 0 0 0 0 0 0 0 DEN3 −0.86 301 TTTVS 670 GPSLRTTTVSGKLIH 613 0 3 0 0 0 0 0 2 DEN4 −1.18 39 SPAHL 671 KFQPESPARLASAIL 614 0 0 0 0 0 0 0 0 DEN4 −1.63 104 ALTPP 672 TKGKRALTPPVSDLK 615 0 15 0 0 1 0 0 1 DEN4 −1.07 125 FTPEA 673 GKAKIFTPEARNSTF 616 0 0 0 0 0 0 0 0 DEN4 −1.81 140 DTSEC 674 LIDGPDTSECPNERR 617 0 0 0 0 0 0 0 0 DEN4 −1.25 207 KNQTW 675 WIESSKNQTWQIEKA 618 0 0 0 0 0 0 0 0 DEN4 −1.20 248 YAGPF 676 LIPKSYAGPFSQHNY 619 0 0 0 0 0 0 0 0 DEN4 −1.01 260 GYATQ 677 HNYRQGYATQTVGPW 620 0 0 0 0 0 0 0 0 DEN4 −1.19 292 CDHRG 678 TIQEDCDHRGPSLRT 621 0 0 0 0 0 0 0 0 WNV −1.69 38 PETPQ 679 RYKYYPETPQGLAKI 622 0 0 0 0 0 0 0 1 WNV −1.16 102 APKRL 680 GMYKSAPKRLTATTE 623 2 0 9 0 0 0 0 1 WNV −1.43 144 ECPTQ 681 GPETKECPTQNRAWN 624 0 0 0 0 0 0 0 0 WNV −1.74 177 NTTEC 682 KVRESNTTECDSKII 625 10 3 0 0 0 0 0 1 WNV −1.47 261 GYKTQ 683 HNRRPGYKTQNQGPW 626 0 0 11 0 0 0 0 0 WNV −1.90 266 NQGPW 684 GYKTQNQGPWDEGRV 627 0 0 11 0 0 0 0 0 WNV −1.67 297 GPATR 685 SCGHRGPATRTTTES 628 0 0 0 0 0 0 0 0 WNV −1.54 303 TTESG 686 PATRTTTESGKLITD 629 0 0 0 0 0 0 0 1 YF −1.21 35 YYPED 687 LNKYSYYPEDPVKLA 630 0 0 0 0 0 0 0 0 YF −1.41 140 SRKEC 688 IIDGKSRKECPFSNR 631 0 0 0 0 0 0 0 2 YF −2.21 193 KSAHG 689 AVNGKKSAHGSPTFW 632 0 0 0 0 0 0 0 2 YF −1.12 234 GTSVE 690 LTHTIGTSVEESEMF 633 0 0 0 0 0 0 0 2 YF −1.05 264 QTNGP 691 PGYKVQTNGPWMQVP 634 0 0 0 0 0 0 0 2 YF −2.05 295 RGKST 692 GNCDGRGKSTRSTTD 635 0 0 0 0 0 0 0 2 YF −2.15 301 STTDS 693 GKSTRSTTDSGKVIP 636 0 0 0 0 0 0 0 5 YF −1.15 338 PRKTH 694 PMEIRPRKTHESHLV 637 0 0 0 0 0 0 0 1 ZIKV −1.55 14 KETRC 695 VDFSKKETRCGTGVF 638 0 0 0 0 0 0 0 0 ZIKV −1.62 38 HPDSP 696 DRYKYHPDSPRRLAA 639 0 0 0 0 0 0 0 0 ZIKV −1.06 130 AKTNN 697 HFVRAAKTNNSFVVD 640 0 0 0 0 0 0 0 0 ZIKV −1.23 193 GKEAV 698 GTAVKGKEAVHSDLG 641 0 0 0 0 0 0 0 1 ZIKV −1.23 209 KNDTW 699 WIESEKNDTWRLKRA 642 0 0 0 0 0 0 0 1 ZIKV −1.36 259 TREGY 700 LSHHNTREGYRTQMK 643 0 0 0 0 0 0 0 0 ZIKV −0.86 291 EETCG 701 TKVHVEETCGTRGPS 644 0 0 0 0 0 0 0 1 ZIKV −1.56 303 STTAS 702 GPSLRSTTASGRVIE 645 0 1 0 0 0 0 0 0 ZIKV −1.85 341 RKEPE 703 MEIRPRKEPESNLVR 646 0 0 0 0 0 0 0 0
(511) The diagnostic sets of B cell epitope peptides may be deployed, preferably but not necessarily as a 15mer, singly as arrays or as a pool of peptides to identify antibodies arising from infection by Zika or the other viruses represented. Many possible delivery formats are possible to attach peptides to a substrate including, but not limited to, directly, via biotin, via a histag, via am immunoglobulin Fc or other fusion partner. Said substrate and antigens can then be used in several different diagnostic immunoassay formats, including but not limited to ELISA, or on microbeads, or in solution. The presence of antibody specifically binding to the diagnostic peptide may be detected by a secondary antibody. A secondary antibody may be selected to detect bound IgG or IgM from human or from other potentially infected species of interest which may be infected and which may serve as reservoir species.
(512) In an alternative approach to a diagnostic kit synthetic proteins from Zika envelope are prepared in which epitopes that are cross reactive with other flaviviruses are removed. Exemplars of these are shown in SEQS 393, 395 and 397. Said synthetic polypeptides may be the full soluble Zika envelope sequence. In preferred embodiments, however, polypeptides comprising only Domain I or Domain II or Domain III of the Zika envelope protein are synthesized. Said polypeptides may be fused to an immunoglobulin Fc molecule. In some instances, they are expressed as a Fc fusion in a host cell and subsequently cleaved to facilitate inclusion in the diagnostic kit.
Example 11: Diagnostic Peptide Cross Reactions
(513) By applying immunoinformatic methods previously described (PCT US2011/029192, PCT US2012/055038, and US2014/014523, U.S. Patent Application No. 62/306,262, each of which is incorporated herein by reference) we identified high probability B cell epitopes in Zika virus proteins and in the corresponding proteins of dengue serotypes, yellow fever and WNV. This resulted in a set of 8-14 peptides of interest selected for further examination for each virus. We then searched the proteins of various other pathogens likely to be co-endemic with these flaviviruses to determine if the corresponding pentamers were present. In the case of Plasmodium we searched the entire proteome of P. falciparum strain 3D7. The patterns of pentamer identity are shown in Tables 18 and 19. While a few peptides are in common with other flaviviruses, a far greater occurrence of cross reactions occurs with Plasmodium and the selected peptides in flaviruses of interest. Also noted is that Plasmodium does not have the peptides identified as “pan-flavi” or common to all the flaviviruses of interest. While this scan was performed only based on the selected set of 8-14 peptides it provided an indicator of probable cross reactivity and also of the absence of the pan flavi peptides in malaria. Thus diagnostics which depend on pan-flavi epitopes will fail to differentiate between the flaviviruses but will not result in false positives due to prior malaria infections.
Example 12. Mapping of Epitopes in Envelope and NS1 Proteins and Malaria Proteomes
(514) We conducted a complete epitope mapping of the proteome of P. falciparum strain 3D7 and P. vivax Sal1, each comprising in excess of 5000 proteins. Parameters mapped included B cell epitopes, MHC binding, cathepsin cleavage, T cell exposed motif usage and topology. A comparison of B cell epitope probability to every B cell epitope probability in the envelope and NS1 proteins of Zika, Den1 Den2 Den3 Den 4, YF and WNV was done.
Example 13: Tabulating B Cell Epitope Matches
(515) We selected Zika peptides which have a B cell probability more than one standard deviation greater than the mean, comprising the top 15.86% in the protein. We then identified those which corresponded to peptides with the same probability of being a B cell epitope in a protein of P. falciparum or P. vivax. Table 20 shows the results for Zika Envelope and Table 21 shows the results for Zika NS1. As the Asian American Zika virus has exhibited a high level of conservation these tables identify malaria protein epitopes which can provide cross protective antibodies. Selection of vaccine components should then take into consideration the life stage in which the malaria proteins identified are expressed, their surface exposure and transcription level to arrive at a final vaccine design.
(516) Tables 22 and 23 provide corresponding in formation for other flaviviruses of interest based on a representative South American strain. Because minor strain variations may occur between isolates of each of these viruses the tables are considered indicative of the process of selecting matching Plasmodium epitopes but geographical differences may need to be factored into vaccine design.
(517) It should be noted that in all following tables probability of B cell epitope binding is indicated as an inverted value; the most negative numbers indicate highest probability of binding.
(518) TABLE-US-00020 TABLE 20 P_faclciparum P_vivax BEPI BEPI BEPI BEPI (standard (standard pentamer (virus) uTOPE) gi: curation - P. falciparum uTOPE) SEQ 705 ASDSR −1.01 −1.57 SEQ 706 SRCPT −1.80 −1.03 SEQ 707 CPTQG −1.64 −1.05 SEQ 708 PTQGE −1.38 −2.04 SEQ 709 TQGEA −1.04 −1.74 PF3D7_1240400_erythrocyte −1.33 membrane protein 1 SEQ 710 DKQSD −1.21 −1.33 PF3D7_0930400.2_conserved −1.29 Plasmodium protein SEQ 711 QSDTQ −1.41 −1.68 SEQ 712 KMTGK −1.12 −1.49 PF3D7_1408700_conserved 0.03 Plasmodium protein SEQ 713 NDTGH −1.04 −1.19 SEQ 714 ETDEN −2.06 −1.07 PF3D7_1115400_cysteine −0.65 proteinase falcipain 3 (FP3 SEQ 715 TDENR −1.77 −1.07 PF3D7_1425600_zinc finger −1.69 protein SEQ 716 NSPRA −1.98 −1.05 SEQ 717 SPRAE −1.89 −1.58 SEQ 718 RAEAT −1.31 −0.91 PF3D7_1430700_NADP-specific −1.15 glutamate dehydrogenase (GDH2) SEQ 719 AGADT −1.18 −1.42 SEQ 720 GADTG −1.52 −0.38 PF3D7_0931700_PIH1 domain- −1.04 containing protein SEQ 723 ADTGT −1.76 −1.67 PF3D7_1255200_erythrocyte −1.06 membrane protein 1 SEQ 724 DIGTP −1.90 −1.30 SEQ 725 GAKGR −1.32 PF3D7_1125500_small nuclear −1.71 ribonucleoprotein Sm D1 SEQ 726 KGRES −1.47 −1.20 PF3D7_0818900_heat shock −0.56 protein 70 (HSP70) SEQ 727 AGTDG −1.53 −1.69 PF3D7_1035200_S-antigen −2.06 SEQ 728 GTDGP −1.56 −1.80 SEQ 729 TDGPC −1.45 −1.45 PF3D7_1300300_erythrocyte membrane protein 1 SEQ 730 DGPCK −1.19 −1.16 PF3D7_0712900_erythrocyte membrane protein 1 SEQ 731 ITEST −1.43 −0.25 PF3D7_0104000_thrombospondin- −1.05 related sporozoite protein (TRSP) SEQ 732 TESTE −1.62 −1.93 PF3D7_1122600_conserved −0.51 Plasmodium protein SEQ 733 ESTEN −1.51 −0.98 PF3D7_0205300_conserved −1.23 Plasmodium protein SEQ 734 STENS −1.30 −1.03 PF3D7_1418100_liver specific −1.63 protein 1 SEQ 735 TENSK −1.05 −1.27 PF3D7_1418100_liver specific protein 1 SEQ 736 GSTIG −1.10 −0.40 PF3D7_1205500_zinc finger −1.04 protein SEQ 737 NTKNG −1.29 −1.57 PF3D7_0904900_copper- −1.11 transporting ATPase (CuTP) SEQ 738 TKNGS −1.42 −0.88 PE3D7_1000100_erythrocyte −1.87 membrane protein 1 gi: curation (P_vivax) pos Virus SEQ 705 PVX_085120_protein kinase 70 Zika SEQ 706 PVX_093705_variable surface protein 73 Zika Vir18 SEQ 707 PVX_095125_hypothetical protein 75 Zika SEQ 708 PVX_084330_hypothetical protein 76 Zika SEQ 709 PVX_018660_unspecified 77 Zika SEQ 710 PVX087865_hypothetical protein 84 Zika SEQ 711 PVX_122920_hypothetical protein 86 Zika SEQ 712 PVX_122905_hypothetical protein 125 Zika SEQ 713 PVX_054190_unspecified 155 Zika SEQ 714 PVX_10072_hypothetical protein 160 Zika SEQ 715 PVX_085020_autophagy protein 5 161 Zika SEQ 716 PVX_116560_RNA-binding protein 173 Zika SEQ 717 PVX116690_hypothetical protein 174 Zika SEQ 718 PVX_111070_S-adenosylmethionine 176 Zika decarboxylase-ornithine decarboxylase SEQ 719 PVX_089985_hypothetical protein 228 Zika SEQ 720 PVX_118475_stromal-processing 229 Zika peptidase SEQ 723 PVX_113550_hypothetical protein 230 Zika SEQ 724 PVX_113550_hypothetical protein 231 Zika SEQ 725 PVX_081345_secreted ookinete protein 280 Zika SEQ 726 PVX_003880_acyl_carrier protein 282 Zika SEQ 727 PVX_117880_rhoptry neck protein 2 334 Zika SEQ 728 PVX_001810_hypothetical protein 335 Zika SEQ 729 336 Zika SEQ 730 337 Zika SEQ 731 PVX_122795_hypothetical protein 366 Zika SEQ 732 PVX_101210_hypothetical protein 367 Zika SEQ 733 PVX_115350_hypothetical protein 368 Zika SEQ 734 PVX_122470_eukaryotic translation 369 Zika initation factor 4 gamma SEQ 735 370 Zika SEQ 736 PVX_082915_ABC transporter B family 405 Zika member 5 SEQ 737 PVX_082580_20 kDa chaperonin 479 Zika SEQ 738 PVX_080580_hypothetical protein 480 Zika
(519) TABLE-US-00021 TABLE 21 P_faclciparum P_vivax BEPI BEPI BEPI BEPI (standard (standard penta (virus) uTOPE) gi: curation uTOPE) gi: curation (P_vivax) pos Virus SEQ 739 SKKET −1.13 −1.61 PF3D7_1401200_Plasmodium −1.36 PVX_084440_hypothetical protein 12 Zika exported protein SEQ 740 KKETR −1.43 −1.07 PF3D7_1138400_guanylyl cyclase 0.23 PVX_086240_serine_threonine protein 13 Zika (GCalpha) phosphatase CPPED1 SEQ 741 YHPDS −1.43 −1.46 PF3D7_0823800_DnaJ protein −0.78 PVX091085_hypothetical protein 37 Zika SEQ 742 HPDSP −1.62 −1.59 PVX_091136_hypothetical protein 38 Zika SEQ 743 DSPRR −1.26 −1.37 PVX_087955_O1 40 Zika SEQ 744 AKTNN −1.06 −1.23 PVX_100825_hypothelical protein 130 Zika SEQ 745 KTNNS −1.09 −2.07 PF3D7_0202000_knob-associated −1.44 PVX_000975_liver specific protein 2 131 Zika histidine-rich protein (KAHRP) SEQ 746 KGKEA −1.13 −1.62 PF3D7_0221700_Plasmodium −0.93 PVX_094855_NLI interacting factor-like 192 Zika exported protein phosphatase SEQ 747 SEKND −1.07 −1.62 PF3D7_0613900_myosin E −1.47 PVX_091434_rhoptry neck protein 4 207 Zika (RON4) SEQ 748 EKNDT −1.23 −1.00 PF3D7_1428400_WD and −1.55 PVX_115415_hypothetical protein 208 Zika tetratricopeptide repeats protein 1 SEQ 749 NTREG −1.22 −1.25 PF3D7_1332000_syntaxin −0.83 PVX_082530_syntaxin 5 258 Zika SEQ 750 GTRGP −1.63 −1.80 PVX_092925_CCAAT-box DNA binding 295 Zika protein subunit B SEQ 751 TRGPS −1.55 −1.36 PVX_132260_unspecified 296 Zika SEQ 752 LRSTT −1.63 −1.14 PYX_120335_unspecified 301 Zika SEQ 753 STTAS −1.56 −1.71 PVX_113460_DNA repair protein 303 Zika RAD50 SEQ 754 TTASG −1.45 −1.73 PF3D7_0712900_erythrocyte −1.87 PVX_113460_DNA repair protein 304 Zika membrane protein 1 RAD50 SEQ 755 TASGR −1.25 −1.00 PVX_090110_transcription factor with 305 Zika AP2 domain(s) SEQ 756 RPRKE −1.59 −1.10 PF3D7_0935400_gametocyte −1.53 PVX_094890_hypothetical protein 339 Zika development protein 1 (GDV1) SEQ 757 KEPES −1.73 −1.46 PF3D7_1030100_pre-mRNA- −0.06 PVX_099540_glutamine synthelase 342 Zika splicing factor ATP-dependent RNA helicase PRP22 SEQ 758 EPESN −1.52 −1.10 PF3D7_1001900_Plasmodium −0.25 PVX_123682_heterochromatin protein 1 343 Zika exported protein (hyp16)
(520) TABLE-US-00022 TABLE 22 P_faclciparum P. vivax Pos in BEPI BEPI virus BEPI BEPI (standard (standard Virus env penta (virus) uTOPE) gi: curation uTOPE) gi: curation (P_vivax) WNV SEQ 759 37 KDKPT −1.38 −0.41 PF3D7_131080_conserved Plasmodium −1.97 PVX_081215_hypothetical protein protein WNV SEQ 760 83 NEKRA −1.55 −0.17 PF3D7_0526500_conserved Plasmodium −1.29 PVX_084330_hypothetical protein protein WNV SEQ 761 84 EKRAD −1.44 −1.04 PF3D7_0703900_conserved Plasmodium −0.72 PVX_082850_hypothetical protein membrane protein WNV SEQ 762 85 KRADP −1.25 −0.86 PF3D7_1039000_serine_threonine_protein -1.35 PVX_085070_rRNA (adenosine-2′-O-)- kinase methyltransferase WNV SEQ 763 148 TTVES −1.11 −1.12 PVX_241295_unspecified WNV SEQ 764 154 GKIGA −1.08 −0.33 PF3D7_0600100_erythrocyte membrane −1.04 PVX_116760_hypothetical protein protein 1 (PfEMP1) WNV SEQ 765 166 ITPSA −1.22 −0.26 PF3D7_1421200_40S ribosomal protein S25 −1.21 PVX_097815_trafficking protein particle (RPS25) complex subunit 8 WNV SEQ 766 167 TPSAP −148 −1.93 PVX_085020_autophagy protein 5 WNV SEQ 767 168 PSAPS −1.60 −2.30 PF3D7_0800300_erythrocyte membrane −2.12 PVX_110965_hypothetical protein protein 1 WNV SEQ 768 188 EPRSG −1.21 −1.39 PVX_116670_hypothetical protein WNV SEQ 769 223 SSAGS −1.23 −0.90 PF3D7_0401000_rifin (RIF) −1.33 PVX_118345_protein transport protein SEC7 WNV SEQ 770 224 SAGST −1.38 −2.03 PVX_080355_transcrition factor with AP2 domain(s) WNV SEQ 771 225 AGSTT −1.48 −1.78 PF3D7_0202000_knob-associated histidine- −1.11 PVX_089055_E3 ubiquitin-protein rich protein (KAHRP) ligase WNV SEQ 772 253 GSQEG −1.07 −1.78 PVX_080320_ATP-dependent RNA helicase DDX23 WNV SEQ 773 254 SQEGA −1.02 −1.60 PF3D7_0212300_peptide chain release factor −1.90 PVX_101355_protein phosphatase subunit 1 PPM4 WNV SEQ 774 309 ARTPA −1 22 −1.04 PVX_089895_glutamyl-tRNA(Gln) amidotransferase subunit A WNV SEQ 775 312 PADTG −1.86 −1.90 PVX_092395_hypothetical protein WNV SEQ 776 314 DTGHG −1.38 −1.31 PVX_054190_unspecified WNV SEQ 777 328 GTDGP −1.44 −1.80 PVX_001810_hypothetical protein WNV SEQ 778 329 TDGPC −1.18 −1.45 PF3D7_1300300_erythrocyte membrane protein 1 WNV SEQ 779 396 KSGSS −1.27 −2.30 PF3D7_1200600_erythrocyte membrane −1.72 PVX_116765_vanant-silencing SET protein 1 protein WNV SEQ 780 397 SGSSI −1.43 −0.22 PF3D7_1308900_mRNA-decapping enzyme 2 −1.35 PVX_013625_unspecified WNV SEQ 781 398 GSSIG −1.30 −0.38 PF3D7_1431600_ATP-specific succinyl- −1.25 PVX_123970_ataxin-3 CoA synthetase beta subunit DEN3 SEQ 782 37 KNKPT −1.20 −1.63 PF3D7_201900_erythrocyte membrane −1.31 PVX_099980_merozoite surface protein protein 3 (EMP3) 1 (MSP1) DEN3 SEQ 783 39 KPTLD −1.01 −1.13 PF3D7_1465100_conserved Plasmodium −0.44 PVX_081830_Plasmodium exported protein protein DEN3 SEQ 784 48 KTEAT −1.16 −1.45 PF3D7_1342600_myosin A (MyoA) −1.69 PVX_097680_merozoite surface protein 3 (MSP3_3) DEN3 SEQ 785 73 SRCPT −1.62 −1.03 PVX_093705_variable surface protein Virl8 DEN3 SEQ 786 75 CPTQG −1.52 −1.05 PVX_095125_hypothetical protein DEN3 SEQ 787 76 PTQGE −1.19 −2.04 PVX_084330_hypothetical protein DEN3 SEQ 788 84 PEEQD −1.23 −1.40 PF3D7_1207800_conserved Plasmodium protein DEN3 SEQ 789 85 WWQDQ −1.18 −2.02 PF3D7_1448500_conserved Plasmodium −1.84 PVX_088840_Phist protein Pf-fam-b) protein DEN3 SEQ 790 151 QVGNE −1.40 −1.21 PF3D7_1255200_erythrocyte membrane −0.91 PVX_098950_hypothetical protein protein 1 DEN3 SEQ 791 154 NETQG −1.49 −1.56 PVX_096115_protein kinase DEN3 SEQ 792 165 PQAST −1.71 −2.09 PF3D7_1115800_conserved Plasmodium protein DEN3 SEQ 793 166 QASTT −1.50 −1.11 PF3D7_1149000_antigen 332 −0.78 PVX_117920_hypothetical protein DEN3 SEQ 794 167 ASTTE −1.26 −1.85 PF3D7_0202000_knob-associated histidine- rich protein (KAHRP) DEN3 SEQ 795 220 TSGAT −1.21 −0.72 PF3D7_0727200_cysteine desulfurase −1.64 PVX_099415_GNS1_SUR4 domain containing protein DEN3 SEQ 796 221 SGATT −1.46 −2.07 PF3D7_0712900_erythrocyte membrane −1.86 PVX_085725_hypothetical protein protein 1 DEN3 SEQ 797 222 GATTE −1.70 −1.63 PVX_117880_rhoptry neck protein 2 DEN3 SEQ 798 223 ATTET −1.90 −1.69 PF3D7_1100200_erythrocyte membrane −1.39 PVX_002835_T-complex protein 1 protein 1 subunit theta DEN3 SEQ 799 224 TTETP −2.03 −1.27 PF3D7_1200600_erythrocyte membrane −2.00 PVX_093680_Phist protein (Pf-fam-b) protein DEN3 SEQ 800 225 TETPT −1.93 −1.22 PVX_097800_hypothetical protein DEN3 SEQ 801 270 QNSGG −1.58 −2.03 PVX_091775_leucine-rich repeat protein (LRR11) DEN3 SEQ 802 271 NSGGT −1.44 −1.60 PF3D7_0833500_erythrocyte membrane −1.94 PVX_091660_hypothetical protein protein 1 DEN3 SEQ 803 272 SGGTS −1.20 −2.26 PF3D7_0712300_erythrocyte membrane −1.74 PVX_089395_perforin-like protein 4 protein 1 (PLP4) DEN3 SEQ 804 311 VSETQ −1.63 −1.39 PF3D7_1332200_conserved Plasmodium −0.31 PVX_090860_CPW-WPC family protein protein. DEN3 SEQ 805 312 SETQH −1.44 −1.24 PVX_114800_hypothetical protein DEN3 SEQ 806 325 YKGED −1.39 −1.26 PF3D7_0621400_Pf77 protein (ALV7) −0.84 PVX_094800_hypothetical protein DEN3 SEQ 807 326 KGEDA −1.42 −1.38 PVX_089010_translation initiation factor IF-2 DEN3 SEQ 808 327 GEDAP −1.24 −1.33 PVX_077695_unspecified DEN3 SEQ 809 337 STEDG −1.59 −1.74 PVX_092070_parasitophorous vacuolar protein 1 DEN3 SEQ 810 3.38 TEDGQ −1.80 −1.82 PF3D7_1403100_conserved Plasmodium protein DEN3 SEQ 811 339 EDGQG −1.86 −2.17 PF3D7_1206200_eukaryotic translation −1.18 PVX_089295_ATP-dependent RNA initiation factor 3 subunit C helicase prh1 DEN3 SEQ 812 340 DGQGK −1.94 −2.02 PF3D7_1206200_eukaryotic translation −1.07 PVX_096180_hypothetical protein initiation factor 3 subunit C DEN3 SEQ 813 342 QGKAH −1.80 −1.07 PVX_092415_hypothetical protein DEN3 SEQ 814 358 TKKEE −1.13 −1.82 PF3D7_1206200_eukaryotic translation −0.43 PVX_092070_parasitophorous vacuolar initiation factor 3 subunit C protein 1 DEN3 SEQ 815 359 KKEEP −1.13 −0.79 PF3D7_1233600_asparagine and aspartate −1.74 PVX_118345_protein transport protein rich protein 1 (AARP1) SEC7 DEN3 SEQ 816 367 EAEPP −1.24 −1.29 PVX_122665_hypothetical protein DEN3 SEQ 817 369 EPPFG −1.57 −1.11 PVX_118340_serine_threonine protein kinase DEN3 SEQ 818 392 KKGSS −1.01 −0.56 PF3D7_1469600_biotin catboxylase subunit −1.74 PVX_112720_unspecified of acetyl CoA carboxylase DEN3 SEQ 819 394 GSSIG −1.03 −0.38 PF3D7_1431600_ATP-specific succinyl- −1.25 PVX_123970_ataxin-3 CoA synthetase beta subunit DEN3 SEQ 820 468 NSKNT −1.18 −0.54 PF3D7_1467200_WD repeat-containing −1.15 PVX_114965_hypothetical protein protein 79 DEN3 SEQ 821 469 SKNTS −1.31 −1.59 PF3D7_0504700_centrosomal protein PVX_111430_cytochrome c oxidase CEP120 copper chaperone DEN3 SEQ 822 470 KNTSM −1.25 −1.13 PF3D7_1035800_probable protein −0.18 PVX_100940_hypothetical protein DEN4 SEQ 823 37 QGKPT −1.16 −1.35 PVX_000975_liver specific protein 2 DEN4 SEQ 824 47 TKTTA −1.10 −1.11 PF3D7_1040600_rifin (RIF) −1.64 PVX_091755_calcium-dependent protein kinase 6 DEN4 SEQ 825 48 KTTAK −1.18 −0.82 PF3D7_1255200_erythrocyte membrane −1.67 PVX_112685 unspecified protein 1 DEN4 SEQ 826 49 TTAKE −1.07 −0.22 PF3D7_1150000_rifin (RIF) −1.14 PVX_122645_pre-mRNA-processing factor 40 DEN4 SEQ 827 75 CPTQG −1.55 −1.05 PVX_095125_hypothetical protein DEN4 SEQ 828 76 PTQGE −1.49 −2.04 PVX_084330_hypothetical protein DEN4 SEQ 829 77 TQGEP −1.28 −1.17 PVX_099635_conserved Plasmodium protein DEN4 SEQ 830 83 LKEEQ −1.03 −0.65 PF3D7_0504700_centrosomal protein −1.06 PVX_003885_ribosome-recycling factor CEP120 DEN4 SEQ 831 84 KEEQD −1.08 −0.63 PF3D7_0618500_malate dehydrogenase −1.75 PVX_079865_Hsc70-interacting protein (MDH) DEN4 SEQ 832 85 EEQDQ −1.12 −2.02 PF3D7_1448500_conserved Plasmodium −1.84 PVX_088840_Phist protein (Pf-fam-b) protein DEN4 SEQ 833 147 GDTHA −1.06 −0.87 PF3D7_0930800_conserved Plasmodium −1.21 PVX_087780_phosphopantetheine membrane protein adenylyltransferase DEN4 SEQ 834 153 GNDTS −1.54 −1.41 PF3D7_0731500_erythrocyte binding −1.67 PVX_095475_circumsporozoite- and antigen-175 (EBA175) TRAP-related protein DEN4 SEQ 835 166 TPRSP −1.59 −1.25 PVX_113574_hypothetical protein DEN4 SEQ 836 167 PRSPS −1.43 −1.14 PVX_000815_sporozoite invasion- associated protein 1 DEN4 SEQ 837 223 AGADT −1.32 −1.42 PVX_089985_hypothetical protein DEN4 SEQ 838 256 SQEGA −1.04 −1.60 PF3D7_0212300_peptide chain release factor −1.90 PVX101355_protein phosphatase subunit 1 PPM4 DEN4 SEQ 839 266 AGATE −1.03 −1.29 PF3D7_0425800_erythrocyte membrane −1.15 PVX_081425_2-C-methyl-D-erythritol protein 1 4-phosphate cytidyly transferase DEN4 SEQ 840 267 GATEV −1.32 −1.19 PF3D7_0425800_erythrocyte membrane −1.00 PVX_111535_hypothetical protein protein 1 DEN4 SEQ 841 271 VDSGD −1.78 0.05 PF3D7_0905700.1_autophagy-related protein 3 −1.29 PVX_081575_hypothetical protein DEN4 SEQ 842 272 DSGDG −1.62 −1.73 PE3D7_1200600_erythrocyte membrane −1.47 PVX_100910_transcription factor with protein 1 AP2 domain(s) DEN4 SEQ 843 273 SGDGN −1.34 −1.84 PE3D7_0712000_erythrocyte membrane −0.82 PVX_017140_unspecified protein 1 DEN4 SEQ 844 274 GDGNH −1.01 −1.22 PVX_051690_unspecified DEN4 SEQ 845 314 AETQH −1.29 −1.21 PVX_115135_hypothetical protein DEN4 SEQ 846 328 EGAGA −1.44 −1.69 PE3D7_0425800_erythrocyte membrane −1.48 PVX_073690_unspecified protein 1 DEN4 SEQ 847 359 AENTN −1.18 −1.30 PE3D7_0708700_Cg8 protein −1.34 PVX_090990_hypothetical protein DEN4 SEQ 848 361 NTNSV −1.19 −0.78 PE3D7_0802100_transcription factor with −1.20 PVX_086285_hypothetical protein AP2 domain(s) (ApiAP2) DEN4 SEQ 849 371 EPPFG −1.01 −1.11 PVX_118340_serine_threonine protein kinase DEN4 SEQ 850 470 NSRNT −1.57 −1.06 PE3D7_0110800_transcription initiation −0.95 PVX_117645_hypothetical protein factor TFIIB DEN4 SEQ 851 471 SRNTS −1.42 −1.36 PE3D7_1469600_biotin carboxylase subunit −1.35 PVX_118062_chloroquine resistance of acetyl CoA carboxylase marker protein YF SEQ 852 3 DKPSL −1.35 −1.05 PF3D7_0520100_protein phosphatase PPM9 YF SEQ 853 52 DRPAE −1.04 −1.54 PVX_096090_exonuclease 1 YF SEQ 854 76 PSTGE −1.69 −1.77 PVX_097885_hypothetical protein YF SEQ 855 77 STGEA −1.30 −1.47 PVX_082980_GPI mannosyltransferase 3 YF SEQ 856 84 AEENE −1.55 −0.70 PF3D7_1348200_step II splicing factor −1.18 PVX_0019.55_schizont egress antigen-1 YF SEQ 857 85 EENEG −1.83 −1.70 PF3D7_0500800_mature parasite-infected −1.50 PVX_116660_Micro-fibrillar-associated erythrocyte surface antigen (MESA) protein 1 C-terminus domain containing protein YF SEQ 858 86 ENEGD −1.95 −1.74 PF3D7_1332200_conserved Plasmodium −1.76 PVX_089085_protein KRII protein YF SEQ 859 87 NEGDN −1.83 −1.38 PF3D7_1412600_deoxyhypusine synthase −1.29 PVX_119310_lipoamide acyltransferase (DHS) component of branched-chain alpha-keto acid dehydrogenase complex YF SEQ 860 96 TYSDR −1.18 −0.68 PF3D7_0418600_regulator of chromosome −1.20 PVX_013120_unspecified condensation YF SEQ 861 148 AKQEN −1.02 −1.25 PVX_094275_hypothetical protein YF SEQ 862 164 ALSGS −1.15 −1.04 PF3D7_0629100_nicotinate −0.94 PVX_169270_unspecified phosphoribosyltransferase YF SEQ 863 165 LSGSQ −1.22 −1.30 PF3D7_0704000_conserved Plasmodium −1.51 PVX_117205_hypothetical protein membrane protein YF SEQ 864 166 SGSQE −1.09 −1.15 PF3D7_0712600_erythrocyte membrane −1.75 PVX_116765_variant-silencing SET protein 1 protein YF SEQ 865 219 QSGSG −1.09 −1.99 PVX_114512_eukaryotic translation initiation factor 2-alpha kinase YF SEQ 866 220 SGSGG −1.16 −2.11 PF3D7_0300100_erthrocyte membrane −2.35 PVX_123205_CCR4-associated factor 1 protein 1 YF SEQ 867 221 GSGGV −1.05 −1.49 PF3D7_1373500_erythrocyte membrane −1.57 PVX_089655_ubiquitin carboxyl- protein 1 terminal hydrolase 13 YF SEQ 868 249 GNQEG −1.42 −1.75 PVX_122250_hypothetical protein YF SEQ 869 250 NQEGS −1.50 −0.31 PF3D7_0108700_secreted ookinete protein −1.17 PVX_114512_eukaryotic translation initiation factor 2-alpha kinase YF SEQ 870 251 QEGSL −1.41 −1.04 PF3D7_0617400_erythrocyte membrane −1.36 PVX_001040_transcription factor with protein 1 AP2 domain(s) YF SEQ 871 265 VTKDT −1.36 −1.04 PF3D7_1009200_small subunit rRNA synthesis-associated protein YF SEQ 872 266 TKDTN −1.62 −1.46 PF3D7_0600200_erythrocyte membrane −1.75 PVX_000730_exosome complex protein 1 component RRP4 YF SEQ 873 267 KDTND −1.73 −1.11 PF3D7_1018200_serine_threonine protein −1.70 PVX_111090_hypothetical protein phosphatase 8 YF SEQ 874 268 DTNDN −1.75 −1.94 PF3D7_1428400_WD and tetratricopeptide −0.81 PVX_113750_eukaryotic translation repeats protein 1 initiation factor 3 subunit 6 interacting protein YF SEQ 875 269 TNDNN −1.55 −1.90 PF3D7_1428400_WD and tetratricopeptide −1.30 PVX_119270_exportin-1 repeats protein 1 YF SEQ 876 309 KNPTD −122 −1.06 PF3D7_1136900_subtilisin-like protease 2 −0.98 PVX_092210_hypothetical protein (SUB2) YF SEQ 877 310 NPTDT −1.81 −1.03 PVX_092535_Adenylate and Guanylate cyclase catalytic domain containing protein YF SEQ 878 313 DTGHG −1.59 −1.31 PVX_054190_unspecified YF SEQ 879 314 TGHGT −1.04 −1.31 PVX_113390_hypothetical protein YF SEQ 880 326 SKGAP −1.20 −0.52 PF3D7_1453400_conserved Plasmodium −1.75 PVX_086245_nuclear formin-like protein protein YF SEQ 881 327 KGAPC −1.05 −1.03 PVX_083220_hypothetical protein YF SEQ 882 357 ASTND −1.54 −0.95 PF3D7_0917100_N-glycosylasc_DNA lyase −1.03 PVX_00650_sentrin-specific protease 1 YF SEQ 883 358 STNDD −1.30 −1.46 PF3D7_1345100_thioredoxin 2 (TRX2) −1.16 PVX_085130_transporter YF SEQ 884 369 NPPFG −1.03 −1.11 PVX_002680_hypothetical protein YF SEQ 885 391 HKEGS −1.06 −0.27 PF3D7_9209000_6-cysteine protein (P230) −1.11 PVX_110920_acetyl-CoA transporter YF SEQ 886 392 KEGSS −1.27 −0.47 PF3D7_0209000_6-cysteine protein (P230) −2.07 PVX_000945_apical sushi protein YF SEQ 887 394 GSSIG −1.01 −0.38 PF3D7_1431600_ATP-specific succinyl- −1.25 PVX_123970_ataxin-3 CoA synthetase beta subunit DEN2 SEQ 888 37 KNKPT −1.25 −1.63 PF3D7_0201900_erythrocyte membrane −1.31 PVX_099980_merozoite surface protein protein 3 (EMP3) 1 (MSP1) DEN2 SEQ 889 50 EAKQP −1.80 −1.16 PF3D7_0306900_40S ribosomal protein S23 −1.00 PVX_119470_40S ribosomal protein S23 DEN2 SEQ 890 69 TTTES −1.58 −0.92 PF3D7_0223500_erythrocyte membrane −1.37 PVX_000735_protein phosphatase protein 1 PPM1 DEN2 SEQ 891 70 TTESR −1.44 −1.25 PVX_013625_unspecified DEN2 SEQ 892 73 SRCPT −1.60 −1.03 PVX_093705_variable surface protein Vir18 DEN2 SEQ 893 75 CPTQG −1.88 −1.05 PVX_095125_hypothetical protein DEN2 SEQ 894 76 PTQGE −1.88 −2.04 PVX_084330_hypothetical protein DEN2 SEQ 895 77 TQGEP −1.76 −1.17 PVX_099635_conserved Plasmodium protein DEN2 SEQ 896 78 QGEPS −1.51 −1.20 PVX_099635_conserved Plasmodium protein DEN2 SEQ 897 84 NEEQD −1.28 −1.45 PF3D7_0408700_sporozoite micronemal −1.66 PVX_094890_hypothetical protein protein essential for cell traversal (PLP1) DEN2 SEQ 898 85 EEQDK −1.0 −0.93 PF3D7_1472800_conserved Plasmodium −1.31 PVX_091570_myosin light chain B protein DEN2 SEQ 899 146 SGEEH −1.20 −0.85 PF3D7_0800300_erythrocyte membrane −1.47 PVX_116680_vacuolar protein sorting- protein 1 associated protein 52 DEN2 SEQ 900 147 GEEHA −1.18 −1.30 PVX_100970_hypothetical protein DEN2 SEQ 901 153 GNDTG −1.72 −0.44 PF3D7_0703500_erythrocyte membrane- −1.69 PVX_088045_hypothetical protein associated antigen DEN2 SEQ 902 154 NDTGK −1.88 −1.00 PE3D7_1105500_centrin-4 (CEN4) −0.80 PVX_090955_centrin-4 DEN2 SEQ 903 155 DTGKH −1.99 −1.01 PF3D7_0305100_conserved Plasmodium −0.96 PVX_114725_metacaspase 1 protein DEN2 SEQ 904 156 TGKHG −1.96 −1.53 PF3D7_1204300_eukaryotic translation −1.00 PVX_003635_hypothetical protein initiation factor 5A (EIF5A) DEN2 SEQ 905 157 GKHMK −1.61 −1.79 PF3D7_1234600_conserved Plasmodium −0.82 PVX_081755_hypothetical protein protein DEN2 SEQ 906 158 KHGKE −1.22 −1.47 PF3D7_1444500_eukaryotic initiation factor −0.13 PVX_123283_JmjC domain containing 2alpha kinase 1 (IK1) protein (JmjC1) DEN2 SEQ 907 166 TPQSS −1.92 −1.01 PVX_003795_serine-repeat antigen (SERA) DEN2 SEQ 908 167 PQSST −2.13 −1.09 PVX_114115_hypothetical protein DEN2 SEQ 909 168 QSSTT −2.09 −1.35 PF3D7_0520100_protein phosphatase PPM9 DEN2 SEQ 910 169 SSTTE −1.92 −1.81 PF3D7_0420900_erythrocyte membrane −1.73 PVX_097835_DNA mismatch repair protein 1 protein MSH6 DEN2 SEQ 911 170 STTEA −1.80 −2.02 PF3D7_0502600_conserved Plasmodium −1.25 PVX_122240_carbamoyl phosphate protein synthetase DEN2 SEQ 912 171 TTEAE −1.50 −1.60 PVX_097705_merozoite surface protein 3 (MSP3_8) DEN2 SEQ 913 224 GADTQ −1.55 −1.49 PVX_004537_VIR protein DEN2 SEQ 914 225 ADTQG −1.62 −0.31 PF3D7_1020300_cytoplasmic dynein −1.09 PVX_088215_hypothetical protein intermediate chain DEN2 SEQ 915 226 DTQGS −1.65 −1.42 PVX_087780_phosphopantetheine adenylyltransferase DEN2 SEQ 916 227 TQGSN −1.45 −1.20 PF3D7_1112300_conserved Plasmodium −1.97 PVX_073690_unspecified protein DEN2 SEQ 917 244 PHAKK −1.44 −0.50 PF3D7_1412100_conserved Plasmodium −1.32 PVX_091105_endoplasmic reticulum protein resident calcium binding protein DEN2 SEQ 918 314 AETQH −1.05 −1.21 PVX_115135_hypothetical protein DEN2 SEQ 919 327 YFGDG −1.54 −1.32 PVX_003645_hypothetical protein DEN2 SEQ 920 328 EGDGS −1.74 −1.63 PF3D7_1035800_probable protein −1.94 PVX_089085_protein KR11 DEN2 SEQ 921 329 GDGSP −1.64 −1.97 PVX_122940_hypothetical protein DEN2 SEQ 922 330 DGSPC −1.27 −1.04 PF3D7_1240600_erythrocyte membrane −0.76 PVX_092345_DNA-directed RNA protein 1 polymerase 1 subunit RPA2 DEN2 SEQ 923 360 TEKDS −1.11 −1.75 PVX_084195_origin recognition complex subunit 1 DEN2 SEQ 924 361 EKDSP −1.19 −2.14 PF3D7_0624600_SNF2 helicase −1.74 PVX_092945_sporozoite and liver stage asparagine-rich protein (KARP) DEN2 SEQ 925 363 DSPVN −1.24 −0.80 PF3D7_1104500_WD repeat-containing −1.20 PVX_123935_haloacid dehalogenase- protein like hydrolase DEN2 SEQ 926 369 EAEPP −1.31 −1.29 PVX_122665_hypothetical protein DEN2 SEQ 927 371 EPPFG −1.48 −1.11 PVX_118340_serine_threonine protein kinase DEN2 SEQ 928 372 PPFGD −1.14 −1.28 PVX_081330_LCCL domain-containing protein (CCp5) DEN2 SEQ 929 396 GSSIG −1.02 −0.38 PF3D7_1431600_ATP-specific succinyl- −1.25 PVX_123970_ataxin-3 CoA synthetase beta subunit DEN2 SEQ 930 471 SRSTS −1.34 −1.54 PF3D7_0207700_serine repeat antigen 4 −1.54 PVX_111025_vesicle transport-related (SERA4) protein DEN2 SEQ 931 472 RSTSL −1.32 −1.05 PF3D7_0410000_erythrocyte vesicle protein 0.73 PVX_116655_hypothetical protein 1 (EVP1) DEN1 SEQ 932 38 KNKPT −1.29 −1.63 PF3D7_0201900_erythrocyte membrane −1.31 PVX_099980_merozoite surface protein protein 3 (EMP3) 1 (MSP1) DEN1 SEQ 933 67 ISNTT −1.82 −0.10 PF3D7_0712500_rifin −1.16 PVX_032190_unspecified DEN1 SEQ 934 68 SNTTT −2.05 −1.79 PF3D7_1013500_phosphoinositide-specific −1.56 PVX_092570_transcription factor with phospholipase C (PI-PLC) AP2 domain(s) DEN1 SEQ 935 69 NTTTD −1.95 −1.47 PF3D7_1443600_conserved Plasmodium −0.53 PVX_100705_hypothetical protein protein DEN1 SEQ 936 70 TTTDS −1.67 −1.50 PFD7_0902200_serine_threonine protein −1.35 PVX_114955_hypothetical protein kinase DEN1 SEQ 937 71 TTDSR −1.49 −1.44 PF3D7_1418100_liver specific protein 1 −1.47 PVX_114955_hypothetical protein DEN1 SEQ 938 74 SRCPT −1.74 −1.03 PVX_093705_variable surface protein Vir18 DEN1 SEQ 939 76 CPTQG −1.75 −1.05 PVX_095125_hypothetical protein DEN1 SEQ 940 77 PTQGE −1.52 −2.04 PVX_084330_hypothelical protein DEN1 SEQ 941 78 TQGEA −1.16 −1.74 PF3D7_1240400_erythrocyte membrane −1.33 PVX_018660_unspecified protein 1 DEN1 SEQ 942 152 QVGNE −1.47 −1.21 PF3D7_1255200_erythrocyte membrane −0.91 PVX_098950_hypothetical protein protein DEN1 SEQ 943 154 GNETT −1.54 −1.54 PF3D7_0314700_zinc finger protein −1.57 PVX_096075_hypothetical protein DEN1 SEQ 944 155 NETTE −1.66 −1.40 PF3D7_0302200_cytoadherence linked −1.60 PVX_097800_hypothetical protein asexual protein 32 (CLAG3_2) DEN1 SEQ 945 158 TEHGT −1.03 −1.14 PVX_080150_hypothetical protein DEN1 SEQ 946 170 APTSE −1.50 −1.46 PVX_089950_bifunctional dihydrofolate reductase-thymidylate synthase DEN1 SEQ 947 188 SPRTG −1.08 −1.85 PVX_116604_hypothetical protein DEN1 SEQ 948 224 SGAST −1.72 −1.41 PF3D7_1015900_enolase (ENO) −1.23 PVX_095015_enolase DEN1 SEQ 949 225 GASTS −1.99 −2.01 PF3D7_0475800_erythrocyte membrane −0.86 PVX_047190_unspecified protein 1 DEN1 SEQ 950 226 ASTSQ −2.09 −0.75 PF3D7_1437200_ribonucleoside-diphosphate −1.36 PVX_119790_hypothetical protein reductase DEN1 SEQ 951 227 STSQE −2.09 −2.24 PF3D7_0215300_acyl-CoA synthetase −1.36 PVX_068190_unspecified (ACS8) DEN1 SEQ 952 273 QTSGT −1.49 −1.97 PF3D7_1240300_erythrocyte membrane protein 1 DEN1 SEQ 953 275 SGTTT −1.00 −1.82 PF3D7_0905100_nucleoporin −1.52 PVX_031690_unspecified NUP100_NSP100 DEN1 SEQ 954 315 AETQH −1.29 −1.21 PVX_115135_hypothetical protein DEN1 SEQ 955 328 YFGTD −1.47 −0.80 PF3D7_1453900_conserved Plasmodium −1.23 PVX_090150_erythrocyte membrane- protein associated antigen DEN1 SEQ 956 329 EGTDA −1.55 −1.55 PVX_030190_unspecified DEN1 SEQ 957 342 QDEKG −1.10 −1.11 PF3D7_0400400_erythrocyte membrane −1.22 PVX_116765_variant-silencing SET protein 1 protein DEN1 SEQ 958 343 DEKGV −1.49 −1.52 PF3D7_1418100_liver specific protein 1 0.10 PVX_095145_hypothetical protein DEN1 SEQ 959 347 VTQNG −1.23 −1.47 PF3D7_1421300_conserved_Plasmodium −0.88 PVX_085877_conserved Plasmodium protein protein DEN1 SEQ 960 363 KEKPV −1.10 −1.49 PF3D7_0712600_erythrocyte membrane PVX_089925_hypothetical protein protein 1 DEN1 SEQ 961 370 ETEPP −1.39 −1.12 PF3D7_0500800_mature parasite-infected erythrocyte surface antigen (MESA) DEN1 SEQ 962 372 EPPFG −1.44 −1.11 PVX_118340_serine_threonine protein kinase DEN1 SEQ 963 472 SRSTS −1.34 −1.54 PF3D7_0207700_serine repeat antigen 4 −1.54 PVX_111025_vesicle transport-related (SERA4) protein DEN1 SEQ 964 473 RSTSL −1.20 −1 05 PF3D7_0410000_erythrocyte vesicle protein 0.73 PVX_116655_hypothetical protein 1 (EVP1)
(521) TABLE-US-00023 TABLE 23 P. falciparum P_vivax BEPI BEPI Pos in BEPI (standard (standard Virus BEPIpenta NS1 (virus) uTOPE) gi: curation uTOPE) gi: curation (P_vivax) DEN3 DSPKR SEQ 647 38 −1.34 −1.44 PVX_088915_hypothetical protein DEN3 QGKRT SEQ 1246 100 −1.07 −0.25 PF3D7_1321300_conserved −1.20 PVX_123915_hypothetical protein Plasmodium membrane protein DEN3 VTAET SEQ 965 125 −1.22 −1.08 PVX_019165_unspecified DEN3 TAETQ SEQ 966 126 −1.29 −1.48 PF3D7_0700100_erythrocyte −0.76 PVX_111180_28 kDa ookinete membrane protein 1 surface protein DEN3 ETQNS SEQ 967 128 −1.07 −1.78 PF3D7_0815600_eukaryotic −1.59 PVX_089625_eukaryotic translation initiation factor 3 subunit G translation initiation factor 3 subunit 4 DEN3 NTPEC SEQ 968 140 −1.80 −1.28 PVX_100620_hypothetical protein DEN3 TPECP SEQ 969 141 −1.73 −1.19 PVX_086285_hypothetical protein DEN3 CPSAS SEQ 970 144 −1.14 −0.98 PF3D7_1355100_DNA replication −1.31 PVX_085195_hypothetical protein licensing factor MCM6 (MCM6) DEN3 SQKNG SEQ 971 205 −1.16 −1.54 PF3D7_0314700_zinc finger protein −1.05 PVX_120845_unspecified DEN3 QKNGS SEQ 972 206 −1.28 −1.02 PF3D7_1319600_conserved −1.29 PVX_098655_hypothetical protein Plasmodium protein DEN3 KNGSW SEQ 973 207 −1.32 −0.62 PF3D7_1203600_cytochrome c1 −1.23 PVX_114260_transcription factor heme lyase with AP2 domain(s) DEN3 GTRGP SEQ 974 293 −1.65 −1.80 PVX_092925_CCAAT-box DNA binding protein subunit B DEN3 TRGPS SEQ 975 294 −1.55 −1.36 PVX_132260_unspecified DEN3 SEKEE SEQ 976 340 −1.11 −1.41 PF3D7_1140000_carbonic −0.45 PVX_213290_unspecified anhydrase (CA) DEN3 EKEEN SEQ 977 341 −1.11 −1.66 PF3D7_0500800_mature parasite- −0.70 PVX_238290_unspecified infected erythrocyte surface antigen (MESA) DEN4 FQPES SEQ 978 35 −1.41 −0.42 PF3D7_0720800_Hand-like protein −1.36 PVX_098620_hypothetical protein DEN4 PESPA SEQ 979 37 −1.64 −1.31 PVX_119380_hypothetical protein DEN4 ESPAR SEQ 980 38 −1.42 −2.04 PF3D7_0600200_erythrocyte −1.87 PVX_114405_hypothetical protein membrane protein 1 DEN4 TPPVS SEQ 981 106 −1.07 −1.03 PVX_081495_hypothetical protein DEN4 GPDTS SEQ 982 138 −1.37 −1.47 PF3D7_1200400_erythrocyte membrane protein 1 DEN4 TSECP SEQ 983 141 −1.74 −1.28 PVX_084715_hypothetical protein DEN4 REGSS SEQ 984 173 −1.07 −2.13 PF3D7_1351700_inner membrane −1.73 PVX_001040_transcription factor complex protein 1f with AP2 domain(s) DEN4 EGSSE SEQ 985 174 −1.25 −2.04 PF3D7_0733000_erythrocyte −1.36 PVX_097583_skeleton-binding membrane protein 1 protein 1 DEN4 GSSEV SEQ 986 175 −1.10 −0.48 PF3D7_0600400_erythrocyte −1.16 PVX_016140_unspecified membrane protein 1 DEN4 SSKNQ SEQ 987 205 −1.02 −1.97 PF3D7_1228300_NIMA related −0.89 PVX_000525_protein kinase kinase 1 (NEK1) domain containing protein DEN4 TTTAS SEQ 988 301 −1.51 −1.28 PF3D7_0716800_eukaryotic −1.12 PVX_049690_unspecified translation initiation factor 3 subunit 1 DEN4 TTASG SEQ 989 302 −1.33 −1.73 PF3D7_0712900_erythrocyte −1.87 PVX_113460_DNA repair protein membrane protein 1 RAD50 DEN4 TASGK SEQ 990 303 −1.09 −1.72 PF3D7_0712900_erythrocyte −0.62 PVX_118455_clathrin coat membrane protein 1 assembly protein AP50 DEN4 LSEKE SEQ 991 339 −1.08 −1.11 PF3D7_1301800_surface-associated −0.30 PVX_014125_unspecified interspersed protein 13_1 (SURFIN 13 1) DEN4 SEKEE SEQ 992 340 −1.18 −1.41 PF3D7_1140000_carbonic −0.45 PVX_213290_unspecified anhydrase (CA) DEN4 EKEEN SEQ 993 341 −1.20 −1.66 PF3D7_0500800_mature parasite- −0.70 PVX_238290_unspecified infected erythrocyte surface antigen (MESA) YF SPGRK SEQ 994 126 −1.38 −1.21 PVX_114115_hypothetical protein YF PGRKN SEQ 995 127 −1.36 −1.22 PF3D7_1325900_conserved −1.28 PVX_119750_ubiquitin-protein Plasmodium protein ligase YF GRKNG SEQ 996 128 −1.10 −1.66 PVX_069690_unspecified YF KSRKE SEQ 997 139 −1.23 −1.70 PF3D7_0215800_origin recognition −1.77 PVX_097000_Plasmodium complex subunit 5 (ORC5) exported ptotein YF VNGKK SEQ 998 189 −1.24 −0.81 PF3D7_0201900_erythrocyte −1.06 PVX_003735_DNA repair protein membrane protein 3 (EMP3) RAD2 YF NGKKS SEQ 999 190 −1.61 −0.85 PF3D7_0709300_Cg2 protein −1.24 PVX_123855_histone chaperone (CG2) ASF1 YF GKKSA SEQ 1000 191 −2.00 −1.36 PF3D7_0400400_erythrocyte −1.88 PVX_116985_biotin carboxylase membrane protein 1 subunit of acetyl CoA carboxylase YF SAHGS SEQ 1001 194 −2.17 −1.21 PVX_091015_protein kinase YF AHGSP SEQ 1002 195 −1.82 −1.54 PVX_091015_protein kinase YF GGPVS SEQ 1003 249 −1.34 −1.39 PVX_101355_protein phosphatase PPM4 YF VQTNG SEQ 1004 263 −1.00 −0.10 PF3D7_1442400_conserved −1.09 PVX_118340_serine_threonine Plasmodium protein protein kinase YF GNCDG SEQ 1005 290 −1.04 −1.15 PVX_001850_hypothetical protein YF DGRGK SEQ 1006 293 −2.00 −1.05 PVX_100970_hypothetical protein YF GRGKS SEQ 1007 294 −2.03 −1.46 PE3D7_1020700_histone −1.03 PVX_116765_variant-silencing acetyltransferase SET protein YF RGKST SEQ 1008 295 −2.05 −1.45 PVX_097965_hypothetical protein YF GKSTR SEQ 1009 296 −2.14 −1.17 PF3D7_1111100_replication factor −1.06 PVX_089935_hypothetical protein C subunit 5 YF KSTRS SEQ 1010 297 −2.36 −1.48 PF3D7_1413700_conserved −1.60 PVX_086050_hypothetical protein Plasmodium protein YF STRST SEQ 1011 298 −2.62 −1.21 PVX_093655_sentrin-specilic protease 2 YF TRSTT SEQ 1012 299 −2.73 −1.05 PF3D7_1479400_rifin (RIF) −0.84 PVX_065690_unspecified YF STTDS SEQ 1013 301 −2.15 −1.60 PF3D7_0600600_erythrocyte −1.27 PVX_094255_reticulocyte binding membrane protein 1 (PfEMP1) protein 2b (RBP2b) YF TTDSG SEQ 1014 302 −1.81 −0.94 PE3D7_1333000_20 kDa −1.10 PVX_092630_hypothetical protein chaperonin (CPN20) YF TDSGK SEQ 1015 303 −1.47 −1.90 PF3D7_0412400_erythrocyte −0.86 PVX_000970_pre-mRNA- membrane protein 1 processing-splicing factor 8 YF DSGKV SEQ 1016 304 −1.10 −0.22 PF3D7_0821300_ATP-dependent −1.13 PVX_089015_ATP-dependent RNA helicase prh1 RNA helicase DBP10 YF RKTHE SEQ 1017 339 −1.14 −1.07 PE3D7_0302000_pre-mRNA- −1.31 PVX_088940_hypothetical protein splicing factor PRP46 WNV PETPQ SEQ 1018 38 −1.69 −2.30 PF3D7_0937800_erythrocyte PVX_096070_early transcribed membrane protein 1 membrane protein (ETRAMP) WNV ETPQG SEQ 1019 39 −1.27 −1.22 PF3D7_1366300_conserved −1.71 PVX_081205_TatD-like Plasmodium protein deoxyribonuclease WNV APKRL SEQ 1020 102 −1.16 −0.22 PF3D7_1465800_dynein beta chain −1.19 PVX_095355_kinesin-5 (EG5) WNV PETKE SEQ 1021 140 −1.48 −1.57 PF3D7_1373500_erythrocyte −1.07 PVX_113990_mitochondrial membrane protein 1 import receptor subunit TOM40 WNV CPTQN SEQ 1022 145 −1.29 −1.12 PF3D7_1334000_conserved Plasmodium protein WNV RESNT SEQ 1023 174 −1.48 −1.22 PF3D7_1120600_conserved −0.94 PVX_002680_hypothetical protein Plasmodium protein WNV ESNTT SEQ 1024 175 −1.94 −1.29 PF3D7_0809100_erythrocyte −1.30 PVX_145260_unspecified membrane protein 1 WNV SNTTE SEQ 1025 176 −2.02 −2.02 PF3D7_1368800_DNA repair −1.16 PVX_145260_unspecified endonuclease WNV AGPRS SEQ 1026 250 −1.48 −1.16 PF3D7_0816500_small heat shock protein HSP20 WNV RSNHN SEQ 1027 253 −1.54 −1.23 PF3D7_1367700_alanine--tRNA −1.37 PVX_118425_serin_threonine ligase (AlaRS) protein kinase WNV RGPAT SEQ 1028 296 −1.56 −1.64 PF3D7_0600200_erythrocyte −0.72 PVX_113645_hypothetical protein membrane protein 1 WNV ATRTT SEQ 1029 299 −2.20 −1.13 PVX_117340_hypothetical protein WNV TRTTT SEQ 1030 300 −2.28 −1.27 PF3D7_0901000_rifin (RIF) −0.96 PVX_085275_60S ribosomal protein L5 WNV RTTTE SEQ 1031 301 −2.27 −1.40 PVX_099295_hypothetical protein WNV TTTES SEQ 1032 302 −1.91 −0.92 PF3D7_0223500_erythrocyte −1.37 PVX_000735_protein phosphatase membrane protein 1 PPM1 WNV TTESG SEQ 1033 303 −1.54 −1.49 PF3D7_0209000_6-cysteine protein −0.91 PVX_071190_unspecified (P230) WNV TESGK SEQ 1034 304 −1.18 −2.56 PF3D7_1459200_WD repeat- −0.59 PVX_115490_VIR protein containing protein DEN1 DSPKR SEQ 1035 38 −1.45 −1.44 PVX_088915_hypothetical protein DEN1 GPDTP SEQ 1036 138 −1.38 −1.51 PVX_090230_early transcribed membrane protein (ETRAMP) DEN1 IPECP SEQ 1037 141 −1.84 −1.19 PVX_086285_hypothetical protein DEN1 ECPDG SEQ 1038 143 −1.53 −1.20 PVX_131260_unspecified DEN1 SEKNE SEQ 1039 205 −1.12 −0.35 PF3D7_1403900_serin_threonine −1.43 PVX_003585_repetitive organellar protein phosphatase CPPED1 protein DEN1 EKNET SEQ 1040 206 −1.17 −1.55 PF3D7_1430400_autophagy protein 5 −0.88 PVX_089085_protein KRI1 DEN1 NRGPS SEQ 1041 294 −1.46 −1.86 PVX_157260_unspecified DEN1 VKEKE SEQ 1042 339 −1.11 −1.12 PF3D7_0500800_mature parasite- −0.66 PVX_123025_selenoprotein infected erythrocyte surface antigen (MESA) DEN1 KEKEE SEQ 1043 340 −1.16 −0.47 PF3D7_1440200_stromal- −1.29 PVX_104695_unspecified processing peptidase DEN1 EKEEN SEQ 1044 341 −1.16 −1.66 PF3D7_0500800_mature parasite- −0.70 PVX_238290_unspecified infected erythrocyte surface antigen (MESA) DEN2 FQPES SEQ 1045 35 −1.71 −0.42 PF3D7_0720800_Ham1-like protein −1.36 PVX_098620_hypothetical protein DEN2 PESPS SEQ 1046 37 −1.93 −2.20 PF3D7_0808700_erythrocyte −1.66 PVX_097815_trafficking protein membrane protein 1 particle complex subunit 8 DEN2 ESPSK SEQ 1047 38 −1.67 −1.89 PVX_135260_unspecified DEN2 SPSKL SEQ 1048 39 −1.50 −1.75 PF3D7_1442700_conserved 0.12 PVX_084521_ABC transporter B Plasmodium protein family member 7 DEN2 GKRSL SEQ 1049 101 −1.04 −1.28 PF3D7_0905300_dynein heavy −0.24 PVX_119465_T-complex protein chain 1 subunit beta DEN2 STESH SEQ 1050 126 −1.15 −1.53 PF3D7_0206000_DNA repair −1.55 PVX_101435_DNA repair protein protein RAD2 rhp16 DEN2 TESHN SEQ 1051 127 −1.03 −1.04 PF3D7_0425800_erythrocyte membrane protein 1 DEN2 PETAE SEQ 1052 139 −1.23 −1.65 PF3D7_1100200_erythrocyte −0.42 PVX_123175_hypothetical protein membrane protein 1 DEN2 PNTNR SEQ 1053 145 −1.08 −0.80 PF3D7_0410000_erythrocyte −1.36 PVX_123240_DEAD_DEAH box vesicle protein 1 (EVP1) helicase DEN2 NRGPS SEQ 1054 294 −1.66 −1.86 PVX_157260_unspecified DEN2 TTTAS SEQ 1055 301 −1.43 −1.28 PF3D7_0716800_eukaryotic −1.12 PVX_049690_unspecified translation initiation factor 3 subunit I DEN2 TTASG SEQ 1056 302 −1.24 −1.73 PF3D7_0712900_erythrocyte −1.87 PVX_113460_DNA repair protein membrane protein 1 RAD50 DEN2 TASGK SEQ 1057 303 −1.05 −1.72 PF3D7_0712900_erythrocyte −0.62 PVX_118455_clathrin coat membrane protein 1 assembly protein AP50
Example 14: Correlation of Malaria B Cell Epitopes and Potential Autoimmune Epitopes
(522) As we describe Zika virus carries pentamer B cell epitopes which match mimics in the human proteome and which may give rise to some of the adverse autoimmune diseases. Zika epitopes of particular interest in this regard are shown in Table 24; these are examples but should not be considered limiting. Notably we identified Zika B cell epitope matches with Plasmodium which overlap these but are displaced by one or more amino acids. This indicates that preexisting Plasmodium antibodies may bind Zika virus and create steric hindrance preventing the formation of antibodies to the adverse autoimmune epitopes. This is one mechanism by which Plasmodium antibodies may provide not only protection against Zika infection but also protect a patient against severe Zika associated autoimmune disease.
(523) TABLE-US-00024 TABLE 24 Near Neighbor Human protein Plasmodium Zika containing falciparum Pentamer mimic BEPI BEPI Plasmodium Protein Envelope PRAEA Platelet derived RAEAT (SEQ PF3D7_1430700 growth factor ID NO: 718) product_NADP-specific receptor, glutamate optineurin dehydrogenase (GDH2) TESTE Synaptogyrin TESTE (SEQ PF3D7_1122600 ID NO: 383) conserved Plasmodium ESTEN ProNeuropeptide protein Y STENS Duffy antigen STENSK PF3D7_1418100 (SEQ ID product_liver NO: 1277) specific protein 1 NS1 SLAGP Platelet AGPLS (SEQ PF3D7_1150400 glycoprotein 1b ID NO: 1278) product_erythrocyte membrane protein 1 STTAS Abnormal TTASG (SEQ PF3D7_0712900 spindle protein ID NO: 1056) product_erythrocyte in microcephaly membrane protein 1 ASPM
Example 15: Selected Malaria Antigens for Cross Protection
(524) Peptides in the Zika envelope and NS1 proteins were identified which had highest probability of eliciting antibodies which provide protection. Where a corresponding high probability Plasmodium falciparum B cell epitope was identified, containing the same pentamer, the flanking regions on either side of this in the malaria protein were identified, thus defining a 15-mer with the matching pentamer central to the 15-mer. These Plasmodium proteins, and 15-mers defined therein, are identified in Table 25 and define immunogens which could provide protection against Zika if included in a vaccine.
(525) In two cases a hexamer match is identified. The lateral ridge, or DE envelope loop of Zika contains the sequence STENSK (SEQ ID NO.: 1277), which is replicated in P. falciparum liver specific protein (PF3D7_1418100 liver specific protein 1). This protein is already under consideration as having potential as a malaria vaccine. A second matching hexamer, KKMTGK (SEQ ID NO.: 1279), is found in another conserved Plasmodium falciparum protein (PF3D7_1408700 conserved Plasmodium protein); in this case the Zika peptide is in the Domain 1 of the envelope. For these two malaria proteins a 16-mer is defined which provides pentamer flanking regions to the hexamer.
(526) While the focus of this invention is protection against Zika virus and the most serious diseases arising therefrom, it would be possible by using the matching pentamers and the extended peptides that comprise them, to design a vaccine which provides protection against both Plasmodium and Zika virus.
(527) TABLE-US-00025 TABLE 25 15-mer and 16-mer immunogens from P. falciparum P_falci- pentamer parum SEQ position BEPI BEPI BEPI ID in Pf (standard (virus) penta NO: protein uTOPE) gi: curation Malaria peptide SEQ Zika Envelope protein matches −1.04 TQGEA 709 988 −1.74 PF3D7_1240400 erythrocyte SGEPQTQGEASSPSD SEQ 1058 membrane protein 1 −1.21 DKQSD 710 474 −1.33 PF3D7_0930400.2 conserved KELNSDKQSDKYISD SEQ 1059 Plasmodium protein −0.87 KKMTG 1280 1817 −1.54 PF3D7_1408700 conserved DEKKKKMTGKEEQII SEQ 1060 Plasmodium protein −1.12 KMTGK 712 1818 −1.49 PF3D7_1408700 conserved EKKKKMTGKEEQIIV SEQ 1061 Plasmodium protein −2.06 ETDEN 370 472 −1.07 PF3D7_1115400 cysteine GYINLETDENGYKKT SEQ 1062 proteinase falcipain 3 (FP3) −1.77 TDENR 382 1389 −1.07 PF3D7_1425600 zinc finger protein DSSLFTDENREEKKD SEQ 1063 −1.31 RAEAT 34 270 −0.91 PF3D7_1430700 NADP-specific GGSNIRAEATGYGVV SEQ 1064 glutamate dehydrogenase (GDH2) −1.76 ADTGT 365 797 −1.67 PF3D7_1255200 erythrocyte RPTQDADTGTDDIDD SEQ 1065 membrane protein 1 −1.47 KGRLS 7 522 −1.20 PF3D7_0818900 heat shock protein TITNDKGRLSQDEID SEQ 1066 70 (HSP70) −1.38 GRLSS 1281 965 −0.92 PF3D7_1148000 serine_threonine ELSGEGRLSSTGMYK SEQ 1067 protein kinase −1.53 AGTDG 32 557 −1.69 PF3D7_1035200 S-antigen EDKGGAGTDGELSHN SEQ 1068 −1.45 TDGPC 778 829 −1.45 PF3D7_1300300 erythrocyte SRGTPTDGPCEGKGD SEQ 1069 membrane protein 1 −1.19 DGPCK 729 1376 −1.16 PF3D7_0712900 erythrocyte LERLKDGPCKNDSEE SEQ 1070 membrane protein 1 −1.62 TESTE 731 1560 −1.93 PF3D7_1122600 conserved DTRDKTESTENKVLS SEQ 1071 Plasmodium protein −1.51 ESTEN 732 493 −0.98 PF3D7_0205300 conserved DELIEESTENLNSQH SEQ 1072 Plasmodium protein −1.30 STENS 733 1022 −1.03 PF3D7_1418100 liver specific TNIEWSTENSKTNTT SEQ 1073 protein 1 −1.05 TENSK 734 1023 −1.27 PF3D7_1418100 liver specific NIEWSTENSKTNTTN SEQ 1074 protein 1 −0.63 ENSKM 1282 182 −1.01 PF3D7_0112000 TatD-like KNEQVENSKMENGNK SEQ 1075 deoxyribonuclease Zika NS1 protein matches −1.13 SKKET 739 209 −1.61 PF3D7_1401200 Plasmodium FKGLSSKKETEEYVS SEQ 1076 exported protein −1.43 KKETR 740 1388 −1.07 PF3D7_1138400 guanylyl cyclase ICKGIEKKETRRWKR SEQ 1077 (GCalpha) −1.43 YHPDS 741 140 −1.46 PF3D7_0823800 DnaJ protein DLSKQYHPDSNKNCK SEQ 1078 −1.09 KTNNS 745 465 −2.07 PF3D7_0202000 knob-associated NKNKEKTNNSKSDGS SEQ 1079 histidine-rich protein (KAHRP) −1.13 KGKEA 746 177 −1.62 PF3D7_0221700 Plasmodium RETYDKGKEAKSKRS SEQ 1080 exported protein −0.78 ESEKN 1283 816 −1.14 PF3D7_1018200 serine_threonine YAACDESEKNVEEHP SEQ 1081 protein phosphatase 8 −1.07 SEKND 747 533 −1.62 PF3D7_0613900 myosin E FENEKSEKNDNYINV SEQ 1082 −1.23 EKNDT 748 758 −1.00 PF3D7_1428400 WD and NKKNIEKNDTCNNNN SEQ 1083 tetratricopeptide repeats protein 1 −1.22 NTREG 749 243 −1.25 PF3D7_1332000 syntaxin IDISLTNTREGQNYL SEQ 1084 −0.57 RTQMK 1284 939 −0.92 PF3D7_1206200 eukaryotic FMQERRTQMKEEKSN SEQ 1085 translation initiation factor 3 subunit C −0.42 TQMKG 1285 244 −1.04 PF3D7_0404800 conserved KQNNNTQMKGKQNNN SEQ 1086 Plasmodium protein −0.53 QMKGP 1286 479 −1.40 PF3D7_1230700 protein transport NNNTNQMKGPPGQMN SEQ 1087 protein SEC13 (SEC13) −1.45 TTASG 754 1887 −1.73 PF3D7_0712900 erythrocyte PSGNNTTASGKNTPS SEQ 1088 membrane protein 1 −1.59 RPRKE 756 565 −1.10 PF3D7_0935400 gametocyte DIIYKIRPRKENKNV SEQ 1089 development protein 1 (GDV1) −1.73 KEPES 757 818 −1.46 PF3D7_1030100 pre-mRNA- EILHSKEPESDYVEA SEQ 1090 splicing factor ATP-dependent RNA helicase PRP22 −1.52 EPESN 758 36 −1.10 PF3D7_1001900 Plasmodium SSSKMEPESNRYIKG SEQ 1091 exported protein (hyp16) 16 mer peptides from envelope STENSK 1277 1022 PFS3D7_1418100 liver specific protein 1 TNIEWSTENSKTNTTN SEQ 1092 KKMTGK 1817 PF3D7_1408700 conserved Plasmodium protein DEKKKKMTGKEEQIIV SEQ 1093
(528) Analysis of P falciparum and P vivax was initially carried out using the well characterized type strains 3D7 and Sal1 respectively. In order to evaluate whether the same B cell epitopes are consistently present in wild type Plasmodium strains and therefore whether natural infection would offer the same protection against Zika infection we searched for the presence of the two hexamers. Both STENSK (SEQ ID NO.: 1277) and KKMTGK (SEQ ID NO.: 1279) are conserved in 16 isolates of P. falciparum examined from diverse different geographical sources.
(529) Immunogen polypeptides were prepared based on the P PF3D7_1418100 liver specific protein 1 peptide shown as SEQ 1092 above. In one instance the peptide was flanked by adjoining wildtype sequences to provide a 70 amino acid polypeptide to which an additional cysteine was added. In a second instance a T cell epitope from ZIKV was inserted into the C terminal flank of STENSK (SEQ ID NO.: 1277). In some embodiments, His tags were added to N or C terminal of the Plasmodium polypeptide to facilitate purification. The rationale was to provide both B cell and T helper motifs which would be present in a wild type ZIKV challenge while not creating the same mimics present in ZIKV. The resultant Sequences are shown below. These were then expressed by stable transfection into CHO cells as previously described.
(530) Seq.1094.P. falciparum LISP, Nucleotide Sequence 1-63 Signal peptide 70-252 falciparum LISP
(531) Seq.1095. P. falciparum LISP, Amino Acid Sequence 1-21 Signal peptide 24-84 falciparum LISP
(532) Seq.1096. 6×His-P. falciparum LISP, Nucleotide Sequence 1-63 Signal peptide 70-87 6× Histag 88-270 falciparum LISP
(533) Seq.1097. 6×His-P. falciparum LISP, Amino Acid Sequence 1-21 Signal peptide 24-29 6× Histag 30-90 falciparum LISP
(534) Seq.1098. P. falciparum LISP-6×His, Nucleotide Sequence 1-63 Signal peptide 70-252 falciparum LISP 253-270 6× Histag
(535) Seq.1099. P. falciparum LISP-6×His, Amino Acid Sequence 1-20 Signal peptide 21-131 Light chain variable region
(536) Seq.1100. P. falciparum LISP with ZV Tcell Epitope, Nucleotide Sequence 1-63 Signal peptide 70-282 falciparum LISP with ZV T cell epitope
(537) Seq.1101. P. falciparum LISP with ZV Tcell Epitope, Amino Acid Sequence 1-21 Signal peptide 22-94 falciparum LISP with ZV T cell epitope
(538) Seq.1102. 6×His-P. falciparum LISP with ZV Tcell Epitope, Nucleotide Sequence 1-63 Signal peptide 70-87 6× Histag 88-300 falciparum LISP with ZV T cell epitope
(539) Seq.1103. 6×His-P. falciparum LISP with ZV Tcell Epitope, Amino Acid Sequence 1-21 Signal peptide 24-29 6× Histag 30-100 falciparum LISP with ZV T cell epitope
(540) Seq.1104. P. falciparum LISP with ZV Tcell Epitope-6×His, Nucleotide Sequence, ID:500n 1-63 Signal peptide 70-282 falciparum LISP with ZV T cell epitope 283-300 6× Histag
(541) Seq.1105. P. falciparum LISP with ZV Tcell Epitope-6×His, Amino Acid Sequence 1-21 Signal peptide 22-94 falciparum LISP with ZV T cell epitope 95-100 6× Histag
Example 16. Epitope Mimics in NS1 Corresponding to Cardiovascular Function Human Proteins
(542) Epitope analysis of NS1 was conducted for an array of flaviviruses including four serotypes of dengue, yellow fever, Zika virus and Usutu virus, as well as St Louis encephalitis, West Nile, Japanese encephalitis, and Tick borne encephalitis. This included evaluation of the following criteria Table 26 and a matrix database for these parameters applied to each successive peptide was created.
(543) TABLE-US-00026 TABLE 26 Immunological Metric Method Prediction MHC I affinity Neural Network Ensembles LN (IC.sub.50) 9-mer trained on binding data std dev LN(IC.sub.50) (ave = 0.5 LN (IC.sub.50)) sliding window of 9-aa standardized affinity within protein or proteome (enables using indexed by 1 amino acid additivity of variance) 20 HLA-A relative binding probability thresholds for each peptide 17 HLA-B 6 murine MHC II affinity Neural Network Ensembles LN (IC.sub.50) 15-mer trained on binding data std dev LN(IC.sub.50) (ave = 0.5-0.7 LN (IC.sub.50)) sliding window of 15-amino standardized affinity within protein or proteome (enables using acids indexed by 1 amino acid additivity of variance) 16 DR relative binding probability thresholds for each peptide 6 DP 6DQ MHC + MHC II MHC I + MHC II Number of high affinity MHC I 9-mers within each high cross presentation simultaneous binding to affinity MHC II 15-mer peptides in a protein Linear B-cell Neural network trained on B- probability of B cell binding standardized within protein epitope 8-mer cell epitopes relative probability among peptides Sliding window of 8 amino acids indexed by 1 aa Cathepsin Neural Network Ensembles Two independent predictions cleavage trained on large proteomic probability of cleavage + probability of non-cleavage between Human cathepsin cleavage database mass aa4 and aa5 (P1P1′) of an octomer B, L and S spectrometry of cleaved peptides for the enzymes. Combined Combination of 3 prediction Probability of excision of various length peptides between 15- cathepsin cleavage + method outputs 21 amino acids in length for MHC II and exactly 9 amino MHC I + MHC II acids. binding affinity T-cell exposed Frequency comparison to Specific motifs exposed to T cell by peptide bound in MHC motif (TCEM) database for: Frequency relative to IGHV germline and somatic mutation relative to normal continuous pentamer within a Frequency relative to human proteome human repertoires bound MHC I 9-mer Frequency relative to GI microbiome two discontinuous pentamers (9-mer core of a bound MHC II 15-mer) Combination of Graphical/interactive Interactive graphical platform for evaluation Treg potential MHC I and MHC combination of 5 different based on combination of: II binding by allele prediction outputs binding predictions and in combination TCEM frequency data using additivity of variance with TCEM T-cell exposure and cathepsin cleavage Mimicry of B-cell Pentamer (core of 9-mer BEPI Proximity of MHC binding regions to BEPIs receptors prediction) exposure Pentamer matches (random probability of match = 20.sup.−10) (immunoglobulins) comparison between proteins BEPI probability classification matches between selected of interest (e.g. viral protein proteins vs multiple isoforms of all UniProt keyword screens proteins in human proteome) URL connection to internet resources in combination with MHC binding predictions Protein topology Neural Network Ensembles Amino acids of protein comprising extra-cellular domain Slider, graphical interface Amino acids of protein comprising intra-cellular domains compared to Web references Amino acids of protein comprising trans-membrane domains Signal peptides cleavage point
(544) Particular attention was focused on the C terminal loop of NS1 lying between amino acids 280 and 329, bounded by cysteine residues, and more particularly between 290 and 311, likewise bounded by cysteine residues. This region contains not only strong predicted B cell epitope but also a region of high WIC II binding for multiple alleles as shown in
(545) TABLE-US-00027 TABLE 27 Predicted MHC II binding of sequential peptides across NS1 280-329 for multiple flaviviruses. Prediction is the permuted population average across 28 alleles of MHC II Index amino Permuted average MHC II binding across 28 MHC II alleles acid Position# DEN1 DEN2 DEN3 DEN4 YF WNV ZIKV USUV 280 −0.55 −0.76 −0.74 −0.05 −0.56 −1.14 −0.60 −1.25 281 −0.38 −0.40 −0.67 0.05 −0.51 −0.90 −0.74 −1.02 282 −0.11 0.05 −0.63 0.10 −0.39 −0.44 −0.78 −0.71 283 0.10 0.40 −0.55 −0.04 −0.31 −0.04 −0.71 −0.49 284 0.06 0.43 −0.55 −0.28 −0.32 0.04 −0.75 −0.44 285 −0.17 0.28 −0.57 −0.39 −0.27 −0.08 −0.74 −0.50 286 −0.39 0.16 −0.63 −0.36 −0.13 −0.04 −0.80 −0.52 287 −0.39 0.19 −0.58 −0.40 0.16 0.05 −0.73 −0.44 288 −0.31 0.19 −0.44 −0.42 0.54 0.29 −0.59 −0.34 289 −0.38 0.04 −0.33 −0.47 0.85 0.41 −0.52 −0.31 290 −0.52 −0.24 −0.36 −0.56 0.98 0.35 −0.52 −0.40 291 −0.69 −0.56 −0.54 −0.67 1.01 0.17 −0.58 −0.54 292 −0.84 −0.82 −0.77 −0.76 0.89 −0.09 −0.65 −0.66 293 −0.88 −0.84 −0.82 −0.81 0.79 −0.26 −0.59 −0.64 294 −0.88 −0.87 −0.83 −0.83 0.52 −0.34 −0.59 −0.66 295 −0.91 −0.86 −0.84 −0.83 0.19 −0.38 −0.61 −0.68 296 −0.95 −0.88 −0.86 −0.85 −0.11 −0.49 −0.61 −0.70 297 −0.98 −0.84 −0.87 −0.84 −0.17 −0.52 −0.62 −0.69 298 −1.02 −0.87 −0.90 −0.86 −0.22 −0.56 −0.57 −0.71 299 −1.03 −0.93 −0.94 −0.83 −0.36 −0.64 −0.57 −0.76 300 −1.10 −1.02 −1.02 −0.88 −0.73 −0.84 −0.67 −0.82 301 −1.25 −1.16 −1.17 −1.03 −1.09 −1.08 −0.84 −0.93 302 −1.36 −1.17 −1.29 −1.10 −1.24 −1.14 −0.94 −0.88 303 −1.43 −1.21 −1.36 −1.19 −1.26 −1.19 −1.05 −0.93 304 −1.59 −1.47 −1.52 −1.43 −1.40 −1.48 −1.21 −1.27 305 −1.81 −1.81 −1.73 −1.70 −1.58 −1.88 −1.50 −1.73 306 −2.03 −2.13 −1.96 −2.01 −1.77 −2.26 −1.76 −2.14 307 −2.14 −2.25 −2.09 −2.13 −1.82 −2.42 −1.86 −2.31 308 −2.12 −2.19 −2.08 −2.07 −1.77 −2.36 −1.85 −2.22 309 −2.11 −2.20 −2.05 −2.07 −1.77 −2.33 −1.91 −2.22 310 −2.11 −2.19 −2.04 −2.08 −1.74 −2.33 −1.97 −2.22 311 −2.11 −2.20 −2.06 −2.13 −1.77 −2.36 −2.04 −2.26 312 −2.15 −2.23 −2.12 −2.19 −1.78 −2.44 −2.08 −2.34 313 −2.06 −2.10 −2.04 −2.14 −1.62 −2.35 −1.98 −2.26 314 −1.88 −1.85 −1.83 −2.05 −1.38 −2.10 −1.83 −2.06 315 −1.67 −1.57 −1.59 −1.95 −1.16 −1.80 −1.66 −1.80 316 −1.56 −1.40 −1.47 −1.93 −1.13 −1.62 −1.62 −1.65 317 −1.56 −1.40 −1.49 −1.99 −1.26 −1.62 −1.65 −1.66 318 −1.57 −1.44 −1.55 −1.99 −1.38 −1.69 −1.63 −1.72 319 −1.49 −1.36 −1.49 −1.93 −1.32 −1.63 −1.51 −1.63 320 −1.44 −1.33 −1.49 −1.91 −1.32 −1.57 −1.45 −1.64 321 −1.48 −1.42 −1.54 −1.89 −1.46 −1.58 −1.51 −1.79 322 −1.53 −1.56 −1.58 −1.86 −1.70 −1.62 −1.64 −1.99 323 −1.50 −1.64 −1.56 −1.76 −1.87 −1.66 −1.70 −2.11 324 −1.45 −1.65 −1.52 −1.68 −1.92 −1.67 −1.70 −2.12 325 −1.38 −1.61 −1.49 −1.66 −1.84 −1.61 −1.65 −2.05 326 −1.37 −1.61 −1.53 −1.70 −1.84 −1.60 −1.64 −2.08 327 −1.39 −1.64 −1.55 −1.73 −1.82 −1.61 −1.62 −2.08 328 −1.43 −1.67 −1.59 −1.77 −1.84 −1.63 −1.65 −2.15 329 −1.43 −1.66 −1.58 −1.76 −1.87 −1.64 −1.67 −2.13
(546) Analysis was then conducted of NS1 of the same set of flaviviruses in order to compare predicted B cell linear epitopes to the predicted B cell linear epitopes in the proteins of the human proteome which have a function related to cardiovascular function. Human proteins were selected for inclusion in this comparison if they were annotated in UniProt with one of the key words shown in Table 28.
(547) TABLE-US-00028 TABLE 28 Cardiovascular key words acetyl-transferring alpha-2-antiplasmin alpha-hemoglobin-stabilizing angio-associated angiogenesis angiogenic angiogenin angiomotin angiomotin-like angiopoietin-1 angiopoietin-2 angiopoietin-4 angiopoietin-like angiopoietin-related angiostatin angiotensin angiotensin-converting angiotensinogen antigen_chemokine antithrombin-iii ceruloplasmin chemokine chemokine-like chemokine-related chemotactic chemotaxin chemotaxin-2 chemotaxis coagulation c-reactive cyclotransferase cyclotransferase-like desmoplakin endoplasmic endoplasmin endoplasmin-like endothelial endothelin endothelin-1 endothelin-2 endothelin-3 endothelin-converting envoplakin envoplakin-like epiplakin erythroblast erythrocyte erythroid erythropoietic erythropoietin ferredoxin ferredoxin-fold ferric-chelate ferritin ferrochelatase fibrillarin fibrillarin-like fibrillary fibrillin-1 fibrillin-2 fibrillin-3 fibrinogen fibrinogen-like gamma-glutamylcyclotransferase hematological hematopoietic hematopoietically-expressed heme heme-binding hemochromatosis hemofiltrate hemogen hemoglobin hemojuvelin hemopexin lactotransferrin lipoma-preferred lvv-hemorphin-7 melanotransferrin microfibril-associated microfibrillar-associated mitoferrin-1 mitoferrin-2 neuferricin nucleoplasmin-2 nucleoplasmin-3 periplakin plakoglobin plakophilin-1 plakophilin-2 plakophilin-3 plakophilin-4 plasminogen plasminogen-like platelet platelet-activating platelet-derived prothrombin protoheme sarcoplasmic_endoplasmic serotransferrin thrombomodulin thrombopoietin thrombospondin thrombospondin-1 thrombospondin-2 thrombospondin-3 thrombospondin-4 thrombospondin-type thromboxane thromboxane-a transferrin uroplakin-1a uroplakin-1b uroplakin-2 uroplakin-3a uroplakin-3b uroplakin-3b-like vascular vasculin vasculin-like vasoactive vasodilator-stimulated vasohibin-1 vasohibin-2 vasopressin vasopressin-induced vasopressin-neurophysin vasorin vwf vwfa willebrand williams-beuren
(548) Peptide pentamer motifs were identified in flaviviruses which matched pentamer motifs in the cardiovascular protein set, where in both cases the pentamer occurred in a predicted linear B cell epitope. The resulting list was manually curated to exclude proteins which contained terms such as “domain containing” and to identify the proteins actually verified as related to or expressed in blood coagulation, platelets, endothelial cells and erythrocytes.
(549) Accession numbers of viruses used in identifying these were as shown in Table 29. Additional strains/isolates of all were used to evaluate conservation. Table 30 shows peptides found in dengue, Zika, and Usutu virus NS1 which have mimics in the human cardiovascular set proteins and which fulfill the B cell epitope criteria.
(550) TABLE-US-00029 TABLE 29 Accession numbers of viruses analyzed Polyprotein Polyprotein Nucleotide DBSource Flavivirus gi accession gi accession Zika Brazil SPH2015 969945757 ALU33341.1 969945756 KU321639.1 Zika Senegal ArD158084 592746966 AHL43504.1 592746965 KF383119.1 Dengue 1 Nauru/West Pac/1974 1854039 AAB70695.1 1854038 U88536.1 Dengue 1 Brazil 12898/BR-PE/10 511782627 AGN94866.1 5117826276 JX669462.1 Dengue 2 Thailand/16681/84 323473 AAA73185.1 323472 M84727.1 Dengue 2 Brazil 9479/BR-PE/10 511782661 AGN94883.1 511782660 JX669479.1 Dengue 3 Philippines 1956/H87 961377532 ALS05358.1 961377531 KU050695.1 Dengue 3 Brazil 2009 389565793 AFK83755.1 389565792 JF808120.1 D3BR/AL95/2009 Dengue 4 Thailand/0476/1997 53653743 AAU89375.1 53653742 AY618988.1 Dengue 4 Brazil DENV-4/BEL83791 418715828 AFX65871.1 418715827 JQ513335.1 Yellow Live Attenuated 564014615 AHB63684.1 564014614 KF769015.1 fever Yellow Fever Vaccine 17D-204 Yellow Peru 2007 “case #2” 256274854 ACU68590.1 256274853 GQ379163.1 fever West Nile West Nile Virus 90025138 ABD85073.1 90025137 DQ431702.1 04-216CO Japanese JEV SA-14 331332 AAA46248.1 331331 M55506.1 encephalitis Tick-borne TBEV Neudoerfl 975238 AAA86870.1 975237 U27495.1 encephalitis Usutu Usutu virus strain Italia 339831600 AEK21245.1 339831599 JF266698 2009
(551) TABLE-US-00030 TABLE 30 Epitope mimics in NS1 proteins Virus B cell Proteome B cell query SEQ Virus Human protein annotation (short) probability## probability## penta ID NO: DEN1 A disintegrin and metalloproteinase −1.12 −0.23 SLRTT SEQ 1106 with thrombospondin motifs 13 ADAMTS13 DEN2 A disintegrin and metalloproteinase −1.45 −0.23 SLRTT SEQ 1106 with thrombospondin motifs 13 ADAMTS13 DEN3 A disintegrin and metalloproteinase −1.19 −0.23 SLRTT SEQ 1106 with thrombospondin motifs 13 ADAMTS13 DEN4 A disintegrin and metalloproteinase −1.34 −0.23 SLRTT SEQ 1106 with thrombospondin motifs 13 ADAMTS13 DEN3 Coagulation factor V −0.26 −1.01 ASRAW SEQ 1107 DEN3 Coagulation factor VIII −0.72 −0.25 IDGPS SEQ 1108 DEN4 Coagulation factor VIII −0.50 −0.57 KGKRA SEQ 1109 DEN4 Plasminogen −1.09 −0.21 IFTPE SEQ 1110 DEN1 Plasminogen −0.94 −1.03 TTVTG SEQ 1111 DEN3 Platelet glycoprotein Ib beta chain −0.84 −1.34 SLAGP SEQ 1112 ZIKV Platelet glycoprotein Ib beta chain −0.79 −1.34 SLAGP SEQ 1118 DEN3 Vascular endothelial growth factor A −0.62 −1.19 SASRA SEQ 1113 ZIKV Vascular endothelial growth factor B −1.51 −1.64 PDSPR SEQ 1114 DEN2 Vascular endothelial growth factor −0.67 −0.80 AGKRS SEQ 1115 receptor 1 DEN3 Vascular endothelial growth factor −0.58 −1.06 LEQGK SEQ 1116 receptor 1 DEN4 Vascular endothelial growth factor −0.52 −0.43 KNSTF SEQ 1117 receptor 2 ZIKV von Willebrand factor −0.53 −0.97 EECPG SEQ 1119 ZIKV von Willebrand factor −0.86 −0.15 EETCG SEQ 1120 ZIKV von Willebrand factor −0.64 −0.46 VEETC SEQ 1121 USUV Platelet endothelial aggregation −0.93 −0.98 SSGRL SEQ 1122 receptor 1 USUV Platelet glycoprotein Ib beta chain −1.01 −1.72 LAGPR SEQ 1123 ##B cell probabilities are shown in inverse standard deviation units. More negative scores are more likely B cell epitopes in the corresponding protein.
(552) Some of these mimics may vary depending on the strain of dengue virus, and it will be clear to those skilled in the art that adjustments may be needed on a geographic basis or over time to adapt to changes in mimics which may affect clinical outcome. However, in particular it was noted that all dengue viruses contained a conserved motif SLRTT located in the stable C terminal loop of NS1 between two cysteine bonds [61] at positions 290-311 of the NS1 protein which corresponds to a motif in the C terminal region of ADAMTS13. ADAMTS13 is expressed in endothelial cells and is essential to cleavage to von Willebrand factor. A deficiency of ADAMTS13 is associated with accumulation of multimers of von Willebrand factor, intravascular platelet aggregation, and thrombocytopenia, both congenital and acquired [70, 71]. ADAMTS is expressed in endothelial cells. Other motifs were found in coagulation factors V and VIII, von Willebrand factor and in platelet glycoprotein 1B beta which is also associated with acquired autoimmune thrombocytopenia [72] and is expressed in both platelets and endothelial cells. Notably these epitope mimic motifs for cardiovascular function proteins are not present in West Nile virus.
(553) Development of transient autoimmunity to these motifs may arise on initial dengue infection but be exacerbated on re-exposure to a further dengue serotype, potentially further boosted by antibody dependent enhancement, thereby contributing to hemorrhagic signs characteristic of dengue hemorrhagic fever. It would be beneficial to remove such epitopes in a vaccine containing NS1 to preclude sensitization to an anamnestic autoimmune response on exposure to wildtype virus of any of the dengue serotypes.
(554) NS1 Vaccine Constructs with Mimics Removed
(555) Vaccines may be designed to elicit an immune response to other epitopes but avoid an immune response to epitopes which may elicit an autoimmune response. Examples of such constructs are shown below, however it should be appreciated that these are examples which are not limiting. Vaccines may comprise synthetic polypeptides alone or as fusions to an immunoglobulin or other fusion protein and may be operatively linked by various linkers including an enterokinase linker as shown here. In the case of dengue, we show an illustrative example for dengue serotype 2 native protein construct followed by a mimic, however following a similar logic, analogous NS1 sequences may be made for other serotypes in which the principal mimic epitopes are removed. In reviewing Usutu virus it was also noted that the motif TTTSS (SEQ ID NO.: 1125) generates a high probability mimic matching human myeloid differentiation factor and RTTTS (SEQ ID NO.: 1124) matching Synaptopodin 2 (Table 31) these were also removed. The mutant sequences were reviewed to ensure that no new adverse mimics were created.
(556) TABLE-US-00031 TABLE 31 Neurologic function mimics in Usutu NS1 USUV Synaptopodin 2 −1.88 −0.5 RTTTS SEQ 1124 USUV Myeloid differentiation −1.82 −2.14 TTTSS SEQ 1125 factor
(557) Seq.1126. DEN2_NS1 SA, Nucleotide Sequence 7-81 Signal peptide 82-1134 DEN2-NS1 from POLG DEN26
(558) Seq.1127. DEN2_NS1 SA, Amino Acid Sequence 3-27 Signal peptide 28-378 DEN2-NS1 from POLG DEN26
(559) Seq.1128. ZIKV-NS1 SA, Nucleotide Sequence 7-78 Signal peptide 79-1134 ZIKV-NS1 from SPH2015
(560) Seq.1129. ZIKV-NS1 SA, Amino Acid Sequence 3-26 Signal peptide 27-378 ZIKV-NS1 from SPH2015
(561) Seq.1130. Usutu-NS1 SA, Nucleotide Sequence 7-78 Signal peptide 79-1134 Usutu-NS1
(562) Seq.1131. Usutu-NS1 SA, Amino Acid Sequence 3-26 Signal peptide 27-378 Usutu-NS1
(563) Seq.1132. DEN2_NS1-EKL-hG1(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-1131 DEN2 NS1 from POLG DEN26 1132-1155 Enterokinase Linker 1162-1857 hG1(CH2-CH3) Constant region
(564) Seq.1133. DEN2_NS1-EKL-hG1(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 24-377 DEN2 NS1 from POLG DEN26 378-385 Enterokinase Linker 388-619 hG1(CH2-CH3) Constant region
(565) Seq.1134. ZIKV_NS1-EKL-hG1(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-1131 ZIKV_NS1 from SPH2015 1132-1155 Enterokinase Linker 1162-1857 hG1(CH2-CH3) Constant region
(566) Seq.1135. ZIKV_NS1-EKL-hG1(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 24-377 ZIKV_NS1 from SPH2015 378-385 Enterokinase Linker 388-619 hG1(CH2-CH3) Constant region
(567) Seq.1136. Usutu_NS1-EKL-hG1(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-1131 Usutu_NS1 1132-1155 Enterokinase Linker 1162-1857 hG1(CH2-CH3) Constant region
(568) Seq.1137. Usutu_NS1-EKL-hG1(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 24-377 Usutu_NS1 378-385 Enterokinase Linker 388-619 hG1(CH2-CH3) Constant region
Example 17: NS1 Loops for Diagnostics
(569) The C terminal loop of NS1 proteins of flaviviruses is highly conserved within strains of each virus. In NS1 the peptide sequence lying between cysteines at 290 and 311 is unique to each flavivirus, but highly conserved among strains of that flavivirus. This loop also comprises a strong B cell epitope. In dengue the loop comprises the motif SLRTT (SEQ ID NO.: 1106) which as described above is a mimic for the human protein ADAMTS13. Table 32 shows the alignment for various flaviviruses of interest. By assembling peptides comprising the 290-311 sequence a loop is formed stabilized by the C—C bonds. As seen in Table 32 the loop comprises the sequence CXXRGXXXRXTTXXGRXXXXWC (SEQ ID NO: 1245) in all flavivruses of interest but is unique to each virus of interest. Therefore, an array comprising variations on this generic sequence structure provides a diagnostic array. An array of the 290-311 loops and derivative constructs thereof can thus serve as a differential diagnostic to differentiate antibody responses to the flaviviruses.
(570) The loop thus formed by a C—C bond may be expressed operably associated as a fusion with an indicator label peptide such as GFP or luciferase or other label peptides. In yet other embodiments an adherent tag or anchor peptide such as a histidine tag or a FLAG tag may be expressed as a fusion with the loop. Said label or anchor peptide may be positioned at the N terminus or the C terminus of the loop peptide. In yet further embodiments the loop may be expressed with both indicator and adherent tags simultaneously.
(571) The loop peptides may be utilized in an ELISA, a dot blot, a bead attached peptide or in many other serodiagnostic configurations, so that these examples are not considered limiting. Negative control loop peptides are constructed containing a pentamer “scrambled” motif not present in any flavivirus.
(572) TABLE-US-00032 TABLE 32 Comparative amino acid distribution on C terminal loop of NS1 YF DEN1 DEN2 DEN3 DEN4 ZIKV WNV JEV TBEV SLE USUV scramble 290 C C C C C C C C C C C C 291 D G G G D G E S D G G G 292 G N N T H T H K K N K T 293 R R R R R R R R R R R R 294 G G G G G G G G G G G G 295 K P P P P P P P A A P P 296 S S S S S S A S S S S S 297 T L L L L L A V V L I L 298 R R R R R R R R R R R R 299 S T T T T S T T S T T M 300 T T T T T T T T T T T T 301 T T T T T T T T T T T T 302 D V A V A A E D E A S V 303 S T S S S S S S S S S M 304 G G G G G G G G G G G G 305 K K K K K R K K K K R R 306 V I L L L V L L V L L V 307 I I I I V I I I I V V I 308 P H T H T E T T P T T E 309 E E E E Q E D D E D D E 310 W W W W W W W W W W W W 311 C C C C C C C C C C C C
(573) Exemplary sequences are provided below for dengue Zika, Usutu, and West Nile viruses plus a scrambled mimic control. We note that early African Usutu viruses have a sequence CGKRGPSIRTTTNSGRLVTDWC but the 302 N is replaced by a serine in current European sequences and thus this is adopted here for diagnostic purposes.
(574) TABLE-US-00033 TABLE 33 Loop sequences from NS1 of flaviviruses of interest YF CDGRGKSTRSTTDSGKVIPEWC SEQ 1138 DEN1 CGNRGPSLRTTTVTGKIIHEWC SEQ 1139 DEN2 CGNRGPSLRTTTASGKLITEWC SEQ 1140 DEN3 CGTRGPSLRTTTVSGKLIHEWC SEQ 1141 DEN4 CDHRGPSLRTTTASGKLVTQWC SEQ 1142 ZIKV CGTRGPSLRSTTASGRVIEEWC SEQ 1143 WNV CEHRGPAARTTTESGKLITDWC SEQ 1144 JEV CSKRGPSVRTTTDSGKLITDWC SEQ 1145 TBEV CDKRGASVRSTTESGKVIPEWC SEQ 1146 SLE CGNRGASLRTTTASGKLVTDWC SEQ 1147 USUV CGKRGPSIRTTTSSGRLVTDWC SEQ 1148 Scramble CGTRGPSLRMTTVMGRVIEEWC SEQ 1149
(575) Exemplary constructs are provided for expression of some the above “loop” diagnostic sequences as synthetic polypeptides with a label sequence at the C terminal end. Those skilled in the art will understand that the label GFP sequences shown could be replaced by other labels or anchor sequences such as a his tag and similarly will understand how to make similar constructs for the other flaviruses. Further such a skilled artisan will be able to place the label or anchor at the N terminal end of the loop.
(576) Seq. 1150. ZikVLoop-Link-GFP, Nucleotide Sequence 4-69 ZikV Loop Region 76-90 Linker 91-807 GFP
(577) Seq.1151. ZikVLoop-Link-GFP, Amino Acid Sequence 2-23 ZikV Loop Region 26-30 Linker 31-269 GFP
(578) Seq.1152. ScrambleLoop-Link-GFP, Nucleotide Sequence 4-69 Scramble Loop Region 76-90 Linker 91-807 GFP
(579) Seq.1153. ScrambleLoop-Link-GFP, Amino Acid Sequence 2-23 Scramble Loop Region 26-30 Linker 31-269 GFP
(580) Seq.1154. YellowFeverLoop-Link-GFP, Nucleotide Sequence 4-69 Yellow Fever Loop Region 76-90 Linker 91-807 GFP
(581) Seq.1155. YellowFeverLoop-Link-GFP, Amino Acid Sequence 2-23 Yellow Fever Loop Region 26-30 Linker 31-269 GFP
(582) Seq.1156. WestNileLoop-Link-GFP, Nucleotide Sequence 4-69 West Nile Loop Region 76-90 Linker 91-807 GFP
(583) Seq.1157. WestNileLoop-Link-GFP, Amino Acid Sequence 2-23 West Nile Loop Region 26-30 Linker 31-269 GFP
(584) Seq.1158. Dengue2Loop-Link-GFP, Nucleotide Sequence 4-69 Dengue2 Loop Region 76-90 Linker 91-807 GFP
(585) Seq.1159. Dengue2Loop-Link-GFP, Amino Acid Sequence 2-23 Dengue2 Loop Region 26-30 Linker 31-269 GFP
(586) Seq.1160. UsutuLoop-Link-GFP, Nucleotide Sequence 4-69 Usutu Loop Region 76-90 Linker 91-807 GFP
Example 18: Epitopes in Usutu Virus Structural Proteins
(587)
(588) Tables 9-11 shows predicted B cell epitope mimics in these structural proteins of USUV for neurologic proteins, microcephaly related proteins and cardiovascular proteins.
(589) TABLE-US-00034 TABLE 34 Neurologic protein mimics in USUV structural proteins B cell epitope USUV protein B cell epitope probability in Human protein SEQ Pentamer probability in human Envelope ID NO: motif virus protein Uniprot identifier Myelin- SEQ 1161 ETEAT −0.65 −1.74 Q5SUK5_HUMAN oligodendrocyte glycoprotein Synaptotagmin-like SEQ 1162 PTTGE −1.60 −0.66 SYTL2_HUMAN protein 2 Synaptopodin-2 SEQ 1163 KSGVT −0.77 −0.41 SYNP2_HUMAN Neuroendocrine SEQ 1164 GKGSI −0.54 −0.55 NEC2_HUMAN convertase 2 Putative SEQ 1165 GSTSS −1.41 −1.49 NBPF7_HUMAN neuroblastoma breakpoint family member 7 Synaptotagmin-16 SEQ 1166 STSSD −1.75 −1.78 SYT16_HUMAN Neurobeachin-like SEQ 1167 QLGAS −1.33 −0.43 NBEL2_HUMAN protein 2 Ceroid-lipofuscinosis SEQ 1168 QLGAS −1.33 −0.78 CLN6_HUMAN neuronal protein 6 Synaptogyrin-3 SEQ 1169 GASQA −1.24 −1.20 SNG3_HUMAN Synapsin-1 SEQ 1170 ASQAG −1.00 −0.49 SYN1_HUMAN Synaptopodin 2-like SEQ 1171 SQAGR −0.78 −0.47 A6NCR3_HUMAN protein Synaptotagmin-8 SEQ 1172 SPASS −1.42 −1.15 F8WBL4_HUMAN Motor neuron and SEQ 1167 SPASS −1.42 −0.93 MNX1_HUMAN pancreas homeobox protein 1 Hematological and SEQ 1173 SPASS −1.42 −0.71 HN1_HUMAN neurological expressed 1 protein Neurobeachin-like SEQ 1174 LTSGH −0.59 −1.10 NBEL2_HUMAN protein 2 Neurogenic locus SEQ 1175 LKGTT −0.73 −0.40 NOTC1_HUMAN notch homolog protein 1 Synaptosomal- SEQ 1176 VASSE −1.21 −0.41 SNP29_HUMAN associated protein 29 Myelin transcription SEQ 1177 ASSEA −1.32 −0.58 MYT1_HUMAN factor 1 Calcineurin subunit B SEQ 1178 GDKQI −0.83 −0.91 H7BYZ3_HUMAN type 1 CMP-N- SEQ 1179 AGSSI −1.28 −0.63 SIA8D_HUMAN acetylneuraminate- poly-alpha-2 PrM SEQ 1180 Neurobeachin-like SEQ 1181 STKAS 0.83 −1.50 NBEL1_HUMAN protein 1
(590) TABLE-US-00035 TABLE 35 Cardiovascular protein mimics in USUV structural proteins USUV protein B cell epitope B cell epitope Human protein SEQ probability in probability in Envelope ID NO: Pentamer motif virus human protein Uniprot identifier Brain-specific SEQ 1182 AKDKP −0.76 −1.85 A2A3C1_HUMAN angiogenesis inhibitor 2 Lymphatic vessel SEQ 1183 RAEDT −1.15 −0.43 F2Z296_HUMAN endothelial hyaluronic acid receptor 1 Vasopressin V2 SEQ 1184 SGVTD −1.01 −0.60 V2R_HUMAN receptor Uroplakin-3b SEQ 1185 GSIDT −0.64 −0.89 A6NHH5_HUMAN Plakophilin-4 SEQ 1186 GSTSS −1.41 −1.69 PKP4_HUMAN Erythroid SEQ 1187 STSSD −1.75 −2.00 EDRF1_HUMAN differentiation- related factor 1 Vascular SEQ 1188 SSQLG −1.12 −0.65 VEGFB_HUMAN endothelial growth factor B Serotransferrin SEQ 1189 LGASQ −1.34 −1.17 F8WC57_HUMAN Endothelial PAS SEQ 1190 TPNSP −1.15 −1.81 EPAS1_HUMAN domain- containing protein 1 C-C motif SEQ 1191 WTSPA −1.17 −0.57 CCL19_HUMAN chemokine 19 Endothelial SEQ 1192 SPASS −1.42 −2.00 GATA2_HUMAN transcription factor GATA-2 Hematological SEQ 1193 SPASS −1.42 −0.71 HN1_HUMAN and neurological expressed 1 protein C-C motif SEQ 1194 ALGSQ −0.76 −0.53 CCL23_HUMAN chemokine 23 Erythrocyte SEQ 1195 QEGAL −0.88 −0.70 EPB42_HUMAN membrane protein band 4_2 Desmoplakin SEQ 1196 TGSDG −1.52 −1.70 DESP_HUMAN Endothelial cell- SEQ 1197 SSEAN −1.25 −0.50 ECSCR_HUMAN specific chemotaxis regulator
(591) TABLE-US-00036 TABLE 36 Microcephaly related protein mimics in USUV structural proteins B cell B cell epitope USUV protein epitope probability Human protein SEQ Pentamer probability in human Envelope ID NO: motif in virus protein Uniprot identifier CCDC19 protein SEQ 1198 METEA −0.54 −1.06 Q05BA3_HUMAN Centrosomal protein of 78 kDa SEQ 1199 STVSN −0.62 −0.87 A8MST6_HUMAN CDK5 and ABL1 enzyme SEQ 1200 KSGVT −0.77 −0.29 CABL2_HUMAN substrate 2 Centrosomal protein SEQ 1201 STSSD −1.75 −0.32 KIZ_HUMAN kizuna Centromere protein V SEQ 1202 ASQAG −1.00 −1.20 CENPV_HUMAN Microcephalin SEQ 1203 SPASS −1.42 −0.94 MCPH1_HUMAN CDK5 regulatory subunit- SEQ 1204 QEGAL −0.88 −0.73 CK5P2_HUMAN associated protein 2 Centromere protein O SEQ 1205 QEGAL −0.88 −1.57 CENPO_HUMAN Microcephalin SEQ 1206 SGSVK −0.28 −0.60 MCPH1_HUMAN Cdc42 effector protein 3 SEQ 1207 LSDLT −0.51 −0.37 BORG2_HUMAN Protein CASC5 SEQ 1208 SSEAN −1.25 −1.34 CASC5_HUMAN Centromere_kinetochore SEQ 1209 GAQRL −0.53 −0.84 ZW10_HUMAN protein zw10 homolog Centrosomal protein of 192 kDa SEQ 1210 ALGDT −0.39 −0.33 E9PF99_HUMAN
(592) In particular the following mimics were considered potentially adverse in a vaccine and constructs are provided for sequences in which these mimics have been substituted by other motifs: ETEAT (SEQ ID NO.: 1161), STSSD (SEQ ID NO.: 1166), SSQLG (SEQ ID NO.: 1188), SPASS (SEQ ID NO.: 1192), SGSVK (SEQ ID NO.: 1206), ASSEA (SEQ ID NO.: 1177). The mutant sequences were reviewed to ensure that no new adverse mimics were created.
(593) Seq.1211. E_KJ438705env SA, Nucleotide Sequence 1-63 Signal peptide 70-1569 E_KJ438705 envelope protein
(594) Seq.1212. E_KJ438705env SA, Amino Acid Sequence 1-21 Signal peptide 24-523 E_KJ438705 envelope protein
(595) Seq.1213. E_KJ438705-EKL-hG1(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-1569 E_KJ438705 envelope protein 1570-1593 Enterokinase Linker 1600-2295 hG1(CH2-CH3) Constant region
(596) Seq.1214. E_KJ438705-EKL-hG1(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 24-523 E_KJ438705 envelope protein 524-531 Enterokinase Linker 534-765 hG1(CH2-CH3) Constant region
(597) Seq.1215. MutantUSUV_Env SA, Nucleotide Sequence 1-63 Signal peptide 70-1569 MutantUSUV envelope protein
(598) Seq.1216. MutantUSUV_Env SA, Amino Acid Sequence 1-21 Signal peptide 24-523 MutantUSUV envelope protein
(599) Seq.1217. MutantUSUV-EKL-hG1(CH2-CH3), Nucleotide Sequence 1-63 Signal peptide 70-1569 MutantUSUV envelope protein 1570-1593 Enterokinase Linker 1600-2295 hG1(CH2-CH3) Constant region
(600) Seq.1218. MutantUSUV-EKL-hG1(CH2-CH3), Amino Acid Sequence 1-21 Signal peptide 24-523 MutantUSUV envelope protein 524-531 Enterokinase Linker 534-765 hG1(CH2-CH3) Constant region
(601) Diagnostic Applications to Differentiate USUV
(602) Epitope pentamers were selected from USUV which are conserved and which are distinct from other co-endemic flaviviruses. These were evaluated against other flaviviruses and a subset of pentamers identified which can be included in a diagnostic peptide array to distinguish Usutu virus.
(603) From the envelope the following peptides were selected from USUV as shown in Table 37
(604) TABLE-US-00037 TABLE 37 Peptides from USUV envelope protein for diagnostic arrays SEQ B Cell Epitope Position in SEQ ID NO: Pentamer probability USUV ENV Flanking regions ID NO: SEQ 1219 PTTGE −1.60 77 TGEAHNPKRAEDTYV 1287 SEQ 1220 NPKRA −1.76 84 KRAEDTYVCKSGVTD 1288 SEQ 1221 SSDTH −2.09 150 DTHGNYSSQLGASQA 1289 SEQ 1222 HGNYS −1.35 154 NYSSQLGASQAGRFT 1290 SEQ 1223 PNSPA −1.19 173 SPAITVKMGDYGEIS 1291 SEQ 1224 PRNGL −1.13 194 NGLNTEAYYIMSVGT 1292 SEQ 1225 TSPAS −1.27 228 PASSNWRNREILLEF 1293 SEQ 1226 PASSN −1.52 230 SSNWRNREILLEFEE 1294 SEQ 1227 PHATK −1.17 247 ATKQSVVALGSQEGA 1295 SEQ 1228 FAKNP −1.04 312 KNPADTGHGTVVLEL 1296 SEQ 1229 TGSDG −1.52 331 SDGPCKIPISIVASL 1297 SEQ 1230 ASSEA −1.32 364 SEANAKVLVEMEPPF 1298
(605) These pentamers were determined to be highly conserved in 68 USUV envelope proteins examined. Cross reactivity was checked against a panel of other flaviviruses and the E2 protein of chikungunya. Table 38 shows that there is little cross reactivity except in those peptides designated as “PanFlavi”. Furthermore peptides previously selected as distinguishing epitopes of the other flaviviruses (see, e.g., copending U.S. Prov. Applications 62/286,779; 62/290,616; 62/292,964; 62/306,264; 62/321,375; and 62/350,881; each of which is incorporated herein by reference in its entirety) were shown to be absent from the 68 USUV envelope proteins examined.
(606) TABLE-US-00038 TABLE 38 B cell Posi- SEQ SEQ Peptide epitope tion ID Penta- ID Den Virus # probaility in ENV Flanking regions NO.: mer NO.: N1 Den2 Den3 Den4 YF WNV ZILV Chik USUV DEN1 1 −1.04 51 ELLKTEVTNPAVLRK 446 EVTNP 519 186 0 0 0 0 0 0 0 0 DEN1 2 −1.84 168 IATITPQAPTSEIQL 447 PQAPT 520 187 0 0 0 0 0 0 0 0 DEN1 3 −2.09 227 WTSGASTSQETWNRQ 448 STSQE 521 188 0 0 0 0 0 0 0 0 DEN1 4 −1.57 272 TGATEIQTSGTTTIF 449 IQTSG 522 192 0 3 0 0 0 0 0 0 DEN1 5 −1.55 329 VQVKYEGTDAPCKTP 450 EGTDA 523 190 0 0 0 0 0 0 0 0 DEN1 6 −1.77 344 FLTQDEKGVTQNGRL 451 EKGVT 524 185 0 0 0 0 0 0 0 0 DEN1 7 −0.99 361 ANPIVTDKEKPVNIE 452 TDKEK 525 191 0 0 0 0 0 0 0 0 DEN1 8 −1.55 371 PVNIETEPPFGESYI 453 TEPPF 526 191 0 0 0 0 0 0 0 0 DEN2 1 −1.65 226 WLPGADTQGSNWIQK 454 DTQGS 527 0 215 0 0 0 0 0 0 0 DEN2 2 −1.13 228 PGADTQGSNWIQKET 455 QGSNW 528 0 215 0 0 0 0 0 0 0 DEN2 3 −1.44 244 VTFKNPHAKKQDVVV 456 PHAKK 529 0 215 0 0 0 0 0 0 0 DEN2 4 −1.74 328 IRVQYEGDGSPCKIP 457 EGDGS 530 0 215 0 0 0 0 0 0 0 DEN2 5 −1.27 330 VQYEGDGSPCKIPFE 458 DGSPC 531 0 215 0 0 0 0 0 0 0 DEN2 6 −1.28 362 PIVTEKDSPVNIEAE 459 KDSPV 532 0 212 0 0 0 0 0 0 0 DEN2 7 −1.53 370 PVNIEAEPPFGDSYI 460 AEPPF 533 1 215 208 0 0 0 0 0 0 DEN2 8 −1.14 372 NIEAEPPFGDSYIIV 461 PPFGD 534 0 215 0 433 48 0 0 0 66 DEN3 1 −1.49 154 QHQVGNETQGVTAEI 462 NETQG 535 0 0 206 0 0 0 0 0 0 DEN3 2 −2.03 224 WTSGATTETPTWNRK 463 TTETP 536 0 0 205 0 0 0 0 0 0 DEN3 3 −1.63 269 TGATEIQNSGGTSIF 464 IQNSG 537 0 0 203 0 0 0 0 0 0 DEN3 4 −1.63 311 VLKKEVSETQHGTIL 465 VSETQ 538 0 0 208 0 0 0 0 0 0 DEN3 5 −1.24 327 KVEYKGEDAPCKIPF 466 GEDAP 539 0 0 145 0 0 0 0 0 0 DEN3 6 −1.02 327 KVEYKGEDVPCKIFF 467 GEDVP 540 0 0 62 0 0 0 0 0 0 DEN3 7 −1.31 336 PCKIPFSTEDGQGKA 468 FSTED 541 0 0 208 0 0 0 0 0 0 DEN3 8 −1.17 360 PVVTKKEEPVNIEAE 469 KEEPV 542 0 0 191 0 0 0 0 0 0 DEN3 9 −1.57 369 VNIEAEPPFGESNIV 470 EPPFG 543 192 215 208 433 0 0 0 0 66 DEN4 1 −1.18 48 DFELTKTTAKEVALL 471 KTTAK 544 0 0 0 431 0 0 0 0 0 DEN4 2 −1.68 155 HAVGNDTSNHGVTAT 472 DTSNH 545 0 0 0 430 0 0 0 0 0 DEN4 3 −1.59 166 VTATITPRSPSVEVE 473 TPRSP 546 0 0 0 433 0 0 0 0 0 DEN4 4 −1.62 272 GATEVDSGDGNHMFA 474 DSGDG 547 0 0 0 424 0 0 0 0 0 DEN4 5 −1.29 315 DKEMAETQHGTTVVK 475 ETQHG 548 192 215 208 433 5 0 0 0 0 DEN4 6 −1.44 328 VKVKYEGAGAPCKVP 476 EGAGA 549 0 0 0 431 0 0 0 0 0 DEN4 7 −1.06 358 ISSIPLAENTNSVTN 477 LAENT 550 0 0 0 431 0 0 0 0 0 DEN4 8 −1.05 362 PLAENTNSVTNIELE 478 TNSVT 551 0 0 0 423 0 0 0 0 0 PAN 1 313 ETQHG 548 192 215 208 433 0 0 0 0 0 DEN PAN 2 369 EPPFG 549 192 215 208 433 0 51 0 0 67 DEN PAN 3 99 DRGWG 550 192 215 208 433 48 50 41 0 66 DEN PAN 4 185 SPRTG 551 192 215 207 0 0 0 0 0 0 DEN PAN 5 404 TARGA 552 192 0 207 0 0 0 0 0 0 DEN PAN 6 394 GSSIG 553 192 214 208 433 48 51 0 0 68 DEN PAN 7 74 RCPTQ 554 192 215 208 433 0 0 41 0 0 DEN PAN 8 370 PPFGD 555 0 215 0 433 48 51 41 0 66 DEN YF 1 −1.04 52 ETVAIDRPAEVRKVC 479 DRPAE 560 0 0 0 0 4 0 0 0 YF 2 −1.25 150 HVGAKQENWNTDIKT 480 QENWN 561 0 0 0 0 39 0 0 0 YF 3 −1.22 165 LKFDALSGSQEVEFI 481 LSGSQ 562 0 0 0 0 48 0 0 0 YF 4 −1.08 218 DLTLPWQSGSGGVWR 482 WQSGS 563 0 0 0 0 48 0 0 0 YF 5 −1.50 250 VLALGNQEGSLKTAL 483 NQEGS 564 0 0 0 0 44 0 0 0 YF 6 −1.73 267 AMRVTKDTNDNNLYK 484 KDTND 565 0 0 0 0 25 0 0 0 YF 7 −2.21 311 FFVKNPTDTGHGTVV 485 PTDTG 566 0 0 0 0 47 0 0 0 YF 8 −1.30 358 VNPIASTNDDEVLIE 486 STNDD 567 0 0 0 0 46 0 0 0 YF 9 −1.61 356 VTVNPIASTNDDEVL 487 IASTN 568 0 0 0 0 48 0 0 0 YF 10 −1.03 369 VLIEVNPPFGDSYII 488 NPPFG 569 0 0 0 0 48 0 0 0 WNV 1 −1.52 38 TIMSKDKPTIDVKMM 489 DKPTI 1247 0 0 0 0 0 49 0 0 0 WNV 2 −1.11 148 FVHGPTTVESHGKIG 490 TTVES 1248 0 0 0 0 0 51 0 0 0 WNV 3 −1.21 188 VTVDCEPRSGIDTSA 491 EPRSG 1249 0 0 0 433 0 51 0 0 0 WNV 4 −1.07 253 SVVALGSQEGALHQA 492 GSQEG 1250 192 215 208 432 0 51 40 0 0 WNV 5 −0.81 295 EKLQLKGTTYGVCSK 493 KGTTY 1251 0 0 0 0 0 51 0 0 0 WNV 6 −1.86 312 KFARTPADTGHGTVV 494 PADTG 1252 0 0 0 0 0 51 0 0 0 WNV 7 −1.50 327 LELQYTGTDGPCKVP 495 TGTDG 1253 0 0 0 0 0 49 0 0 0 WNV 8 −0.90 385 YIVVGRGEQQINHHW 496 RGEQQ 1254 0 0 0 0 0 51 0 0 0 ZIKV 1 −0.62 16 DFVEGMSGGTWVDIV 497 MSGGT 1255 0 0 0 0 0 0 41 0 0 ZIKV 2 −1.21 38 TVMAQDKPTVDIELV 498 DKPTV 1256 0 0 0 0 0 0 41 0 0 ZIKV 3 −1.41 86 AYLDKQSDTQYVCKR 499 QSDTQ 570 0 0 0 0 0 0 41 0 0 ZIKV 4 −1.37 128 SKKMTGKSIQPENLE 500 GKSIQ 571 0 0 0 0 0 0 41 0 0 ZIKV 5 −0.84 145 IMLSVHGSQHSGMIV 501 HGSQH 572 0 0 0 0 0 0 41 0 0 ZIKV 6 −2.20 159 VNDTGHETDENRAKV 502 HETDE 573 0 0 0 0 0 0 41 0 0 ZIKV 7 −2.01 172 KVEITPNSPRAEATL 503 PNSPR 574 0 0 0 0 0 0 41 0 0 ZIKV 8 −1.70 175 ITPNSPRAEATLGGF 504 PRAEA 575 0 0 0 0 0 0 41 0 0 ZIKV 9 −1.55 233 AGADTGTPHWNNKEA 505 GTPHW 576 0 0 0 0 0 0 41 0 0 ZIKV 10 −1.47 282 EMDGAKGRLSSGHLK 506 KGRLS 577 0 0 0 0 0 0 41 0 0 ZIKV 11 −1.56 335 EVQYAGTDGPCKVPA 507 GTDGP 578 0 0 0 0 0 50 40 0 0 ZIKV 12 −1.14 365 ITANPVITESTENSK 508 VITES 579 0 0 0 0 0 0 41 0 0 ZIKV 13 −1.51 368 NPVITESTENSKMML 509 ESTEN 580 0 0 0 0 0 0 41 0 0 ZIKV 14 −1.05 370 VITESTENSKMMLEL 510 TENSK 581 0 0 0 0 0 0 41 0 0 CHIK 1 −1.14 40 ALERIRNEATDGTLK 511 RNEAT 582 0 0 0 0 0 0 0 30 0 CHIK 2 −1.21 144 GREKFHSRPQHGKEL 512 HSRPQ 583 0 0 0 0 0 0 0 30 0 CHIK 3 −1.18 249 VPRNAELGDRKGKIH 513 EFGDR 584 0 0 0 0 0 0 0 30 0 CHIK 4 −1.46 274 RVPKARNPTVTYGKN 514 RNPTV 585 0 0 0 0 0 0 0 30 0 CHIK 5 −1.14 276 PKARNPTVTYGKNQV 515 PTVTY 586 0 0 0 0 0 0 0 30 0 CHIK 6 −1.27 303 SYRNMGEEPNYQEEW 516 GEEPN 587 0 0 0 0 0 0 0 30 0 CHIK 7 −0.70 334 EVTWGNNEPYKYWPQ 517 NNEPY 588 0 0 0 0 0 0 0 30 0 CHIK 8 −1.33 347 PQLSTNGTAHGHPHE 518 NGTAH 589 0 0 0 0 0 0 0 30 0 USUV 1 −1.60 77 TGEAHNPKRAEDTYV 1287 PTTGE 1219 0 0 0 0 0 0 0 0 68 USUV 2 −1.76 84 KRAEDTYVCKSGVTD 1288 NPKRA 1220 0 0 0 0 0 0 0 0 68 USUV 3 −2.09 150 DTHGNYSSQLGASQA 1289 SSDTH 1221 0 0 0 0 0 0 0 0 67 USUV 4 −1.35 154 NYSSQLGASQAGRFT 1290 HGNYS 1222 0 0 0 0 0 51 0 0 68 USUV 5 −1.19 173 SPAITVKMGDYGEIS 1291 PNSPA 1223 0 0 0 0 0 0 0 0 67 USUV 6 −1.13 194 NGLNTEAYYIMSVGT 1292 PRNGL 1224 0 0 0 0 0 0 0 0 68 USUV 7 −1.27 228 PASSNWRNREILLEF 1293 TSPAS 1225 0 0 0 0 0 0 0 0 68 USUV 8 −1.52 230 SSNWRNREILLEFEE 1294 PASSN 1226 0 0 0 0 0 0 0 0 67 USUV 9 −1.17 247 ATKQSVVALGSQEGA 1295 PHATK 1227 0 0 0 0 0 51 0 0 68 USUV 10 −1.04 312 KNPADTGHGTVVLEL 1296 FAKNP 1228 0 0 0 0 0 0 0 0 68 USUV 11 −1.52 331 SDGPCKIPISIVASL 1297 TGSDG 1229 0 0 0 0 0 1 0 0 67 USUV 12 −1.32 364 SEANAKVLVEMEPPF 1298 ASSEA 1230 0 0 0 0 0 0 0 0 68
(607) The selected envelope USUV pentamer peptides were then evaluated against other pathogens of interest that are co-endemic. Some cross reactivity with SLE, JAEV and Hepatitis C was noted for peptides PTTGE (SEQ ID NO.: 1162), HGNYS (SEQ ID NO.: 1222), PHATK (SEQ ID NO.: 1227) and FAKNP (SEQ ID NO.: 1228). As has been noted with other flaviviruses, some cross reactivity was found with Plasmodium falciparum. The parvovirus 19, enteroviruses and alphaviruses showed no similarity
(608) TABLE-US-00039 TABLE 39 Evaluation of potential cross reactivity between USUV pentaniers and other pathogens SEQ Ross Plasmodium ID NO.: SLE HEPC JAEV Parvo19 Entero River EEE falciparum Isolates 3 539 11 225 90 12 4 1 tested Proteins 24 539 11 225 990 109 44 5392 USUV peptide PTTGE 1162 24 42 23 0 0 0 0 1 NPKRA 1220 0 0 0 0 0 0 0 0 SSDTH 1221 0 0 0 0 0 0 0 3 HGNYS 1222 20 2 23 0 0 0 0 1 PNSPA 1223 0 0 0 0 0 0 0 2 PRNGL 1224 0 0 0 0 0 0 0 2 TSPAS 1225 0 0 0 0 0 0 0 1 PASSN 1226 0 0 0 0 0 0 0 0 PHATK 1227 24 3 0 0 0 0 0 0 FAKNP 1228 0 0 19 0 0 0 0 0 TGSDG 1229 0 0 0 0 0 0 0 0 ASSEA 1230 0 0 0 0 2 0 0 2
(609) A similar selection and evaluation of peptides was then made from USUV NS1. The following peptides were selected as diagnostic array for USUV.
(610) TABLE-US-00040 TABLE 40 Peptides from USUV NS1 protein Bepi Epitope Position in SEQ Pentamer probability NS1 Flanking regions ID NO.: SEQ 1231 MPETP −1.05 37 DRYKFMPETPKQLAK 1299 SEQ 1232 PKGMY −1.07 95 VVVEKPKGMYKSAPQ 1300 SEQ 1233 PETKE −1.55 140 FVVDGPETKECPDVK 1301 SEQ 1234 HNTTD −1.44 176 LKVREHNTTDCDSSI 1302 SEQ 1235 PKSNH −1.81 252 VTLAGPKSNHNRREG 1303 SEQ 1236 QGPWD −1.58 267 YKVQSQGPWDEEDIV 1304 SEQ 1237 SIRTT −1.52 299 GKRGPSIRTTTSSGR 1305 SEQ 1238 RTTTS −1.54 301 RGPSIRTTTSSGRLV 1306
(611) When compared to pentamers selected for other flaviviruses (see, e.g., copending U.S. Prov. Applications 62/286,779; 62/290,616; 62/292,964; 62/306,264; 62/321,375; and 62/350,881; each of which is incorporated herein by reference in its entirety) no cross reactivity was seen except for with WNV as seen in Table 41
(612) TABLE-US-00041 TABLE 41 NS1 peptides from USUV showing lack of cross reactivity with other flavivirus pentamers selected for a diagnostic array. SEQ SEQ Bepi Pent- ID ID Virus # Prob Pos ainer NO.: Flanking NO.: Den1 Den2 Den3 Den4 WNV YF ZIKV USUV DEN1 1 −1.45 38 DSPKR 647 YKFQADSPKRLSAAI 590 74 0 160 0 0 0 0 0 DEN1 2 −0.75 104 MIRPQ 648 AQGKKMIRPQPMEHK 591 70 0 0 0 0 0 0 0 DEN1 3 −1.84 141 TPECP 649 IDGPDTPECPDGQRA 592 73 0 160 0 0 0 0 0 DEN1 4 −1.27 144 CPDGQ 650 PDTPECPDGQRAWNI 593 43 0 0 0 0 0 0 0 DEN1 5 −0.94 190 KDSKA 651 MSAAIKDSKAVHADM 594 74 0 0 0 0 0 0 0 DEN1 6 −1.17 206 EKNET 652 YWIESEKNETWKLAR 595 74 0 0 0 0 0 0 0 DEN1 7 −1.46 294 NRGPS 653 DEHCGNRGPSLRTTT 596 47 108 0 0 0 0 0 0 DEN1 8 −0.81 301 TTTVT 654 GPSLRTTTVTGKIIH 597 74 0 0 0 0 0 0 0 DEN2 1 −1.50 39 SPSKL 655 KFQPESPSKLASAIQ 598 0 107 0 0 0 0 0 0 DEN2 2 −2.00 105 LRPQP 656 AGKRSLRPQPTELKY 599 0 105 0 0 0 0 0 0 DEN2 3 −1.15 126 STESH 657 KAKMLSTESHNQTFL 600 0 97 0 0 0 0 0 0 DEN2 4 −1.43 142 AECPN 658 DGPETAECPNTNRAW 601 0 106 0 0 0 0 0 0 DEN2 5 −0.83 191 DNRAV 659 SAAIKDNRAVHADMG 602 0 106 0 0 0 0 0 0 DEN2 6 −1.03 248 FAGPV 660 IIPKNFAGPVSQHNY 603 0 105 0 0 0 0 0 0 DEN2 7 −1.02 262 HTQTA 661 YRPGYHTQTAGPWHL 604 0 105 159 0 0 0 0 0 DEN2 8 −1.37 291 DCGNR 662 VVVTEDCGNRGPSLR 605 0 106 0 0 0 0 0 0 DEN3 1 −1.40 37 ADSPK 663 QYKFQADSPKRLATA 606 74 0 160 0 0 0 0 0 DEN3 2 −1.33 103 RTLTP 664 LKQGKRTLTPQPMEL 607 0 0 1.58 0 0 0 0 0 DEN3 3 −1.80 140 NTPEC 665 IIDGPNTPECPSASR 608 1 0 157 0 0 0 0 0 DEN3 4 −0.90 190 KDERA 666 MSAAVKDERAVHADM 609 0 0 159 0 0 0 0 0 DEN3 5 −1.32 207 KNGSW 667 WIESQKNGSWKLEKA 610 0 0 160 0 0 0 0 0 DEN3 6 −1.11 257 HRPGY 668 ISQHNHRPGYHTQTA 611 0 0 141 0 0 0 0 0 DEN3 7 −0.86 290 ENCGT 669 TVVITENCGTRGPSL 612 0 0 160 0 0 0 0 0 DEN3 8 −0.86 301 TTTVS 670 GPSLRTTTVSGKLIH 613 0 0 160 0 0 0 0 0 DEN4 1 −1.18 39 SPARL 671 KFQPESPARLASAIL 614 0 0 0 29 0 0 0 0 DEN4 2 −1.63 104 ALTPP 672 TKGKRALTPPVSDLK 615 0 0 0 26 0 0 0 0 DEN4 3 −1.07 125 FTPEA 673 GKAKIFTPEARNSTF 616 0 0 0 28 0 0 0 0 DEN4 4 −1.81 140 DTSEC 674 LIDGPDTSECPNERR 617 0 0 0 29 0 0 0 0 DEN4 5 −1.25 207 KNQTW 675 WIESSKNQTWQIEKA 618 0 0 0 29 0 0 0 0 DEN4 6 −1.20 248 YAGPF 676 LIPKSYAGPFSQHNY 619 0 0 0 28 0 0 0 0 DEN4 7 −1.01 260 GYATQ 677 HNYRQGYATQTVGPW 620 0 0 0 29 0 0 0 0 DEN4 8 −1.19 292 CDHRG 678 TIQEDCDHRGPSLRT 621 0 0 0 29 0 0 0 0 WNV 1 −1.69 38 PETPQ 679 RYKYYPETPQGLAKI 622 0 0 0 0 52 0 0 0 WNV 2 −1.16 102 APKRL 680 GMYKSAPKRLTATTE 623 0 0 0 0 51 0 0 0 WNV 3 −1.43 144 ECPTQ 681 GPETKECPTQNRAWN 624 0 0 0 0 51 0 0 0 WNV 4 −1.74 177 NTTEC 682 KVRESNTTECDSKII 625 0 0 0 0 52 0 0 1 WNV 5 −1.47 261 GYKTQ 683 HNRRPGYKTQNQGPW 626 0 0 0 0 52 0 0 0 WNV 6 −1.90 266 NQGPW 684 GYKTQNQGPWDEGRV 627 0 0 0 0 52 0 0 0 WNV 7 −1.67 297 GPATR 685 SCGHRGPATRTTTES 628 0 0 0 0 52 0 0 0 WNV 8 −1.54 303 TTESG 686 PATRTTTESGKLITD 629 0 0 0 0 51 0 0 0 YF 1 −1.21 35 YYPED 687 LNKYSYYPEDPVKLA 630 0 0 0 0 0 72 0 0 YF 2 −1.41 140 SRKEC 688 IIDGKSRKECPFSNR 631 0 0 0 0 0 72 0 0 YF 3 −2.21 193 KSAHG 689 AVNGKKSAHGSPTFW 632 0 0 0 0 0 72 0 0 YF 4 −1.12 234 GTSVE 690 LTHTIGTSVEESEMF 633 0 0 0 0 0 72 0 0 YF 5 −1.05 264 QTNGP 691 PGYKVQTNGPWMQVP 634 0 0 0 0 0 72 0 0 YF 6 −2.05 295 RGKST 692 GNCDGRGKSTRSTTD 635 0 0 0 0 0 71 0 0 YF 7 −2.15 301 STTDS 693 GKSTRSTTDSGKVIP 636 0 0 0 0 0 72 0 0 YF 8 −1.15 338 PRKTH 694 PMEIRPRKTHESHLV 637 0 0 0 0 0 50 0 0 ZIKV 1 −1.55 14 KETRC 695 VDFSKKETRCGTGVF 638 0 0 0 0 0 0 47 0 ZIKV 2 −1.62 38 HPDSP 696 DRYKYHPDSPRRLAA 639 0 0 0 0 0 0 47 0 ZIKV 3 −1.06 130 AKTNN 697 HFVRAAKTNNSFVVD 640 0 0 0 0 0 0 47 0 ZIKV 4 −1.23 193 GKEAV 698 GTAVKGKEAVHSDLG 641 0 0 0 0 0 0 44 0 ZIKV 5 −1.23 209 KNDTW 699 WIESEKNDTWRLKRA 642 0 0 0 0 0 0 47 0 ZIKV 6 −1.36 259 TREGY 700 LSHHNTREGYRTQMK 643 0 0 0 0 0 0 45 0 ZIKV 7 −0.86 291 EETCG 701 TKVHVEETCGTRGPS 644 0 0 0 0 0 0 47 0 ZIKV 8 −1.56 303 STTAS 702 GPSLRSTTASGRVIE 645 0 0 0 0 0 0 46 0 ZIKV 9 −1.85 341 RKEPE 703 MEIRPRKEPESNLVR 646 0 0 0 0 0 0 46 0 USUV 1 −1.05 37 MPETP 1231 DRYKFMPETPKQLAK 1299 0 0 0 0 0 0 0 65 USUV 2 −1.07 95 PKGMY 1232 VVVEKPKGMYKSAPQ 1300 0 0 0 0 0 0 0 66 USUV 3 −1.55 140 PETKE 1233 FVVDGPETKECPDVK 1301 0 0 0 0 51 0 0 68 USUV 4 −1.44 176 HNTTD 1234 LKVREHNTTDCDSSI 1302 0 0 0 0 0 0 0 65 USUV 5 −1.81 252 PKSNH 1235 VTLAGPKSNHNRREG 1303 0 0 0 0 0 0 0 67 USUV 6 −1.58 267 QGPWD 1236 YKVQSQGPWDEEDIV 1304 0 0 0 0 51 0 0 68 USUV 7 −1.52 299 SIRTT 1237 GKRGPSIRTTTSSGR 1305 0 0 0 0 0 0 0 68 USUV 8 −1.54 301 RTTTS 1238 RGPSIRTTTSSGRLV 1306 0 0 0 0 0 0 0 67
(613) The selected USUV pentamers were then compared to various other potentially co-endemic pathogens, searching for the presence of the pentamers in these pathogens but not determining if they are present in B cell epitopes therein. Table 42 indicates where possible cross reactions may occur, particularly with other flaviviruses.
(614) TABLE-US-00042 TABLE 42 SEQ Ross Plasmodium ID NO.: SLE HEPC JAEV Parvo19 Entero River EEE falciparum Isolates 3 539 11 225 90 12 4 1 tested Proteins 24 539 11 225 990 109 44 5392 USUV peptide MPETP 1231 0 0 0 0 0 0 0 0 PKGMY 1232 0 0 0 0 0 0 0 0 PETKE 1233 10 3 11 0 0 0 0 3 HNTTD 1234 0 0 0 0 0 0 0 1 PKSNH 1235 0 0 0 0 0 0 0 0 QGPWD 1236 0 0 11 0 0 0 0 0 SIRTT 1237 0 0 8 0 0 0 0 0 RTTTS 1238 0 0 0 0 0 0 0 4
REFERENCE LIST
(615) [1] E.C.f.D.P.a. Control, Rapid risk assessment: Zika virus epidemic in the Americas: potential association with microcephaly and Guillain-Barré syndrome, Stockholm, December 2015. [2] C.f.D. Control, Dengue Fact Sheet, 2006. [3] S. B. Halstead, F. X. Heinz, A. D. Barrett, J. T. Roehrig, Dengue virus: molecular basis of cell entry and pathogenesis, 25-27 Jun. 2003, Vienna, Austria, Vaccine, 23 (2005) 849-856. [4] C. Y. Lai, W. Y. Tsai, S. R. Lin, C. L. Kao, H. P. Hu, C. C. King, H. C. Wu, G. J. Chang, W. K. Wang, Antibodies to envelope glycoprotein of dengue virus during the natural course of infection are predominantly cross-reactive and recognize epitopes containing highly conserved residues at the fusion loop of domain II, J.Virol., 82 (2008) 6631-6643. [5] R. C. Pinto, D. B. Castro, B. C. Albuquerque, S. Sampaio Vde, R. A. Passos, C. F. Costa, M. Sadahiro, J. U. Braga, Mortality Predictors in Patients with Severe Dengue in the State of Amazonas, Brazil, PloS one, 11 (2016) e0161884. [6] P. R. Beatty, H. Puerta-Guardo, S. S. Killingbeck, D. R. Glasner, K. Hopkins, E. Harris, Dengue virus NS1 triggers endothelial permeability and vascular leak that is prevented by NS1 vaccination, Science translational medicine, 7 (2015) 304ra141. [7] H. Puerta-Guardo, D. R. Glasner, E. Harris, Dengue Virus NS1 Disrupts the Endothelial Glycocalyx, Leading to Hyperpermeability, PLoS pathogens, 12 (2016) e1005738. [8] S. J. Thomas, NS1: A corner piece in the dengue pathogenesis puzzle?, Science translational medicine, 7 (2015) 304fs337. [9] U. Ashraf, J. Ye, X. Ruan, S. Wan, B. Zhu, S. Cao, Usutu virus: an emerging flavivirus in Europe, Viruses, 7 (2015) 219-238. [10] A. E. Paniz-Mondolfi, W. E. Villamil-Gomez, A. J. Rodriguez-Morales, Usutu virus infection in Latin America: A new emerging threat, Travel Med Infect Dis, (2016). [11] F. A. Rey, F. X. Heinz, C. Mandl, C. Kunz, S. C. Harrison, The envelope glycoprotein from tickborne encephalitis virus at 2 A resolution, Nature, 375 (1995) 291-298. [12] V. C. Luca, J. AbiMansour, C. A. Nelson, D. H. Fremont, Crystal structure of the Japanese encephalitis virus envelope protein, Journal of virology, 86 (2012) 2337-2346. [13] D. Gubler, Kuno G., Markoff L., Flaviviruses, in: D. Knipe, Howley, P M (Ed.) Field's Virology, Lippincott, Williams and Wilkins, Philadelphia, Pa., 2007, pp. 1153-1252. [14] A. Santos-Carvalho, A. F. Ambrosio, C. Cavadas, Neuropeptide Y system in the retina: From localization to function, Progress in retinal and eye research, 47 (2015) 19-37. [15] S. B. Halstead, Dengue Antibody-Dependent Enhancement: Knowns and Unknowns, Microbiology spectrum, 2 (2014). [16] S. B. Halstead, S. Nimmannitya, S. N. Cohen, Observations related to pathogenesis of dengue hemorrhagic fever. IV. Relation of disease severity to antibody response and virus recovered, The Yale journal of biology and medicine, 42 (1970) 311-328. [17] S. Porter, I. M. Clark, L. Kevorkian, D. R. Edwards, The ADAMTS metalloproteinases, Biochem J, 386 (2005) 15-27. [18] A. D. Haddow, A. J. Schuh, C. Y. Yasuda, M. R. Kasper, V. Heang, R. Huy, H. Guzman, R. B. Tesh, S. C. Weaver, Genetic characterization of Zika virus strains: geographic expansion of the Asian lineage, PLoS neglected tropical diseases, 6 (2012) e1477. [19] O. Faye, C. C. Freire, A. Iamarino, O. Faye, J. V. de Oliveira, M. Diallo, P. M. Zanotto, A. A. Sall, Molecular evolution of Zika virus during its emergence in the 20(th) century, PLoS neglected tropical diseases, 8 (2014) e2636. [20] E. Oehler, L. Watrin, P. Larre, I. Leparc-Goffart, S. Lastere, F. Valour, L. Baudouin, H. Mallet, D. Musso, F. Ghawche, Zika virus infection complicated by Guillain-Barre syndrome—case report, French Polynesia, December 2013, Euro surveillance: bulletin europeen sur les maladies transmissibles=European communicable disease bulletin, 19 (2014). [21] R. W. Malone, J. Homan, M. V. Callahan, J. Glasspool-Malone, L. Damodaran, B. Schneider Ade, R. Zimler, J. Talton, R. R. Cobb, I. Ruzic, J. Smith-Gagen, D. Janies, J. Wilson, G. Zika Response Working, Zika Virus: Medical Countermeasure Development Challenges, PLoS neglected tropical diseases, 10 (2016) e0004530. [22] P. Brasil, J. P. Pereira, Jr., M. E. Moreira, R. M. Ribeiro Nogueira, L. Damasceno, M. Wakimoto, R. S. Rabello, S. G. Valderramos, U. A. Halai, T. S. Salles, A. A. Zin, D. Horovitz, P. Daltro, M. Boechat, C. Raja Gabaglia, P. Carvalho de Sequeira, J. H. Pilotto, R. Medialdea-Carrera, D. Cotrim da Cunha, L. M. Abreu de Carvalho, M. Pone, A. Machado Siqueira, G. A. Calvet, A. E. Rodrigues Baiao, E. S. Neves, P. R. Nassar de Carvalho, R. H. Hasue, P. B. Marschik, C. Einspieler, C. Janzen, J. D. Cherry, A. M. Bispo de Filippis, K. Nielsen-Saines, Zika Virus Infection in Pregnant Women in Rio de Janeiro, The New England journal of medicine, 375 (2016) 2321-2334. [23] M. A. Honein, A. L. Dawson, E. E. Petersen, A. M. Jones, E. H. Lee, M. M. Yazdy, N. Ahmad, J. Macdonald, N. Evert, A. Bingham, S. R. Ellington, C. K. Shapiro-Mendoza, T. Oduyebo, A. D. Fine, C. M. Brown, J. N. Sommer, J. Gupta, P. Cavicchia, S. Slavinski, J. L. White, S. M. Owen, L. R. Petersen, C. Boyle, D. Meaney-Delman, D. J. Jamieson, U.S.Z.P.R. Collaboration, Birth Defects Among Fetuses and Infants of US Women With Evidence of Possible Zika Virus Infection During Pregnancy, JAMA, 317 (2017) 59-68. [24] V.-M.B. Cao-Lormeau, A.; Mons, S.; Lastere, S.; Roche, C.; Vanhomwegan, J.; Dub, T.; Baudouin, L.; Teissier, A.; Larre, P.; Vial, A-L.; Decam, C.; Choumet, V.; Halstead, S. K.; Willison, H. J.; Musset, L.; Manuguerra, J-C.; Despres, P.; Fournier, E.; Mallet, H-P., Musso, D., Fontanet, A., Neil, J., Ghwache, F., Guillain-Barre Syndrome outbreak associated with Zika virus infection in French Polynesia: a case control study, Lancet, (2016). [25] J. M. Anaya, Y. Rodriguez, D. M. Monsalve, D. Vega, E. Ojeda, D. Gonzalez-Bravo, M. Rodriguez-Jimenez, C. A. Pinto-Diaz, P. Chaparro, M. L. Gunturiz, A. A. Ansari, M. E. Gershwin, N. Molano-Gonzalez, C. Ramirez-Santana, Y. Acosta-Ampudia, A comprehensive analysis and immunobiology of autoimmune neurological syndromes during the Zika virus outbreak in Cucuta, Colombia, Journal of autoimmunity, (2017). [26] E. Goncalves, Acute inflammatory demyelinating polyradiculoneuropathy (Guillain-Barre syndrome) following dengue fever, Revista do Instituto de Medicina Tropical de Sao Paulo, 53 (2011) 223-225. [27] B. Roze, F. Najioullah, J. L. Ferge, K. Apetse, Y. Brouste, R. Cesaire, C. Fagour, L. Fagour, P. Hochedez, S. Jeannin, J. Joux, H. Mehdaoui, R. Valentino, A. Signate, A. Cabie, G.B.S.Z.W. Group, Zika virus detection in urine from patients with Guillain-Barre syndrome on Martinique, January 2016, Euro surveillance: bulletin europeen sur les maladies transmissibles=European communicable disease bulletin, 21 (2016). [28] B. Roze, F. Najioullah, A. Signate, K. Apetse, Y. Brouste, S. Gourgoudou, L. Fagour, S. Abel, P. Hochedez, R. Cesaire, A. Cabie, M. Neuro-Zika Working Group of, Zika virus detection in cerebrospinal fluid from two patients with encephalopathy, Martinique, February 2016, Euro surveillance: bulletin europeen sur les maladies transmissibles=European communicable disease bulletin, 21 (2016). [29] D. Butler, Brazil asks whether Zika acts alone to cause birth defects, Nature, 535 (2016) 475-476. [30] L. P. De Goes Cavalcanti, P. L. Tauil, C. H. Alencar, W. Oliveira, M. M. Teixeira, J. Heukelbach, Zika virus infection, associated microcephaly, and low yellow fever vaccination coverage in Brazil: is there any causal link?, J Infect Dev Ctries, 10 (2016) 563-566. [31] S. Bhatt, P. W. Gething, O. J. Brady, J. P. Messina, A. W. Farlow, C. L. Moyes, J. M. Drake, J. S. Brownstein, A. G. Hoen, O. Sankoh, M. F. Myers, D. B. George, T. Jaenisch, G. R. Wint, C. P. Simmons, T. W. Scott, J. J. Farrar, S. I. Hay, The global distribution and burden of dengue, Nature, 496 (2013) 504-507. [32] D. H. Libraty, P. R. Young, D. Pickering, T. P. Endy, S. Kalayanarooj, S. Green, D. W. Vaughn, A. Nisalak, F. A. Ennis, A. L. Rothman, High circulating levels of the dengue virus nonstructural protein NS1 early in dengue illness correlate with the development of dengue hemorrhagic fever, J Infect Dis, 186 (2002) 1165-1168. [33] C. V. Ventura, M. Maia, V. Bravo-Filho, A. L. Gois, R. Belfort, Jr., Zika virus in Brazil and macular atrophy in a child with microcephaly, Lancet, (2016). [34] C. Kowal, A. Athanassiou, H. Chen, B. Diamond, Maternal antibodies and developing blood-brain barrier, Immunologic research, 63 (2015) 18-25. [35] B. Diamond, P. T. Huerta, P. Mina-Osorio, C. Kowal, B. T. Volpe, Losing your nerves? Maybe it's the antibodies, Nature reviews. Immunology, 9 (2009) 449-456. [36] E. Fox, D. Amaral, J. Van de Water, Maternal and fetal antibrain antibodies in development and disease, Developmental neurobiology, 72 (2012) 1327-1334. [37] W. Dejnirattisai, P. Supasa, W. Wongwiwat, A. Rouvinski, G. Barba-Spaeth, T. Duangchinda, A. Sakuntabhai, V. M. Cao-Lormeau, P. Malasit, F. A. Rey, J. Mongkolsapaya, G. R. Screaton, Dengue virus sero-cross-reactivity drives antibody-dependent enhancement of infection with zika virus, Nat Immunol, (2016). [38] O. Karimi, A. Goorhuis, J. Schinkel, J. Codrington, S. G. Vreden, J. S. Vermaat, C. Stijnis, M. P. Grobusch, Thrombocytopenia and subcutaneous bleedings in a patient with Zika virus infection, Lancet, (2016). [39] T. M. Sharp, J. Munoz-Jordan, J. Perez-Padilla, M. I. Bello-Pagan, A. Rivera, D. M. Pastula, J. L. Salinas, J. H. Martinez Mendez, M. Mendez, A. M. Powers, S. Waterman, B. Rivera-Garcia, Zika Virus Infection Associated with Severe Thrombocytopenia, Clinical infectious diseases: an official publication of the Infectious Diseases Society of America, (2016). [40] A. K. Falconar, The dengue virus nonstructural-1 protein (NS1) generates antibodies to common epitopes on human blood clotting, integrin/adhesin proteins and binds to human endothelial cells: potential implications in haemorrhagic fever pathogenesis, Arch.Virol., 142 (1997) 897-916. [41] K. Djamiatun, A. J. van der Ven, P. G. de Groot, S. M. Faradz, D. Hapsari, W. M. Dolmans, S. Sebastian, R. Fijnheer, Q. de Mast, Severe dengue is associated with consumption of von Willebrand factor and its cleaving enzyme ADAMTS-13, PLoS neglected tropical diseases, 6 (2012) e1628. [42] Y. C. Chuang, J. Lin, Y. S. Lin, S. Wang, T. M. Yeh, Dengue Virus Nonstructural Protein 1-Induced Antibodies Cross-React with Human Plasminogen and Enhance Its Activation, J Immunol, 196 (2016) 1218-1226. [43] H. J. Cheng, Y. H. Luo, S. W. Wan, C. F. Lin, S. T. Wang, N. T. Hung, C. C. Liu, T. S. Ho, H. S. Liu, T. M. Yeh, Y. S. Lin, Correlation between serum levels of anti-endothelial cell autoantigen and anti-dengue virus nonstructural protein 1 antibodies in dengue patients, The American journal of tropical medicine and hygiene, 92 (2015) 989-995. [44] E. Roberts, D. J. Hampshire, L. Pattison, K. Springell, H. Jafri, P. Corry, J. Mannon, Y. Rashid, Y. Crow, J. Bond, C. G. Woods, Autosomal recessive primary microcephaly: an analysis of locus heterogeneity and phenotypic variation, J Med Genet, 39 (2002) 718-721. [45] C. Speake, A. Pichugin, T. Sahu, V. Malkov, R. Morrison, Y. Pei, L. Juompan, N. Milman, S. Zarling, C. Anderson, S. Wong-Madden, J. Wendler, A. Ishizuka, Z. W. MacMillen, V. Garcia, S. H. Kappe, U. Krzych, P. E. Duffy, Identification of Novel Pre-Erythrocytic Malaria Antigen Candidates for Combination Vaccines with Circumsporozoite Protein, PloS one, 11 (2016) e0159449. [46] M. Van Esbroeck, K. Meersman, J. Michiels, K. K. Arien, D. Van den Bossche, Letter to the editor: Specificity of Zika virus ELISA: interference with malaria, Euro surveillance: bulletin europeen sur les maladies transmissibles=European communicable disease bulletin, 21 (2016). [47] G. Robin, Y. Sato, D. Desplancq, N. Rochel, E. Weiss, P. Martineau, Restricted diversity of antigen binding residues of antibodies revealed by computational alanine scanning of 227 antibody-antigen complexes, J Mol Biol, 426 (2014) 3729-3743. [48] H. Zhao, E. Fernandez, K. A. Dowd, S. D. Speer, D. J. Platt, M. J. Gorman, J. Govero, C. A. Nelson, T. C. Pierson, M. S. Diamond, D. H. Fremont, Structural Basis of Zika Virus-Specific Antibody Protection, Cell, (2016). [49] R. D. Bremel, E. J. Homan, Frequency Patterns of T-Cell Exposed Amino Acid Motifs in Immunoglobulin Heavy Chain Peptides Presented by MHCs, Frontiers in immunology, 5 (2014) 541. [50] A. Enfissi, J. Codrington, J. Roosblad, M. Kazanji, D. Rousset, Zika virus genome from the Americas, Lancet, (2016). [51] K. Morl, A. G. Beck-Sickinger, Intracellular Trafficking of Neuropeptide Y Receptors, Progress in molecular biology and translational science, 132 (2015) 73-96. [52] A. Santos-Carvalho, A. R. Alvaro, J. Martins, A. F. Ambrosio, C. Cavadas, Emerging novel roles of neuropeptide Y in the retina: from neuromodulation to neuroprotection, Prog Neurobiol, 112 (2014) 70-79. [53] E. M. McNeill, M. Klockner-Bormann, E. C. Roesler, L. E. Talton, D. Moechars, M. Clagett-Dame, Nav2 hypomorphic mutant mice are ataxic and exhibit abnormalities in cerebellar development, Developmental biology, 353 (2011) 331-343. [54] E. M. McNeill, K. P. Roos, D. Moechars, M. Clagett-Dame, Nav2 is necessary for cranial nerve development and blood pressure regulation, Neural development, 5 (2010) 6. [55] M. Flamand, F. Megret, M. Mathieu, J. Lepault, F. A. Rey, V. Deubel, Dengue virus type 1 nonstructural glycoprotein NS1 is secreted from mammalian cells as a soluble hexamer in a glycosylation-dependent fashion, Journal of virology, 73 (1999) 6104-6110. [56] P. R. Young, P. A. Hilditch, C. Bletchly, W. Halloran, An antigen capture enzyme-linked immunosorbent assay reveals high levels of the dengue virus protein NS1 in the sera of infected patients, Journal of clinical microbiology, 38 (2000) 1053-1057. [57] S. Alcon-LePoder, P. Sivard, M. T. Drouet, A. Talarmin, C. Rice, M. Flamand, Secretion of flaviviral non-structural protein NS1: from diagnosis to pathogenesis, Novartis Found Symp, 277 (2006) 233-247; discussion 247-253. [58] G. Kuno, A. V. Vorndam, D. J. Gubler, I. Gomez, Study of anti-dengue NS1 antibody by western blot, J.Med.Virol., 32 (1990) 102-108. [59] I. J. Liu, C. Y. Chiu, Y. C. Chen, H. C. Wu, Molecular mimicry of human endothelial cell antigen by autoantibodies to nonstructural protein 1 of dengue virus, J Biol Chem, 286 (2011) 9726-9736. [60] A. K. Falconar, The dengue virus nonstructural-1 protein (NS1) generates antibodies to common epitopes on human blood clotting, integrin/adhesin proteins and binds to human endothelial cells: potential implications in haemorrhagic fever pathogenesis, Archives of virology, 142 (1997) 897-916. [61] M. A. Edeling, M. S. Diamond, D. H. Fremont, Structural basis of Flavivirus NS1 assembly and antibody recognition, Proc Natl Acad Sci USA, 111 (2014) 4285-4290. [62] J. Bond, E. Roberts, G. H. Mochida, D. J. Hampshire, S. Scott, J. M. Askham, K. Springell, M. Mahadevan, Y. J. Crow, A. F. Markham, C. A. Walsh, C. G. Woods, ASPM is a major determinant of cerebral cortical size, Nat Genet, 32 (2002) 316-320. [63] M. A. Rujano, L. Sanchez-Pulido, C. Pennetier, G. le Dez, R. Basto, The microcephaly protein Asp regulates neuroepithelium morphogenesis by controlling the spatial distribution of myosin II, Nat Cell Biol, 15 (2013) 1294-1306. [64] N. Kouprina, A. Pavlicek, N. K. Collins, M. Nakano, V. N. Noskov, J. Ohzeki, G. H. Mochida, J. I. Risinger, P. Goldsmith, M. Gunsior, G. Solomon, W. Gersch, J. H. Kim, J. C. Barrett, C. A. Walsh, J. Jurka, H. Masumoto, V. Larionov, The microcephaly ASPM gene is expressed in proliferating tissues and encodes for a mitotic spindle protein, Hum Mol Genet, 14 (2005) 2155-2165. [65] C. C. Homem, M. Repic, J. A. Knoblich, Proliferation control in neural stem and progenitor cells, Nat Rev Neurosci, 16 (2015) 647-659. [66] J. J. Schlesinger, M. W. Brandriss, E. E. Walsh, Protection of mice against dengue 2 virus encephalitis by immunization with the dengue 2 virus non-structural glycoprotein NS1, The Journal of general virology, 68 (Pt 3) (1987) 853-857. [67] A. J. Goncalves, E. R. Oliveira, S. M. Costa, M. V. Paes, J. F. Silva, A. S. Azevedo, M. Mantuano-Barradas, A. C. Nogueira, C. J. Almeida, A. M. Alves, Cooperation between CD4+ T Cells and Humoral Immunity Is Critical for Protection against Dengue Using a DNA Vaccine Based on the NS1 Antigen, PLoS neglected tropical diseases, 9 (2015) e0004277. [68] K. M. Chung, G. E. Nybakken, B. S. Thompson, M. J. Engle, A. Marri, D. H. Fremont, M. S. Diamond, Antibodies against West Nile Virus nonstructural protein NS1 prevent lethal infection through Fc gamma receptor-dependent and -independent mechanisms, J.Virol., 80 (2006) 1340-1351. [69] E. J. M. Homan, R. W.; Darnell, S.; Bremel, R. D.; Antibody mediated epitope mimicry in the pathogenesis of Zika virus related disease, Preprint posted on BioRXiv, (2016). [70] H. J. Rogers, C. Allen, A. E. Lichtin, Thrombotic thrombocytopenic purpura: The role of ADAMTS13, Cleveland Clinic journal of medicine, 83 (2016) 597-603. [71] X. L. Zheng, ADAMTS13 and von Willebrand factor in thrombotic thrombocytopenic purpura, Annu Rev Med, 66 (2015) 211-225. [72] D. B. Cines, V. S. Blanchette, Immune thrombocytopenic purpura, The New England journal of medicine, 346 (2002) 995-1008.