RHAMNOSE-POLYSACCHARIDES

20220259629 · 2022-08-18

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention relates to a method of synthesizing a rhamnose polysaccharide. The invention also relates to a synthetic streptococcal polysaccharide, a streptococcal glycoconjugate, an immunogenic composition or vaccine comprising the streptococcal polysaccharide or glycoconjugate and the polysaccharide, glycoconjugate, immunogenic composition or vaccine for use in raising an immune response in an animal or for use in treating or preventing a disease, condition or infection with a streptococcal aetiology.

    Claims

    1. A method of synthesizing a rhamnose polysaccharide, the method comprising (i) transferring a rhamnose moiety to a hexose monosaccharide, disaccharide or trisaccharide using a hexose-β-1,4-rhamnosyltransferase, a hexose-α-1,2-rhamnosyltransferase and/or a hexose-α-1,3-rhamnosyltransferase, or an enzymatically active fragment or variant thereof to form a disaccharide, trisaccharide or tetrasaccharide comprising a rhamnose moiety at a non-reducing end of the disaccharide, trisaccharide or tetrasaccharide; (ii) generating the rhamnose polysaccharide by extending from the rhamnose moiety at the non-reducing end of the disaccharide, trisaccharide or tetrasaccharide using a heterologous bacterial enzyme Streptococcus pyogenes Group A carbohydrate enzyme C (GacC) and/or Streptococcus pyogenes Group A carbohydrate enzyme G (GacG) or an enzymatically active homologue, variant or fragment thereof.

    2. The method according to claim 1, wherein the method is performed in a bacterium species heterologous to the bacterium species from which the enzyme GacC and/or GacG, or an enzymatically active homologue, variant or fragment thereof is derived.

    3. The method according to claim 1, wherein the hexose-β-1,4-rhamnosyltransferase is not a GlcNAc-β-1,4-rhamnosyltransferase.

    4. The method according to claim 1, wherein the hexose-β-1,4-rhamnosyltransferase is a Glc-β-1,4-rhamnosyltransferase or an enzymatically active fragment or variant thereof.

    5. The method according to claim 4, wherein the Glc-β-1,4-rhamnosyltransferase comprises a WchF enzyme, or an enzymatically active fragment or variant thereof.

    6. (canceled)

    7. The method according to claim 1, wherein the hexose-α-1,2-rhamnosyltransferase is a galactose-α-1,2-rhamnosyltransferase or an enzymatically active fragment or variant thereof.

    8. The method according to claim 7, wherein the galactose-α-1,2-rhamnosyltransferase comprises a WbbR enzyme, or an enzymatically active fragment or variant thereof.

    9. (canceled)

    10. The method according to claim 1, wherein the hexose-α-1,3-rhamnosyltransferase is a GlcNAc-α-1,3-rhamnosyltransferase, a diNAcBac-α-1,3-rhamnosyltransferase, a Glc-α-1,3-rhamnosyltransferase, a galactose-α-1,3-rhamnosyltransferase or an enzymatically active fragment or variant thereof.

    11. The method according to claim 10, wherein the GlcNAc-α-1,3-rhamnosyltransferase comprises a WbbL enzyme, or an enzymatically active fragment or variant thereof and the galactose-α-1,3-rhamnosyltransferase comprises a WsaD enzyme, or an enzymatically active fragment or variant thereof.

    12. (canceled)

    13. (canceled)

    14. The method according to claim 1, wherein the enzymatically active homologue of GacC and/or GacG is selected from a homologue from a Streptococci Group B, Group C, Group G, S. mutans, S. uberis or an enzymatically active fragment or variant thereof.

    15. The method according to claim 1, wherein the method is performed in a gram-negative bacterium/bacteria, such as E. coli.

    16. (canceled)

    17. The method according to claim 1, wherein step ii) further comprises using one or more additional enzymes from the Gac cluster of bacterial enzymes, or one or more enzymatically active homologue(s), variant(s), or fragment(s) thereof.

    18. The method according to claim 1, the method further comprising: (iii) conjugating the rhamnose polysaccharide to an acceptor molecule using an O-oligosaccharyltransferase capable of recognizing the hexose monosaccharide at the reducing end of the rhamnose polysaccharide to form a rhamnose glycoconjugate.

    19. (canceled)

    20. The method according to claim 18, wherein the O-oligosaccharyltransferase comprises PglB, PglL, PglS or WsaB, or an enzymatically active homologue, fragment, or variant thereof.

    21. The method according to claim 18, wherein the acceptor molecule comprises a peptide or a protein.

    22. The method according to claim 18, wherein the method further comprises purifying the rhamnose glycoconjugate.

    23. (canceled)

    24. A synthetic streptococcal polysaccharide, the polysaccharide having a non-reducing end comprising a linear chain of rhamnose moieties and a reducing end comprising a hexose monosaccharide, disaccharide, or trisaccharide, wherein the polysaccharide comprises a α-1,3 bond or a α-1,2 bond between the hexose monosaccharide, disaccharide, or trisaccharide and the linear chain of rhamnose moieties; or the polysaccharide comprises a β-1,4 bond between the hexose monosaccharide, disaccharide, or trisaccharide and the linear chain of rhamnose moieties and the hexose monosaccharide, disaccharide, or trisaccharide does not comprise N-acetylglucosamine.

    25. The synthetic streptococcal rhamnose polysaccharide according to claim 24, wherein the polysaccharide comprises a α-1,3 bond between the hexose monosaccharide, disaccharide, or trisaccharide and the linear chain of rhamnose moieties and the hexose comprises N-acetylglucosamine, N,N′-diacetylbacillosamine, glucose or galactose.

    26. The synthetic streptococcal rhamnose polysaccharide according to claim 24, wherein the polysaccharide comprises a α-1,2 bond or a β-1,4 bond between the hexose monosaccharide, disaccharide, or trisaccharide and the linear chain of rhamnose moieties and the hexose comprises galactose.

    27. (canceled)

    28. The synthetic streptococcal rhamnose polysaccharide according to claim 24, wherein the polysaccharide comprises a polysaccharide or a fragment or variant thereof selected from the group consisting of a Group A, Group B, Group C and Group G carbohydrate.

    29. The synthetic streptococcal rhamnose polysaccharide according to claim 24 conjugated to an acceptor.

    30. (canceled)

    31. (canceled)

    32. An immunogenic composition or vaccine comprising the synthetic streptococcal rhamnose polysaccharide according to claim 24, together with a pharmaceutically acceptable and/or sterile excipient, carrier, and/or diluent.

    33. (canceled)

    34. The immunogenic composition or vaccine according to claim 32, wherein the immunogenic composition or vaccine further comprises an antigen, polypeptide and/or adjuvant.

    35. (canceled)

    36. A bacterial host cell, the bacterial host cell comprising a hexose-β-1,4-rhamnosyltransferase, a hexose-α-1,2-rhamnosyltransferase or a hexose-α-1,3-rhamnosyltransferase, or an enzymatically active fragment or variant thereof and a heterologous bacterial enzyme GacC and/or GacG or an enzymatically active homologue, variant or fragment thereof.

    37. A kit of parts, the kit comprising: (i) a nucleic acid sequence encoding a hexose-β-1,4-rhamnosyltransferase, a hexose-α-1,2-rhamnosyltransferase or a hexose-α-1,3-rhamnosyltransferase, or an enzymatically active fragment or variant thereof; and (ii) a nucleic acid sequence encoding a heterologous bacterial enzyme GacC and/or GacG or an enzymatically active homologue, variant, or fragment thereof.

    Description

    DETAILED DESCRIPTION

    [0224] The invention will now be described by way of example with reference to the following figures, which show:

    [0225] FIG. 1 A) shows a gene complementation strategy and map of S. pyogenes and S. mutans genes required to produce the rhamnose chain. S. mutans cluster: sccA (Smu0824), sccB (Smu0825), sccC (Smu0826), sccD (Smu0827), sccE (Smu0828), sccF (Smu0829), sccG (Smu0830). S. pyogenes cluster: gacA (M5005_Spy_0602), gacB (M5005_Spy_0603), gacC (M5005_Spy_0604), gacD (M5005_Spy_0605), gacE (M5005_Spy_0606), gacF (M5005_Spy_0607), gacG (M5005_Spy_0608). B) Bacterial complementation assay. Western blot of whole cells samples probed with anti-Group A antibody. Legends on the figure;

    [0226] FIG. 2 shows a western blot of whole cell samples probed against anti-GAC antibody showing the complementation of ΔsccB or ΔgacB with sccB_TTG, sccB_ATG and gacB;

    [0227] FIG. 3 shows a thin layer chromatography analysis of radiolabelled lipid-linked oligosaccharides extracted from E. coli cells expressing the empty vector, S. mutans SccAB-DEFG, S. pyogenes GacB or S. mutans SccB;

    [0228] FIG. 4 shows an in vitro assessment of GacB's activity detected MALDI-MS. Spectra obtained from the products of the enzymatic reaction between dTDP-Rha and: A. Acceptor 1 (C13-PP-GlcNAc) B. Acceptor 1+GacB-GFP C. Acceptor 1+GacB cleaved (no GFP) D. Acceptor 2 (Phenol-O—C11-PP-GlcNAc). E. Acceptor 2+GacB-GFP. F. Acceptor 2+GacB cleaved (no GFP) G. Acceptor 2+GacB-D160N-F GFP H. Acceptor 2+GacB-Y182N-F-GFP;

    [0229] FIG. 5 shows an in vitro assessment of GacB's specificity towards different activated nucleotide sugar donors using MALDI-MS. Spectra obtained from the products of the enzymatic reaction between GacB-GFP, acceptor 2 and either dTDP-Rha (A), UDP-Glc (B), UDP-GlcNAc (C) or UDP-Rha (D). The conversion to the product (818 m/z and 840 m/z) was observed only when dTDP-Rha was used as nucleotide sugar donor;

    [0230] FIG. 6 shows an in vitro assessment of GacB's metal ion dependency via MALDI MS. Spectra obtained from the products of the enzymatic reaction between dTDP-Rha, acceptor 2 (A), and either: GacB-GFP (B), 1 mM MgCl.sub.2 (C), 1 mM MnCl.sub.2 (D), or EDTA (E). The conversion to the product (818 m/z and 840 m/z) was observed in all conditions where GacB-GFP was present, regardless of the addition of metal ions or the metal chelator;

    [0231] FIG. 7 shows A) 800 MHz .sup.1H NMR spectra of (a) acceptor substrate 1, (b) product 1, (c) acceptor substrate 2, (d) product 2. B) Partial 2D ROESY spectrum of the product 1 showing the correlations between the H1 of a β-L-Rha and protons of rhamnose (R) and GlcNAc (G). The F2 cross section through H1 of Rha is shown in red. C) The chemical structures with proton numbering.

    [0232] FIG. 8 shows a schematic representation of the RhaPS initiation within different Streptococcus species in comparison to the capsule polysaccharide in S. pneumoniae. RhaPS biosynthesis is initiate on Und-P by GacO (green background), followed by the action of GacB (turquoise), generating the conserved core structure Und-PP-GlcNac-Rha. Percentage of the amino acid sequence identity, positive amino acids, and gaps within the sequence compared to GacO or GacB are given below each homolog: S. mutans serotype c SccB, Streptococcus agalactiae (GBS) RfaB, Streptococcus dysgalactiae subsp. equisimilis 167 (GCS) RgpAc, Streptococcus dysgalactiae subsp. equisimilis ATCC 12394 (GGS) Rs03945. The specific carbohydrate composition extending the lipid linked core structure of each group are depicted on the right side. Repeating units (RU) of the carbohydrates are highlighted (light pink background), symbolic representation of the sugar residues is shown in the figure legend;

    [0233] FIG. 9 shows (top) anti-lipid A and anti-GAC western blot of E. coli total cell lysate. WchF complementation of the dgacB gene cluster complements RhaPS biosynthesis in 21548 cells (lacking Und-PP-GlcNAc, inactive wecA gene), whilst no other GacB and homologous enzyme fail to initiate RhaPS biosynthesis. (Below) All gene combinations result in functional RhaPS biosynthesis in CS2775 cells (containing Und-PP-GlcNAc, functional wecA gene);

    [0234] FIG. 10 A) shows phylogenetic relationships amongst forty-eight partially or completely sequenced streptococcal pathogens. The tree was constructed based a multiple sequence alignment of GacB homologs using the default neighbour-joining clustering method of Clustal Omega. The tree was plotted using iTOL online tool. Black squares at the branches indicate species with fully sequenced genomes. (B) Bar charts associates to each node indicate the percentage amino acid identity of the respective homologs to GacB (blue) or GacO (magenta);

    [0235] FIG. 11 Left) shows anti-GAC western blot of total cell lysate western blot of E. coli 21548 cells expressing dgacB gene cluster and either gacB, gacB-mutants or gacB-WchF chimera. The GacB-WchF chimera complements the dgacB RhaPScluster, suggesting that the N-terminal WchF domain is sufficient to alter the acceptor substrate specificity for GacB from Und-PP-GlcNAc to Und-PP-Glc.Right) Loading control—coomassie stained membrane after Western blotting;

    [0236] FIG. 12 is a schematic diagram to show the composition of the naturally occurring GAC; and

    [0237] FIG. 13 is a schematic diagram to illustrate an embodiment of the invention;

    [0238] FIG. 14 is a schematic diagram to illustrate another embodiment of the invention;

    [0239] FIG. 15 is a schematic diagram to illustrate a further embodiment of the invention;

    [0240] FIG. 16 is a schematic diagram to illustrate another embodiment of the invention;

    [0241] FIG. 17 is a schematic diagram to illustrate embodiments of the invention;

    [0242] FIG. 18 is another schematic diagram to further illustrate the invention;

    [0243] FIG. 19 is an anti GAC Western Blot to show that WbbL can be used instead of GacB or SccB in a method according to the invention. The figure shows an anti-GAC Western blot of total E. coli lysate from cells expressing the gene cluster RmlD-SccC-SccD-SccE-SccF-SccG (deltaSccB) and GacA-GacC-GacD-GacE-GacF-GacG (deltaGacB) complemented with empty plasmid controls or WbbL. Arabinose induction concentrations stated in %;

    [0244] FIGS. 20 and 21 are images of radiolabelled lipid-linked oligosaccharides prepared in vivo;

    [0245] FIG. 22 shows the results from E. coli complementation studies;

    [0246] FIG. 23 shows the results of phylogenetic studies of the GacO, GacB and GacC enzymes from Streptococci spp.;

    [0247] FIG. 24 shows the functional characterisation of GacC and how GacC installs poly-rhamnose to an adaptor/stem;

    [0248] FIG. 25 shows assignment of proton and carbon sugar signals as obtained from 2D TOCSY and NOESY spectra and how this translates into the rhamnose polysaccharide molecule;

    [0249] FIG. 26 shows a Western blot image obtained from generating rhamnose polysaccharides with a WbbPQR adaptor/stem;

    [0250] FIG. 27 shows a schematic of rhamnose polysaccharides generated from Shigella spp. adaptor/stem and GAC repeat units; and

    [0251] FIG. 28 shows rhmanose polysaccharides prepared in accordance with the present invention are capable of acting as substrates for an E. coli glycoconjugation system.

    EXAMPLE 1—GACB IS A α-D-GLCNAC β-1,4-L-RHAMNOSYLTRANSFERASE

    Introduction

    [0252] S. pyogenes relies on different mechanisms to withstand the host's defences (1-5). These mechanisms are supported by the synthesis of a wide array of virulence factors, amongst which is the Group A Carbohydrate (GAC), a surface polysaccharide that constitutes between 40% and 60% of the bacterial cell wall (6-9). GAC is composed of a [.fwdarw.3)α-Rha(1.fwdarw.2)α-Rha(1.fwdarw.] rhamnose polysaccharide (RhaPS) backbone with a β-D-GlcNAc (1.fwdarw.3) side chain modifications on every α-1,2-linked rhamnose (9-11). Recent structural examinations and composition analysis of the GAC also suggest the presence of glycerol phosphate (GroP) (12), an observation that remained unnoticed for over fifty years (13,14). Further, Edgar et al. demonstrated that approximately 25% of GAC side chain GlcNAcs are decorated with GroP, imparting a negative charge to this polymer that has implications on S. pyogenes biology and defence mechanisms (12, 13, 15). This feature, previously identified in other surface glycans (16,17), provided new insight into the structural composition, biosynthesis and function of GAC.

    [0253] GAC is proposed to be synthesised by twelve proteins, GacABCDEFGHIJKL, encoded in one gene cluster (i.e.: MGAS5005_spy0602-0613) that has been found in all S. pyogenes species identified so far (1, 18). Through sequencing of transposon mutant libraries, Le Breton et al. discovered that eight of these genes, gacABCDEFG and gacL are essential for S. pyogenes survival (4, 19). This information supports the observation by van Sorge et al., who identified via insertional mutagenesis that the first three genes of the cluster (gacABC) are essential (1).

    [0254] It is currently hypothesized that the GAC is formed in five consecutive steps: (i) lipid-linked acceptor initiation, (ii) [-.fwdarw.3)α-Rha(1.fwdarw.2)α-Rha(1.fwdarw.] RhaPS backbone synthesis, (iii) membrane translocation, (iv) post-translocational chain modifications in the extracellular environment and (v) linkage to the peptidoglycan (9). The cytoplasmic pool of dTDP-rhamnose is supplied by the enzymes encoded in two separate gene clusters rm/ABC and gacA/rm/D (16).

    [0255] Despite the recent findings, some pressing questions remain unanswered regarding the biosynthesis of the GAC. For example, the products of six of the twelve genes that constitute the GAC cluster (gacBCDEFG) have not yet been characterised, leaving the GAC initiation, RhaPS backbone biosynthesis and translocation steps unknown.

    [0256] As a means of attaining more information on the GAC initiation step, we conducted an in-depth examination of the second enzyme encoded in the GAC gene cluster. Here we demonstrate that GacB, in disagreement with its preliminary genetic annotation and currently proposed action (8), is the first retaining rhamnosyltransferase that catalyses the transfer of L-rhamnose from dTDP-β6-L-rhamnose. GacB forms a β-1,4 glycosidic bond with the lipid-linked GlcNAc-diphosphate through a metal-independent mechanism. More importantly, our research on phylogenetically-related homologs from other important human pathogenic streptococci, in particular from the Lancefield groups B, C and G streptococci, reveal that the role of GacB is well conserved within the Streptococcus genus, suggesting a common first committed step for the production of RhaPS from all Lancefield groups.

    [0257] Experimental Procedures

    [0258] Bioinformatics Analysis

    [0259] Alignment of protein sequences was performed using NCBI Blast Global align (https://goo.gl/vB9zmD) and ClustalOmega (https://goo.gl/8FbvYP) (49). Molecular weight predictions were obtained using the ProtParam tool at the Expasy server (http://www.expasy.org/). Topological predictions were generated using both SpOctopus (http://octopus.cbr.su.se/) and the TMHMM algorithms (www.cbs.dtu.dk/services/TMHMM/).

    [0260] Secondary structure predictions were generated using either Phyre2 (https://goo.gl/zrGKJ7) or RaptorX (raptorx.uchicago.edu) homology recognition engines, and these structures were viewed and analysed using the PyMOL Molecular Graphics System (educational version 1.8 Schrödinger, LLC). The Carbohydrate Active Enzymes database (CAZy) (http://www.cazy.org/) (50) was examined to obtain information about the classification and characterization of carbohydrate active enzymes. Phylogeny relationships were established using Clustal Omega, Clustal X and the interactive tree of life iTOL (22).

    [0261] Bacterial Strains and Growth Conditions

    [0262] E. coli strains DH5a and MC1061 were used indistinctively as host strains for the propagation of recombinant plasmids and plasmid integration. E. coli CS2775, a strain lacking the Rha modification on the lipopolysaccharide, was used as the host strain to evaluate the production of RhaPS. E. coli 21548 is an Und-PP-GlcNAc deficient strain that contains a wecA deletion, serving as a negative control for the production of RhaPS. E. coli strain C43 (DE3) was used for the production of recombinant protein. All E. coli strains were grown in LB media. Unless otherwise indicated, all bacterial cultures were incubated at 37° C. in a shaking incubator at 200 rpm. Where necessary, media were supplemented with one or more antibiotics to the following final concentration: carbenicillin (Amp) at 100 μg/μL, erythromycin (Erm) at 300 μg/μL or kanamycin (Kan) at 50 μg/mL.

    [0263] Molecular Genetic Techniques

    [0264] Table 1 shows the DNA sequence of the forward and reverse oligonucleotide primer pairs used to amplify, delete, or mutagenise the genes of interest. All primers were obtained from Integrated DNA Technologies (IDT). All PCR reactions were performed using a SimpliAmp™ Thermal Cycler from ThermoFisher Scientific with standard procedures. Constructs were cloned using standard molecular biology procedures, including restriction enzyme digest and ligation. All constructs were validated with DNA sequencing.

    TABLE-US-00001 Gene Amplified Plasmid product/ from/ Restriction ID Gene/s Description Origin Fwd Primer Rev Primer Enzymes Vector Inductor pHD0119 S. mutans S. mutans S. mutans pRGP-11 — sccACDEFG ΔsscB- Xc47 chromosomal pRGP-12 DNA sccABCDEFG with an insertion in sccB (SccB_1-277) pHD0120 S. mutans S. mutans S. mutans pRGP-12 — sccABCDEFG ΔsscC Xc47 chromosomal DNA sccABCDEFG with an insertion in sccC (SccB_1-160) pHD0131 pBAD24 Empty pBAD24::ampR pBAD24 Arabinose vector empty vector pHD0136 S. mutans SccABCDEFG S. mutans pRGP-1 — sccABCDEFG Xc47 chromosomal DNA sccABCDEFG pHD0139 Ori 15A Smu pHD0136 A102 A103 Modified — Erm empty (TACCTCGAGGGCAAAGCCG (TACGGATCCGTTATTTCCTC pRGP1 vector TTTTTCCATAGGCTCCGCCC) CCGTTAAATAATAGATAAC) ΔsscABCDEFG SEQ ID NO: 47 SEQ ID NO: 48 pHD0183 gacB gfp GFP- S. pyogenes A042 (AGACTCGAG A125 BamHI/ pWaldoE IPTG tagged MGAS505 ATGCAGGATGTTTTTATCAT (AGACTCGAGATGTTCATTTA XhoI GacB complete TGGTAGC) SEQ ID NO: 49 AAAATAAAGCCTCGTAC) genome SEQ ID NO: 50 GenBank NC_007297 NCBI (2015) pHD0194 gacB GacB_M5005_- S. pyogenes A155 A156 EcoRI/ pBAD24 Arabinose RS03100 MGAS505 (TCTGAATTCATGCAGGATG (ACACTGCAGTTAATGTTCAT PstI complete TTTTTATCATTGGTAGC) TTAAAAATAAAGCCTCGTAC) genome SEQ ID NO: 51 SEQ ID NO: 52 GenBank NC_007297 NCBI (2015) pHD02227 gacB_D126A GacB pHD0194 A198 (CAATCCAGCTGGGTTAGAG EcoRI/ pBDAD24 Arabinose amino (CACTCTAACCCAGCTGGAT TGGAAACGGTCT) SEQ ID PstI acid TGATAAAAAAGCG) A199 NO: 54 substitution SEQ ID NO: 53 D126A pHD0228 gacB_E222A GacB pHD0195 A200 A201 EcoRI/ pBDAD24 Arabinose amino (CGTAATTATTTGCAGGAACA (CGCTTTGTTCCTGCAAATAA PstI acid AAGCGTCCTAAATG) SEQ TTACGAAACCGC) SEQ ID substitution ID NO: 55 NO: 56 E222A pHD0229 gacB_D160A GacB pHD0196 A202 A203 EcoRI/ pBDAD24 Arabinose amino (CAATGCCAATATTAGCTGAA (GGTCATTTCAGCTAATATTG PstI acid ATGACCAAATC) SEQ ID GCATTGACCGC) SEQ ID substitution NO: 57 NO: 58 D160A pHD0230 gacB_Y182A GacB pHD0197 A204 A205 EcoRI/ pBDAD24 Arabinose amino (GTCTGCGTTCCAGCAGCAA (GTTTTATTGCTGCTGGAACG PstI acid TAAAACATGTTTTAG) SEQ ID CAGACACAACCTTC) SEQ ID substitution NO: 59 NO: 60 Y182A pHD0231 gacB_D126A GacB pHD0198 A219 A220 EcoRI/ pBDAD24 Arabinose amino (CTCTAACCCGTTTGGATTG (CGCTTTTTTATCAATCCAAA PstI acid ATAAAAAAGCGTCCACCTCG) CGGGTTAGAGTGGAAACGG substitution SEQ ID NO: 61 TC) SEQ ID NO: 62 D126N pHD0232 gacB_E222Q GacB pHD0199 A221 A222 (GTTCCTCAAAATAATTA EcoRI/ pBDAD24 Arabinose amino (GGTTTCGTAATTATTTTGAG CGAAACCGC) SEQ ID NO: 64 PstI acid GAACAAAGCG) SEQ ID substituion NO: 63 E222Q pHD0233 gacB_D160N GacB pHD0200 A223 A224 EcoRI/ pBDAD24 Arabinose amino (TGCCAATATTATTTGAAATG (GATTTGGTCATTTCAAATAA PstI acid ACCAAATCAGCC) SEQ ID TATTGGCATTGACCGCTACC) substitution NO: 65 SEQ ID NO: 66 D160N pHD0234 gacB_Y182F GacB pHD0201 A225 A2226 EcoRI/ pBDAD24 Arabinose amino (GGTTGTGTCTGCGTTCCGA (GTTTATTGCTTTCGGAACG PstI acid AAGCAATAAAACATGTTTTA CAGACACAACCTTCACG substitution GACC) SEQ ID NO: 67 SEQ ID NO: 68 Y128F pHD0235 gacB_K131R GacB pHD0202 A241 A242 EcoRI/ pBDAD24 Arabinose amino (TTTAGACCGCGTCCACTCT (AGAGTGGACGCGGTCTAAA PstI acid AACCCGTCTGG) SEQ ID TGGTCAAGACC) SEQ ID substitution NO: 69 NO: 70 K131R pHD0256 S. pyogenes GacA- A170 A156 Ncol/ Modified — gacA, CDEFG (TTCGGATCCAACTATTAGC (ACActgcagttaatgttcattt PstI pRGP1 gacB-292-385, from CTACATTCGAGAACAGG) aaaaataaagcctcgtac) gacCDEFG S. pyogenes SEQ ID NO: 72 MGAS505 NC_007297 with GacB 292-385 (inactive) pHD0312 gacB_119- GacB pHD0183 A015 A016 XhoI/ pWaldoE Arabinose 385 without (CTTTAAGAAGGAGACTCGA (GTCTGGATTGATAAAAAAGC BamHI residues GATGGGACGCTTTTTTATCA GTCCCATCTCGAGTCTCCTT 1-118 ATCCAGAC) SEQ ID NO: 73 CTTAAAG) SEQ ID NO: 74 pHD0313 gacB_127- GacB pHD0183 A017 A018 XhoI/ pWaldoE Arabinose 385 without (CTTTAAGAAGGAGACTCGA (GACCGTTTCCACTCTAACC BamHI residues GATGGGGTTAGAGTGGAAA CCATCTCGAGTCTCCTTCTT 1-127 CGGTC) SEQ ID NO: 75 AAAG) SEQ ID NO: 76 pHD0322 gacB_76- GacB pHD0194 A3464 A156 BamHI/ pBAD24 Arabinose 385 without (GGATCCATGATGGCAATTA (ACACTGCAGTTAATGTTCAT PstI residues CCTATGCCCTGTC) SEQ ID TTAAAAATAAAGCCTCGTAC) 1-76 NO: 77 SEQ ID NO: 78 pHD0323 gacB_23- GacB pHD0194 A365 A156 BamHI/ pBAD24 Arabinose 385 without (GGATCCATGGAAGAGTTGA (ACACTGCAGTTAATGTTCAT PstI residues TTAGTCATCAATCATCT) TTAAAAATAAAGCCTCGTAC) 1-23 SEQ ID NO: 79 SEQ ID NO: 80 pHD0332 sccB_TTG Extended pHD0136 A373 A370 KpnI/ pBAD2 Arabinose SccB_TTG_BAA (GGTACCATGCGTCATATATT (ATATTCTAGAATTATAGGTA PstI 32089.1 CATCATAGGAAGTCGCG) CCCCTTATTAAAGTTAAACAA with a SEQ ID NO: 81 AATTATTTC) SEQ ID NO: 82 TTG start codon pHD0333 sccB_ATG Extended pHD0136 1ST A425 1ST A426 KpnI/ pBAD24 Arabinose SccB_TTG_BAA (GCTATCCGTGAGTTCATGA (CGAAGTCATGAACTCACGG PstI 32089.1 CTTCG) SEQ ID NO: 83 ATAGC). 2ND A0424 SEQ ID with a 2ND A0372 NO: 85 ATG (CTGCAGTTAACTTTCATGTA (GGAGGAATTCACCTTGCGT start AGAACAAGTCCTCGTAC) CATATATTCATCATAGGAAG codon SEQ ID NO: 84 TCGCG) SEQ ID NO: 86 pHD0440 wchF_1- WchF- pHD0194-pHD0486 A634 A768 EcoRI/ pBAD24 Arabinose 186 + GacB (TCTGAATTCATGAAACAGTC (GGTTGTGTCTGCGTTCCAT PstI gacB_179- chimaera AGTTTATATCATTGGTTCAA) AAGCAATAAAGGTCGTCTTG 385 SEQ ID NO: 87 GGCTGATACTG) SEQ ID NO: 88 pHD0441 gacB_L128H_R131L_- GacB pHD605 A770 A771 EcoRI/ pBAD24 Arabinose GNT100ACR_A105P with (CCAGATTCAGAACCCTATTT (CGATTGTGAATCTGCTTCAC PstI amino TTTATGTGTTGGCGTGTCGA AAATGGCGCAATAAATGGGC substitution GTAGGCCCATTTATTGCGCC CTACTCGACACGCCAACACA L128H_R131L_- ATTTGTGAAGCAGATTCACA TAAAAAATAGGGTTCTGAAT GNT100ACR_A105P ATCG) SEQ ID NO: 89 CTGG) SEQ ID NO: 90 pHD0445 gacBL128H_R131L GacB pHD0194 A736 A737 EcoRI/ pBAD24 Arabinose with (CAATCCAGACGGGCACGGAG (GTCTTGACCATTTAGACAGT PstI amino TGGAAACTGTCTAATGGTC TTCCACTCGTGCCCGTCTGG acid AAGAC) SEQ ID NO: 91 ATTG) SEQ ID NO: 92 substitutions L128H_R131L pHD0457 gacB_D160N - GFP- pHD0233 A223 A224 XhoI/ pWaldoE IPTG gfp tagged (TGCCAATATTATTTGAAATG (GATTTGGTCATTTCAAATAA BamHI GacB ACCAAATCAGCC) SEQ ID TATTGGCATTGACCGCTACC) amino NO: 93 SEQ ID NO: 94 acid substitution D160N pHD0458 gacB_Y182D - GFP- pHD0234 A225 A226 XhoI/ pWaldoE IPTG gfp tagged (GGTTGTGTCTGCGTTCCGA (GTTTTATTGCTTTCGGAACG BamHI GacB AAGCAATAAAACATGTTTTA CAGACACAACCTTCACG) amino GACC) SEQ ID NO: 95 SEQ ID NO: 96 acid substitution Y182F pHD0477 S. dysgalactiae GacB NCBI A604 A605 PstI/ pBAD24 Arabinose subsp. homolog NC_0175671.1 (ATCTGAATTCATGCAGGAT (ACACTGCAGTTAATGTTCAT EcoRI equisimilis from the WP_01461218.01 GTTTTCATCATTGGTAGC) CTAAAAATAAAGCCTCATAC) ATCC Group G SEQ ID NO: 97 SEQ ID NO: 98 12394_RS03945 Streptococcus - SDSE_ATC12394_- RS03945 pHD0478 S. agalactiae GacB NCBI: A606 A607 PstI/ pBAD24 Arabinose SAG1423 homolog txid208435 (TCTgaattcatgcaagatgttttc (ACActgcagttaactttcGttCaaG EcoRI from the WP_001154381.1 attatagg) SEQ ID NO: 99 aacaaGtcctc) SEQ ID NO: 100 Group B Streptococcus - KXA41920.1 pHD0479 S. dysgalactiae GacB GenBank: A607 A609 PstI/ pBAD24 Arabinose subsp. homolog AP012976. (ATGAATTCATGCAGGATGTT TAAAAATAAAGCCTCATACT EcoRI equisimilis from the BAN9325.1 TTCATCATTGGTAGCAGA) CCCCAACAAT) SEQ ID 167 Group C SEQ ID NO: 101 NO: 102 rgpAc Streoptococcus - WP_022554465.1 pHD0486 S. pneumonia WchF_SBT85395.1 CAI34122 A634 A635 PstI/ pBAD24 Arabinose wchF from NCBI (TCTgaattcatgaaacagtcagt (ATATctgcaggcatcatacagta EcoRI S. pneumoniae taxon: ttatatcattggttcaa) aacacttcctcataatctgac) serotype 1313 SEQ ID NO: 103 SEQ ID NO: 104 2 pHD0605 GacB_L128H_R131L_- GacB pHD0445 A772 A773 EcoRI/ pBAD24 Arabinose GNT100ACR_mutant with (CCAGATTCAGAACCCTATTT (CGATTGTGAATCTGCTTCAC PstI amino TTTATGTGTTGgcgtgtcgaGTA AAATGGCGCAATAAAagcGC acid GGCgctTTTATTGCGCCATTT CTACtgacacgcCAACACATAA substitutions GTGAAGCAGATTCACAATCG) AAAATAGGGTTCTGAATCTG L128H_R131L_- SEQ ID NO: 105 SEQ ID NO: 106 GNT100ARC

    [0265] Determination of RhaPS Production

    [0266] 50 μL of OD.sub.600-normalised overnight cultures grown at 37° C. were mixed with 50 μL of 6×SDS-loading buffer and resolved in 20% Tricine-SDS gels (29). Assessment of the RhaPS production was performed via immunoblotting on PVDF membranes following the traditional immunoblotting technique. Primary antibody: rabbit-raised anti-Streptococcus pyogenes Group A carbohydrate polyclonal antibody (Abcam, ab21034). Secondary antibody: goat-raised anti-rabbit IgG HRP conjugate (Biorad, 170-6515). Immunoreactive signals were captured using GENESYS™ 10S UV-Vis Spectrophotometer (Thermo Scientific) after exposure to the Clarity Western ECL (Biorad).

    [0267] Extraction and Radiolabelling of Lipid-Linked Oligosaccharides

    [0268] Radiolabelled lipid-linked saccharides (LLS) of induced E. coli CS2775 cells bearing the selected plasmids were extracted using 1:1 CHCl.sub.3/CH.sub.3OH and water-saturated butan-1-ol (1:1 v/v) solution to determine the addition of sugar residues in vivo after glucose D[6s.sup.3H] (N) (Perkin Elmer) supplementation (1 mCi/mL). The incorporated radioactivity was measured in a Beckman Coulter® LS6000SE scintillation counter. The organic phase containing the LLSs were normalised to 0.05 μCi/μL. The samples were separated via thin layer chromatography (TLC) on a HPTLC Silica Gel 60 plate (Merck) using a C:M:AC:A:W mobile phase (180 mL chloroform+140 mL methanol+9 mL 1M ammonium acetate+9 mL 13 M ammonia solution, 23 mL distilled water), then dried and sprayed with En 3 Hance™ liquid (Perkin Elmer). Radioautography images were obtained from Carestream® Kodak® BioMax® XAR Film and MS Intensifying Screens after 5 to 10 days.

    [0269] Purification of Recombinantly Expressed Membrane Associated Proteins

    [0270] The purification was conducted following the established protocol from Waldo, et. al. (30) with the following modifications. Overnight cultures of E. coli C43 (DE3) cells expressing C-terminal GFP-fusion proteins were diluted 1:100, incubated for 3 hours until OD.sub.600=0.6, induced with 0.5 mM IPTG and shifted to room temperature overnight, all at 200 rpm shaking. GPF expression was detected through in-gel fluorescence using a Fujifilm FLA-5000 laser scanner. Cloning, expression and purification of GacB-WT, GacB-D160N-GFP and GacB-Y182-GFP: plasmids containing GFP-Hiss-tagged recombinant proteins were constructed as described in Table 1 into the vector pWaldo-E (30). For protein production and purification purposes, the vectors were transformed into E. coli C43 (DE3) cells and expressed as described above. The cells were fractionated using an Avestin C3 High-Pressure Homogenisator (Biopharma, UK) and spun down at 4000×g. Further centrifugation of the supernatant at 200 000×g for 2 h rendered 2-3 g of membrane containing the GacB-GFP proteins. Membranes were solubilised in Buffer 1 (500 mM NaCl, 10 mM Na.sub.2HPO.sub.4, 1.8 mM KH.sub.2PO.sub.4 2.7 mM KCl, pH of 7.4, 20 mM imidazole, 0.44 mM TCEP) with the addition of 1% DDM (Anatrace) for 2 hr at 4° C. and bound to a 1 mL Ni-Sepharose 6 Fast Flow (GE healthcare) column, prewashed with buffer 1 plus 0.03% DDM. Elution was conducted using Buffer 1 supplemented with 250 mM imidazole and 0.03% DDM. Imidazole was removed using a HiPrep 26/10 desalting column (GE Healthcare) equilibrated with Buffer (PBS, 0.03% DDM, 0.4 mM TCEP). The GFP-His tag was removed with PreScission Protease cleavage in a 1:100 ratio overnight at 4° C. Cleaved GacB proteins were collected after negative IMAC. Protein identity and purity was determined by tryptic peptide mass fingerprinting, matrix-assisted laser desorption/ionisation time-of-flight mass spectrometry (MALDI-TOF), respectively (University of Dundee ‘Fingerprints’ Proteomics Facility).

    [0271] Synthesis of Acceptor Acceptor 1 and 2

    [0272] Acceptor 2 (P.sup.1-(11-phenoxyundecyl)-P.sup.2-(2-acetamido-2-deoxy-α-D-glucopyranosyl) diphosphate) was synthesised as sodium salt from phenoxyundecyl dihydrogen phosphate and 2-acetamido-2-deoxy-3,4,6-tri-O-acetyl-α-D-glucopyranosyl dihydrogen phosphate according to the procedure by T. N. Druzhinina et al. 2010 (94). Acceptor 1 (P.sup.1-tridecyl-P.sup.2-(2-acetamido-2-deoxy-α-D-glucopyranosyl) diphosphate) was synthesised from tridecyl dihydrogen phosphate (obtained similarly to phenoxyundecyl dihydrogen phosphate) by the same procedure as described for acceptor 2.

    [0273] GacB In Vitro Enzymatic Reaction

    [0274] Purified GacB-WT-GFP, GacB-D160N-GFP, GacB-Y182F-GFP and the GacB (tag-less) protein (0.15 mg/ml final concentration) were mixed in a 100 μl TBS buffer supplemented with 1 mM TDP-Rha as sugar donor and 1 mM acceptor-1 (C.sub.13—PP-GlcNAc) or 1 mM acceptor-2 (Phenol-O—C.sub.11H.sub.22—PP-GlcNAc) as acceptor substrate. The reaction was incubated for 3 h to 24 h at 30° C. The assay mixture was adjusted with the exchange of the nucleotide sugar donor to UDP-Rha or UDP-GlcNAc and with the addition of either 1 mM MgCl.sub.2, 1 mM MnCl.sub.2, or 1 mM EDTA to define the essentiality of metal dependency.

    [0275] Mass Spectrometry Analysis

    [0276] Matrix-assisted Laser Desorption Ionization Time-of-Flight (MALDI-TOF) was used to analyse the acceptors and products of the GacB in vitro assay. 100 μl reaction samples were purified over a 100 μL Sep-Pak C18 cartridges (Waters, UK), pre-equilibrated with 5% EtOH. The bound samples were washed with 800 μl H.sub.2O and 800 μl 15% EtOH, eluted in two fractions with a) 800 μl 30% and b) 800 μl 60% EtOH. The two elution fractions were dried in a speed vac and resuspended in 20 μl 50% MeOH. 1 μl of sample was mixed with 1 μl 2,5-dihydroxybenzoic (DHB) acid matrix (15 mg/mL in 30:70 acetonitrile: 0.1% TFA) and 1 μl was added to the MALDI grid. Samples were analyzed by MALDI in an Autoflex speed mass spectrometer set up in reflection positive ion mode (Bruker, Germany).

    [0277] NMR Analysis

    [0278] The purified GacB in vitro assay products (0.5-2 mg) were dissolved in D20 (550 μL) and measured at 300 K. The spectra were acquired on a 4-channel Avance III 800 MHz Bruker NMR spectrometer equipped with a 5 mm TCl CryoProbe™ with automated matching and tuning. 1D spectra were acquired using the relaxation and acquisition times of 5 and 1.8 s, respectively. Between 32 and 512 scans were acquired using the spectral width of 11 ppm. J connectivities were established in a series of 1D and 2D TOCSY experiments with mixing times between 20 and 120 ms. Selective 1D TOCSY spectra (32) were acquired using a 40 ms Gaussian pulses and DIPSI-2 sequence (33) (γB.sub.1/2π=10 kHz) for spin lock of between 20 and 120 ms. The following parameters were used to acquire 2D TOCSY and ROESY experiments: 2048 and 768 complex points in t.sub.2 and t.sub.1, respectively, spectral widths of 11 and 8 ppm in F.sub.2 and F.sub.1, yielding t.sub.2 and t.sub.1 acquisition times of 116 and 60 ms, respectively. Sixteen scans were acquired for each t.sub.1 increments using a relaxation time of 1.5 s. The overall acquisition time was 6-7 hours per experiment. A forward linear prediction to 4096 points was applied in F.sub.1. A zero filling to 4096 was applied in F.sub.2. A cosine square window function was used for apodization prior to Fourier transformation in both dimensions. The ROESY mixing time was applied in the form of a 250 ms rectangular pulse at γB.sub.1/2π=4167 Hz. DIPSI-2 sequence (γB.sub.1/2π=10 kHz) was applied for a 20, 80 and 120 ms spin lock. 2D magnitude mode HMBC experiments: 2048 and 128 complex points in t.sub.2 and t.sub.1, respectively, spectral widths of 6 and 500 ppm in F.sub.2 and F.sub.1, yielding t.sub.2 and t.sub.1 acquisition times of 0.35 s and 0.6 ms, respectively. Two scans were acquired for each of 128 t.sub.1 increments using a relaxation time of 1.2 s. The overall acquisition time was 8 minutes. A forward linear prediction to 512 points was applied in F.sub.1; zero filling to 4096 was applied in F.sub.2. A sine square window function was used for apodization prior to Fourier transformation in both dimensions.

    [0279] GacC/Homologous Enzymes Protein Purification

    [0280] For production of recombinant proteins, target genes (GacC, GbcC, Cps2F, SccC) were synthesized using IDT's gBlock gene fragment synthesis service. Wild-type sequences for GacC and its' homologs were PCR amplified with overhangs designed for cloning into pOPINF.sup.1, which contains an N-terminal 6× Histidine tag for affinity purification. Cloning into pOPINF was carried out using In-Fusion™ cloning technology (Clontech). The resulting plasmids were then transformed into DH5α: competent cells for propagation and extraction (miniprep kit; Qiagen). Positively transformed plasmids were identified by size comparison to a non-transformed control pOPINF plasmid using gel electrophoresis, which were subsequently confirmed by DNA sequencing. For insertion of point mutants, wild-type plasmids were used as templates to PCR amplify 2 overlapping fragments containing the desired point mutant. Fragments were designed to contain a minimum of a 15 bp overlap and were cloned into pOPINF and sequence verified as for wild type plasmids. A full list of primers used for both wild-type and mutant cloning can be found in Table A.

    [0281] Sequence verified plasmids were then transformed into C43 cells for protein expression. For activity assays, 1 L of E. coli culture typically yielded enough protein for >50 assays (1 mg L.sup.−1). Cultures were grown at 37° C. and shaking at 200 RPM to an OD of 0.6-1, at which point they were transferred to 18° C. for 1 hour before induction with 0.5 mM isopropyl β-D-thiogalactopyranoside (IPTG). Cultures were left shaking at 18° C. overnight. Following centrifugation of the culture at 3000×g, proteins were extracted in Buffer A0 (50 mM HEPES pH 7.5, 300 mM NaCl, 10% glycerol, 2 mM TCEP) supplemented with protease inhibitors, using an Avestin C3 cell disruptor according to the manufacturer's instructions. Lysed cultures were then subject to ultracentrifugation at 200,000×g and the supernatant was collected. The supernatant containing the soluble proteins of interest was then purified over a Nickel-affinity (Thermo Fisher) column using wash Buffer A (50 mM HEPES pH 7.5, 300 mM NaCl, 10% glycerol, 2 mM TCEP, 20 mM imidazole) and elution Buffer B (50 mM HEPES pH 7.5, 300 mM NaCl, 10% glycerol, 2 mM TCEP, 400 mM imidazole) according to manufacturer's instructions. Elution fractions containing the target proteins were then passed over a desalting column, preequilibrated with Buffer A0, to remove imidazole. Protein samples were concentrated to 0.5-1 mg/ml and snap frozen in liquid nitrogen until use.

    TABLE-US-00002 TABLE A Name SEQUENCE (5′ TO 3′) Use A872_GacC_pOP1N_fwd AAGTTCTGTTTCAGGGCCCGAACATTAAT Cloning of N- ATTTTACTATCCACCTAC (SEQ ID NO: terminal region of 107) GacC constructs A873_GacC_pOP1N_rev ATGGTCTAGAAAGCTTTACTTTCTCCTGT Cloning of C- AACCAAATAAGGTAAC (SEQ ID NO: 108) terminal region of GacC constructs A810_GbcC_pOP1N_fwd AAGTTCTGTTTCAGGGCCCGAAGGTTAAT Cloning of N- ATCTTAATGGCCACCTAC (SEQ ID NO: terminal region of 109) GbcC constructs A811_GbcC_pOP1N_rev ATGGTCTAGAAAGCTTTATCTCTTATTGTA Cloning of C- ATAATTTGTTGCAATCAACC (SEQ ID NO: terminal region of 110) GbcC constructs A948_RgpB_pOP1N_fwd AAGTTCTGTTTCAGGGCCCGAAAGTTAAT Cloning of N- ATTTTAATGTCCACCTAC (SEQ ID NO: terminal region of 111) SccC constructs A949_RgpB_pOP1N_rev ATGGTCTAGAAAGCTTTATTTTCTCCTATA Cloning of C- ACCAAATTTAG (SEQ ID NO: 112) terminal region of SccC constructs A936_Cps2F_pOPIN_fwd AAGTTCTGTTTCAGGGCCCGAGTAACAA Cloning of N- GCAAATTG (SEQ ID NO: 113) terminal region of Cps2F constructs A937_Cps2F_pOPIN_rev ATGGTCTAGAAAGCTTTAAATAAACATTAA Cloning of C- CTCACCG (SEQ ID NO: 114) terminal region of Cps2F constructs A968_GbcC_R217G_nterm_rev CTTAAATCTCTTATCCATTGTACCCGCCC Reverse primer for CCAAAAC (SEQ ID NO: 115) N-terminal fragment of R217G A969_GbcC_R217G_cterm_fwd GTTTTGGGGGCGGGTACAATGGATAAGA Forward primer for GATTTAAG (SEQ ID NO: 116) C-terminal fragment of R217G A970_GbcC_K221G_nterm_rev CGAAGTATCTTAAATCTACCATCCATTGT Reverse primer for CCTC (SEQ ID NO: 117) N-terminal fragment of K221G A971_GbcC_K221G_cterm_fwd GAGGACAATGGATGGTAGATTTAAGATAC Forward primer for TTCG (SEQ ID NO: 118) C-terminal fragment of K221G A972_GbcC_K224G_nterm_rev GACCTTCACGAAGTATACCAAATCTCTTA Reverse primer for TCC (SEQ ID NO: 119) N-terminal fragment of K224G A973_GbcC_K224G_cterm_fwd GGATAAGAGATTTGGTATACTTCGTGAAG Forward primer for GTC (SEQ ID NO: 120) C-terminal fragment of K224G A958_GbcC_R227G_nterm_rev TAGATTTAGGACCTTCACCAAGTATCTTA Reverse primer for AATCTC (SEQ ID NO: 121) N-terminal fragment of R227G A959_GbcC_R227G_cterm_fwd GAGATTTAAGATACTTGGTGAAGGTCCTA Forward primer for AATC (SEQ ID NO: 122) C-terminal fragment of R227G A992_GacC_D91A_Fwd GCAGATGTCTATTTTTTCAGTGCCCAAGA TGATATATGGTTAGAC (SEQ ID NO: 123) A993_GacC_D91A_rev GTCTAACCATATATCATCTTGGGCACTGA AAAAATAGACATCTGC (SEQ ID NO: 124) A994_Y206F_fwd CTTGATATTCCAACAGAATTATTCCGTCA GCACGATGC (SEQ ID NO: 125) A995_Y206F_rev GCATCGTGCTGACGGAATAATTCTGTTGG AATATCAAG (SEQ ID NO: 126) A998_GacC_H209A_fwd CAACAGAATTATACCGTCAGGCCGATGCT AACGTGTTGGG (SEQ ID NO: 127) A999_GacC_H209A_rev CCCAACACGTTAGCATCGGCCTGACGGT ATAATTCTGTTG (SEQ ID NO: 128) .sup.1Berrow NS, Alderton D, Sainsbury S, Nettleship J, Assenberg R, Rahman N, Stuart DI, Owens RJ. A versatile ligation-independent cloning method suitable for high-throughput expression screening applications. Nucleic acids research. 2007 Mar 1; 35(6): e45.

    [0282] HPLC Assay

    [0283] For in vitro enzyme analyses, 50 μl reactions were set up to include 2.5 mM synthetic lipid acceptor PH—O—C.sub.11H.sub.22—PP-alpha-NAG, 12.5 mM TDP-L-rhamnose, 0.5-1.5 μM GacB-GFP, and 1.25-2.5 μM GacC or homolog/mutant of interest, topped up to 50 μl with TBS Buffer supplemented with 2 mM MnCl.sub.2. Reactions were incubated at 30° C. and when desired timepoints were met, quenched with 50 μl acetonitrile and left on ice for 15 minutes. Reactions were spin filtered at 14,000 RPM in a benchtop centrifuge to remove precipitated protein before being injected onto a Xbridge BEH Amide OBS Prep column (130 Å, 5 μM, 10×250 mm) connected to an HPLC system fitted with a UV detector set to 270 nm (Ultimate 3000, Thermo). Samples were applied to the column at 4 ml/min using Running Buffer A (95% acetonitrile, 10 mM ammonium acetate, pH 8) and Running Buffer B (50% acetonitrile, 10 mM ammonium acetate, pH 8) over a gradient of increasing concentration of B. Increasingly polar products with additional sugar residues eluted later into the gradient, with the triple rhamnosylated GacC product typically eluting ˜14 min into a 36 min run. Products purified from the HPLC were dried in a speed vacuum to remove excess acetonitrile, before being freeze-dried to remove residual water and ammonium acetate. Samples could be stored at −20° C. for structural analysis.

    [0284] NMR Analysis GacC Product

    [0285] For NMR analysis at the University of Dundee, HPLC purified products (0.5-2 mg) were resuspended in 600 μl of D20 and NMR spectra were recorded at 293 K. The spectra were acquired on a Bruker AVANCE III HD 500 MHz NMR Spectrometer equipped with a 5-mm QCPI cryoprobe. NMR spectra were recorded as described for the GacB reaction product. Spectra were analysed using Bruker Topsin (4.0.7).

    [0286] Results

    [0287] GacB is Required for the Biosynthesis of the GAC RhaPS Chain

    [0288] To investigate the GacB function and to identify potential catalytic residues, we used E. coli as a heterologous expression system to study the GAC RhaPS backbone biosynthesis. We constructed two vectors carrying the homologous genes from S. pyogenes, gacACDEFG (gacA-G; ΔgacB) and gacB (FIG. 1A).

    [0289] The RhaPS chain is presumed to be translocated to the outer membrane in E. coli, which naturally contains rhamnose attached to the lipopolysaccharides. Thus, to avoid unspecific binding of the anti-GAC antibody, all transformations were made using a rfaS-deficient strain (20). The interruption of the rfaS gene impedes the attachment of rhamnose to the LPS on the bacterial outer membrane, rendering a strain that lacks endogenous rhamnose on its surface (20). The role of GacB was investigated using the traditional complementation strategy depicted in FIG. 1.

    [0290] We investigated the production of RhaPS by gacA-G from our complementation approach using immunoblots of total cells lysates (FIG. 1B). If the expression of GacBCDEFG is sufficient to produce the RhaPS chain, then we should be able to detect the synthesised RhaPS using a specific anti-GAC antibody. The results showed that E. coli cells lacking the gacA-G gene cluster (empty vector) did not produce RhaPS (FIG. 1, lane 2). Likewise, transformants bearing the ΔgacB or ΔsccB plasmids lost reactivity with the GAC antibody (FIG. 1, lane 3 and 5). Instead, co-transformation of sccB+ΔsccB or gacB+ΔgacB restored the RhaPS production, underlining the essentiality of sccB and gacB for the biosynthesis of the GAC backbone (FIG. 1, lane 4 and 6).

    [0291] In order to investigate if GacB and SccB are catalysing the same reaction, we tested the ability of GacB to functionally substitute SccB and vice versa by co-transforming ΔsccB+gacB and ΔgacB+sccB. In all cases, SccB and GacB were interchangeable (FIG. 2). GacB's predicted initiation codon was different from S. mutans SccB, with the latter using TTG instead of ATG (FIG. 2). We decided to test two versions of SccB; one with a TTG as the initiation codon and the other one with an ATG. Both versions rendered an active enzyme that could complement either ΔsccB and ΔgacB (FIG. 2). Unless stated otherwise, all further work was conducted using sccB constructs with the native TTG start codon.

    [0292] GacB Extends a Lipid-Linked Precursor

    [0293] We investigated whether GacB is a GT that uses GlcNAc-PP-Und as an acceptor. We performed an in vivo experiment generating radiolabelled lipid-linked oligosaccharides (LLO), which were isolated from the bacterial membrane and separated via thin-layer chromatography (TLC). Based on the annotation as a rhamnosyltransferase, radiolabelled dTDP-β-L-rhamnose would be the preferred sugar donor for GacB. However, this compound is not commercially available, therefore tritiated glucose was chosen as an alternative. Inside the bacterial cell, glucose is used as a substrate to synthesise a wide array of organic components, including dTDP-L-rhamnose (25).

    [0294] We hypothesised that GacB transfers an activated sugar from a (radiolabelled) nucleotide sugar donor to a membrane-bound acceptor monosaccharide-PP-Und, e.g. GlcNAc-PP-Und. Therefore, we expected a change in size of the membrane bound acceptor, compared to the signal of the monosaccharide lipid-linked acceptor after running the samples in a TLC plate. As negative control, we used E. coli CS2775 (ArfaS) transformed with the empty vector. This transformant showed a signal consistent with the generation of monosaccharide-PP-Und (FIG. 3 lane 1). Upon expression of either the gacB or sccB genes, we observed the accumulation of a radioactive signal that migrated more slowly on the TLC plate, suggesting a higher molecular mass for these compounds (FIG. 3, lane 3 and 4). The same shift was observed for the sccAB-DEFG (AsccC) construct (FIG. 3, lane 2), demonstrating that sccB and gacB can glycosylate a lipid-linked precursor. Based on the literature, we assume that the upper radiolabelled band corresponds to GlcNAc-PP-Und, and the lower one to Rha-GlcNAc-PP-Und (8, 9).

    [0295] GacB is a Rhamnosyltransferase that Transfers Rhamnose from TDP-β-I-Rha onto GlcNAc-PP-Lipid Acceptors

    [0296] The observed band shift suggested that GacB adds a monosaccharide to a lipid-linked precursor, most likely GlcNAc-PP-Und. We investigated this hypothesis using recombinantly produced and purified GacB WT and amino acid mutants (mutants D.sub.160N and Y.sub.182F). We established an in vitro assay using the predicted nucleotide sugar donor, TDP-β-L-rhamnose and a synthetic acceptor substrate. We tested two of these synthetic substrates designed to mimic the native lipid-linked acceptor: C.sub.13H.sub.27—PP-GlcNAc (acceptor 1) or phenyl-O—C.sub.11H.sub.22—PP-GlcNAc (acceptor 2) (FIG. 7C). The reactions were purified and characterised using matrix-assisted laser desorption ionisation mass spectrometry (MALDI-MS) in positive ion mode.

    [0297] The MALDI-MS spectra of the enzymatic reaction (FIG. 4) confirmed that GacB catalyses the addition of one rhamnose to both acceptor substrates when incubated with TDP-β-L-rha (FIGS. 4B and E). Acceptor 1 possesses a molecular weight of 563 Da and is detected at both m/z=608 [M-1H+2Na].sup.+ and m/z=630 [M-2H+3Na].sup.+ (FIG. 4A). GacB-GFP and GacB lacking the GPF tag modified the acceptor, resulting in one predominant peak at m/z=776 [M-2H+3Na].sup.+ (FIG. 4B, C). In this spectrum, we can also observe an additional peak of lower intensity at m/z=754 [M-1H+2Na].sup.+, corresponding to the modified acceptor 1 coupled with 2 Na.sup.+ ions, instead of 3 Na.sup.+ ions. In both cases, the products are shifted by m/z=146 compared to the unmodified acceptor, which is consistent with the addition of one rhamnose via a glycosidic linkage. The same mass shift was observed for the second acceptor; the peaks of the unmodified acceptor 2 (FIG. 4D) were detected at m/z=672 [M-1H+2Na].sup.+ and m/z=694 [M-2H+3Na].sup.+, while the product peaks emerge at m/z=818 [M-1H+2Na].sup.+ and m/z=840 [M-2H+3Na].sup.+ (FIGS. 4E and 4F). We also tested the ability of GacB to catalyse the rhamnosylation of GlcNAc-α-1-P, but the reaction rendered no detectable product (data not shown), suggesting that the enzyme interacts not only with the GlcNAc-P, but might require the second phosphate and the lipid component to recognise the acceptor substrate.

    [0298] We further investigated GacB's specificity towards the sugar-nucleotide donor. In particular, we tested if GacB is selective for thymidine-based nucleotides and tolerates uridine-based nucleotides such as UDP-Glc, UDP-GlcNAc and UDP-Rha. As shown before, in the presence of TDP-β-L-Rha, two products consistent with the incorporation of rhamnose plus either two or three sodium cations were observed in the spectrum (FIG. 5A). In contrast, no product peaks were observed with UDP-α-D-Glc or UDP-α-D-GlcNAc as substrates (FIGS. 5B and C), while residual activity was detected for UDP-β-L-Rha (FIG. 5D). This data demonstrate that GacB does not tolerate α-D configured nucleotide sugars. Furthermore, GacB has specificity towards the deoxyribose (TDP-rhamnose) and/or requires binding of the thymine methyl group.

    [0299] Finally, we assessed metal ion dependency in vitro. Compared to the control reaction (FIG. 6B), we noticed no significant differences in the rhamnosylation activity of the enzyme when GacB was supplemented with MgCl.sub.2, MnCl.sub.2 or EDTA as a metal chelator (FIG. 6C, D, E), indicating that GacB does not require a divalent metal ion for its activity.

    [0300] Together, these data confirmed our previous conclusions drawn from the LLSs radiolabelled assay (FIG. 3). This is the first in vitro evidence revealing that GacB is a metal-independent rhamnosyltransferase that catalyses the initiation step in the GAC RhaPS backbone biosynthesis by transferring a single rhamnose to GlcNAc-PP-Und using TDP-β-L-Rha as the exclusive activated nucleotide sugar donor.

    [0301] Investigation of GacB's Catalytic Residues

    [0302] We were unable to obtain diffraction-quality crystals from the detergent-extracted protein, which would ultimately have revealed detailed insights into the catalytic region. We constructed a GacB structural model based on two enzymes that belong to the GT-4 family of GTs: Bacillus anthracis' BaBshA (PDB entry 3mbo) (72) and Corynebacterium glutamicum's MshA (PDB ID: 3c4v) (24). BaBshA shares 15% identity in 64 out of 424 amino acids. MshA is a ‘homologous’ GT that shares 16% identical residues in a sequence stretch of 71 residues out of 446. Based on the scarce information provided by the structural models and the multiple sequence alignment described in detail below, we mutated several residues that are highly conserved in over forty pathogenic streptococci species.

    [0303] Our in vitro E. coli system is the first one that enables the study of GacB mutant proteins, allowing the identification of those mutants that abrogate or reduce the production of RhaPS backbone. Conducting this in S. pyogenes is not possible since deletion of the gacB gene renders inviable cells (1, 20). We used the information available from the GT models mentioned above and the sequence alignment of multiple streptococci to select residues that might be involved in substrate binding, which tends to be conserved among GT. Through in-situ mutagenesis, we constructed nine recombinant versions of GacB containing the following amino acid substitutions: D126A, D126N, E222A, E222Q, D160A, D160N, Y182A, Y182F and K131R. The latter mutation was included as a negative control since it is a conserved predicted surface residue that presumably is not engaged in the catalytic activity or could inactivate the enzyme otherwise.

    [0304] We found that substitution of D160 with an asparagine led to a drastic reduction in the production of the RhaPS chain, while an alanine residue did not cause such significant effect. This suggests that the D160 carboxyl group might be required for catalysis, which potentially can be replaced in the alanine mutant by a water molecule. A more severe effect was observed with mutations of Y182. The alanine substitution of Y182 (Y182A) impeded the RhaPS backbone biosynthesis significantly, while Y182F completely inactivated GacB, suggesting an essential role for the Y182 hydroxyl group in GacB's enzymatic activity.

    [0305] We further investigated the mutants D160N and Y182F in an in vitro assay using recombinantly expressed and purified GacB-GFP-fusions. The MALDI-MS analysis of the reaction products from GacB-D160N-GFP and GacB-Y182F-GFP revealed that both mutants lacked an enzymatic activity in vitro (FIGS. 4G and H). These results support the hypothesis that the residues D160 and Y182 play a role in substrate binding or catalysis.

    [0306] Finally, we created three truncated versions of GacB at the N-terminal end as an attempt to determine whether the enzyme remains active in the absence of the residues predicted to be associated with the membrane. Our results showed that truncations of the first 22 (GacB.sub.23-385), 75 (GacB.sub.76-385) and 118 residues (GacB.sub.119-385) led to inactivation of the enzyme when assessed through the complementation assay. Their inability to complement ΔgacB suggest that the N-terminal domain is required for activity and supports the hypothesis that GacB is a membrane-associated rhamnosyltransferase.

    [0307] GacB is a Retaining β-1,4-Rhamnosyl-Transferase

    [0308] The current gene annotation suggests that GacB is an inverting α-1,2 rhamnosyltransferase (1, 8). This annotation is incompatible with the acceptor sugar GlcNAc since its carbon at position C2 is already decorated with the N-acetyl group. Therefore, GacB can only transfer the rhamnose onto the available hydroxyl groups on C3, C4 or C6. In addition, the GAC backbone is composed of repeating units of rhamnose connected via an α-1,3-1,2 linkage (9, 12) suggesting that GacB would be the only rhamnosyltransferase of this pathway using a retaining mechanism of action. According to the CAZy database, the GacB sequence is classified as a GT-4 family member, which are classified as retaining GTs (27). If that classification is correct for GacB, the stereochemical configuration at the anomeric centre of the sugar donor, TDP-β-L-rhamnose, should be retained in the final product.

    [0309] In order to elucidate whether GacB is an inverting or a retaining rhamnosyltransferase, we conducted nuclear magnetic resonance (NMR) spectroscopy on the purified reaction products 1 and 2. .sup.1H NMR spectra were collected at 800 MHz to both establish the structural integrity of acceptors 1 and 2 (FIG. 7A) and to determine the chemical structure of their products after the enzymatic reaction (Product 1 and 2). The NMR parameters were determined through one and two-dimensional (1D and 2D) and 2D total correlation spectroscopy (TOCSY) experiments (FIG. 7B); their chemical shifts are summarised in Table 2. For both acceptors, the anomeric proton of α-D-GlcNAc appeared as a doublet of doublets with 3J(H1,H2)=3.4 Hz, and 3J(H1,P)=7.2 Hz. Proton H2 of α-D-GlcNAc was also split by a 3J(H2,P)=2.4 Hz coupling with P. A 2D 1H, 31P HMQC spectrum (data not shown) revealed a correlation of both of these H-1′ protons with P at −13.5 ppm. Another correlation appeared between the 31P at −10.6 ppm and protons of the adjacent CH.sub.2 groups of the alkyl chain, confirming the integrity of the acceptor substrate. For acceptor 2 a typical pattern of signals of a monosubstituted benzene with integral intensities of 2:2:1 was observed.

    [0310] The addition of rhamnose to both acceptor substrates was accompanied by the appearance of a characteristic signal in the anomeric region of the spectrum (4.88 ppm, H1) next to the water signal. The anomeric configuration of this monosaccharide was established in several ways. The measured .sup.3J(H1,H2) coupling constant of 1.0 Hz indicated a β-L configuration (1.1 and 1.8 Hz reported) for β-L and α-L-Rha, respectively). A rotating-frame nuclear Overhauser effect (ROESY) spectrum (FIG. 4B) showed spatial proximity of H1 of rhamnose with four other protons. Among these were H2, H3 and H5 protons of rhamnose, the latter two confirming a 1,3 diaxial arrangement between H1, H3 and H5 that is indicative of a β-L Rha configuration. Finally, a comparison of .sup.1H chemical shifts of rhamnose with those of α-L and β-L-rhamnopyranose (FIG. 7C) showed a good agreement with those of β-L-rhamnose (75), thus confirming configuration of this ring. The forth ROESY cross peak of H1 of rhamnose was with H4 of GlcNAc, revealing the presence of a (1-4) linkage between the two monosaccharides. This observation was further supported by a comparison of GlcNAc 1H chemical shifts of acceptor substrates and products. Here, an increased chemical shift (+0.21 ppm) was observed for H4 upon glycosylation, while the average of the absolute values of the differences between the chemical shifts of the other corresponding protons of GlcNAc was 0.03 ppm. As expected, the signals of the alkyl and aryl sidechains practically did not change in the respective acceptor-product pairs.

    [0311] In conclusion, .sup.1H NMR spectroscopy revealed the formation of a R-L-Rha (1-4) D-GlcNAc moiety and the integrity of the product.

    [0312] Group a, B, C and G Streptococcus Share a Common RhaPS Initiation Step

    [0313] In addition to S. mutans SccB, GacB homologs with a high degree of sequence identity are found in other streptococcal species of clinical importance, such as the Streptococcus species from Group B (GBS), Group C (GCS) and Group G (GGS). All homologous enzymes are situated in the corresponding gene clusters encoding the biosynthesis of their Lancefield antigens, i.e., the Group B, C and G carbohydrate (15). The homologous gene products share 67%, 89% and 89% amino acid identity to GacB, respectively (Table 2, FIG. 8). With varying degrees of evidence depending on the species, there is a general understanding of the chemical structure of the RhaPS of these streptococci (9). The currently accepted structures for GAC, GBC, GCC, GGC and SCC are summarised in FIG. 8. Remarkably, none of the investigations that led to the understanding of the surface carbohydrate structures includes data describing the mechanism of action of the enzymes involved in the priming step of each RhaPS biosynthesis.

    [0314] Based on the high-sequence identity to GacB, we hypothesised that the carbohydrate biosynthesis of the Group A, Group B, Group C and Group G Streptococcus possess a conserved initiation step, in which the first rhamnose residue is transferred onto the lipid-linked acceptor forming Rha-β-1,4-GlcNAc-PP-Und. We tested the ability of the homologs from GBS, GCS and GGS (GbsB, GcsB and GgsB, respectively) to functionally substitute GacB in the production of the RhaPS chain (FIG. 9). Our results show that all homologous proteins were able to restore the RhaPS backbone when their genes were co-expressed with the ΔgacB expression plasmid, suggesting these enzymes can perform the same enzymatic reaction.

    [0315] We showed that GacB requires GlcNAc-PP-Und as acceptor, but it is possible that the enzymes from GBS, GCS and GGS use a different lipid-linked acceptor substrate, such as Glc-PP-Und. Thus, to determine whether the GacB homologs require GlcNAc-PP-Und as lipid acceptor, we conducted the complementation assay using E. coli ΔwecA cells, which lack GlcNAc-PP-Und (23). As a positive control we identified S. pneumoniae WchF, a Glc-1,4-β-rhamnosyltransferase that uses exclusively Glc-PP-Und as substrate (28). As expected, GacB was unable to restore the RhaPS chain when co-transformed with the ΔgacB vector in the absence of the GlcNAc-PP-Und (FIG. 9A, lane 2). The GacB homologs from GBS, GCS and GGS also failed to produce the RhaPS backbone (FIG. 9A, lane 4-6), but could replace GacB function in the ArfaS strain (FIG. 9B). Only WchF, which uses a Glc-PP-Und acceptor for the transfer of a rhamnose residue, restored the RhaPS biosynthesis in the absence of GlcNAc-PP-Und (FIG. 9A, lane 3). Combined with the data from our in vitro enzymatic reactions, these results suggest that the GacB homologues from GBS, GCS and GGS are also GlcNAc-1,4-β-rhamnosyltransferases that require GlcNAc-PP-Und as membrane-bound acceptor.

    [0316] Most Streptococcal Pathogens are Predicted to have a GlcNAc-1,4-β-Rhamnosyl-Transferase

    [0317] S. pneumoniae wchF encodes a Glc-β-1,4-rhamnosyltransferase that requires Glc-PP-Und as acceptor (28). It shares 51% amino acid identity to GacB, compared to 67-89% for the homologous enzymes from GBS, GCS, GGS and S. mutans. Towards a better understanding of the conservation of GacB in the Streptococcus genus, we extended our bioinformatics analysis to search for other strains that harbour GacB homologous genes. We found 48 human/veterinary pathogenic Streptococcus species with a single GacB homolog, sharing 50 to 94% sequence identity (Table 2, FIG. 10). Five of our 48 identified species showed a percentage identity equal or lower than 51% (S. mitis, S. pneumoniae, S. oralis subsp. tigurinus, S. peroris and S. pseudopneumoniae), while all other encoded proteins presented more than 65% homology to GacB. For simplicity, we will refer to the five Streptococcus strains with low amino acid identity as ‘low identity’ subgroup, and the rest of the species as the ‘high identity’ subgroup.

    [0318] The sequence analysis paired with the complementation assay led us to hypothesise that all GacB homologs encompassed in the ‘high identity’ subgroup possess GlcNAc-β-1,4-rhamnosyltransferase activity. In contrast, the ‘low identity’ subgroup contains S. pneumoniae WchF, a known Glc-1,4-β-rhamnosyltransferase (28). All five members of the ‘low identity subgroup’ exhibit very high sequence identity (>90%) when compared to WchF.

    [0319] GacO from S. pyogenes, the WecA homolog, was shown to be responsible for the biosynthesis of the GlcNAc-PP-Und (8,9), the substrate for GacB. We therefore hypothesised that the ‘low’ and ‘high identity’ subgroups utilise different substrates, and therefore investigated whether an equivalent discrepancy should be observed when comparing the sequence identity of the GacO homologs. Within the 48 pathogenic streptococci genomes (Table 2, FIG. 10), we found that all strains from the ‘high identity’ subgroup share a gacO homologue with 63-92% sequence identity. Importantly, any genome from the ‘low identity’ subgroup contains a gene product with equal or less than 30% sequence identity to GacO. This subgroup present gene products that have high homology to S. pneumoniae Cps2E, which transfers Glc-1-P to P-Und, to generate Glc-PP-Und (28). S. mitis, S. oralis subsp. tigurinus, S. peroris and S. pseudopneumoniae homologues share 98% sequence identity to Cps2E.

    [0320] The degree of phylogenetic conservation of GacB in the Streptococcus genus highlights the importance of this gene, for survival and pathogenesis of streptococcal pathogens. Overall, these results lead us to propose that those streptococcal species that have GacB homologs with a high degree of identity (>65%) are GlcNAc-β-1,4-rhamnosyltransferases that catalyse the first committed step in the biosynthesis of their surface RhaPS by transferring rhamnose from TDP-β-L-rhamnose to the membrane-bound GlcNAc-PP-Und. In contrast, we postulate that the species within the ‘low identity’ subgroup, in accordance with the function of S. pneumoniae serotype 2 WchF, contains a rhamnosyltransferase that acts on lipid-linked Glc-PP-Und.

    TABLE-US-00003 TABLE 2 Sequence conservation in % for GacB and GacO homologous enzymes from 48 species of the Streptococcus genus. % Identity Species GacB N-terminus C-Terminus GacO S. pyogenes 100 100 100 100 S. canis 94 94 92 92 S. dysgalactiae subsp. 89 92 86 90 equisimilis S. phocae 79 83 75 85 S. equi subsp. zooepidermicus 77 78 75 86 S. equi subsp. equi 76 74 73 86 S. ictaluri 75 79 72 80 S. bovimastitidis 73 77 69 80 S. iniae 73 74 72 81 S. hongkongensis 72 77 68 80 S. panaeicida 72 78 68 81 S. uberis 72 76 67 81 S. porcinus 71 75 68 80 S. henryi 70 70 70 75 S. orisasini 70 70 69 75 S. orisratti 70 70 69 73 S. parasanguinis 69 71 66 65 S. ratti 69 70 53 76 S. vestibularis 69 68 68 70 S. australis 68 71 66 63 S. equinus 68 71 65 78 S. porci 68 69 67 71 S. sanguinis 68 71 65 67 S. sinensis 68 69 66 66 S. sobrinus 68 69 64 72 S. thoraltensis 68 70 66 71 S. anginosus 67 69 65 66 S. caballi 67 66 67 74 S. downei 67 70 65 72 S. gordonii 67 68 66 63 S. intermedius 67 70 64 67 S. constellatus 66 69 64 66 S. gallolyticus 66 68 66 78 S. hyovaginalis 66 69 64 71 S. mutans 66 51 61 75 S. salivarius 66 59 63 71 S. urinalis 66 69 64 74 S. agalactiae 65 66 64 73 S. entericus 65 63 67 66 S. infantarius 65 68 62 78 S. plurextorum 65 69 62 68 S. suis 65 67 62 68 S. lutetiensis 64 68 61 78 S. oralis subsp. tigurimus 51 46 52 28 S. mitis 50 45 51 29 S. peroris 50 46 50 28 S. pneumoniae 50 45 51 30 S. pseudopneumoniae 50 44 68 29

    [0321] GacB's N-Terminal Domain Encodes Specificity for the GlcNAc Acceptor

    [0322] We performed a multiple sequence alignment of the GacB homologs from all 48 streptococcal pathogens to identify the most variable and conserved regions in the protein sequence. We observed a higher discrepancy between the ‘high identity’ and the ‘low identity’ subgroups in their N-terminal domains (Table 2). More precisely, a low sequence conservation region is identifiable between the GacB amino acid residues 40 and 80, suggesting that this section of the domain is either involved in the GlcNAc acceptor sugar recognition or in essential protein-protein interactions.

    [0323] We knew from our previous experiment that GacB cannot initiate the RhaPS biosynthesis on a wecA deletion background (FIG. 9A, lane 2). Based on this information and in order to identify residues involved in sugar acceptor recognition, we introduced mutations in the GacB amino acid sequence. The goal was to salvage the RhaPS initiation step in a wecA-deficient E. coli strain in which GacB mutants recognise a lipid-linked sugar acceptor other that GlcNAc-PP-Und.

    [0324] Therefore, we investigated a structural model based on the GacB homolog from Bacillus anthracis, BaBshA (PDB entry 3mbo), which suggested that residues L128, R131, GNT100 may potentially be involved in sugar acceptor recognition. We mutated these residues to mimic those found in WchF. Complementation assays using GacB L128H_R131L, failed to complement ΔgacB in a ΔwecA background (FIG. 11, lane 2). Following a sequential approach, we modified the GacB primary sequence by introducing additional amino acid substitutions that corresponded to those found in WchF: L128H_R131L_GNT100ARC and L128H_R131L_GNT100ARC_A105P. None of these mutants recognised glucose to initiate the rhamnose chain, and thus, did not restore GacB's activity. Finally, we replaced the first 178 residues of GacB with the corresponding WchF amino acids (1-186). When expressed in a wecA deletion background, this WchF-GacB chimera was able to synthesise the RhaPS backbone on the exclusive acceptor substrate Glc-PP-Und (FIG. 11, lane 5).

    [0325] Discussion

    [0326] This work sheds light on the first committed step of the GAC biosynthesis and provides insight into the function of GacB, the first metal-independent, retaining and non-processive α-D-GlcNAc β-1,4-L-rhamnosyltransferase reported. This insight is depicted schematically in FIG. 12, which shows the elucidated structure of GAC as well as the endogenous S. mutans enzymes involved in the synthesis of each section. Other enzymes from Gram-negative and Gram-positive bacteria that are involved in polysaccharide biosynthesis use lipid-linked GlcNAc as acceptor and either dTDP-L- or GDP-D-rhamnose sugar nucleotides, however, their reaction results in an α-1,3 or α-1,4 glycosidic bond (29-31). Also, the fact that the GAC backbone is composed of repeating units of rhamnose connected via an α-1,3-1,2 linkage (9, 13) suggest that GacB is the only rhamnosyltransferase of this pathway using a retaining mechanism of action.

    [0327] We have also shown that streptococcal RhaPS can be synthesized in a recombinant expression system, namely E. coli, onto a different acceptor, Und-PP-Glu using the enzyme WchF. This is depicted schematically in FIG. 13. Specifically, FIG. 13 demonstrates how the enzyme WchF can be used to transfer a rhamnose moiety to a glucose monosaccharide to form a disaccharide, the disaccharide having the glucose at the reducing end and the rhamnose moiety at the non-reducing end. The enzyme WchF facilitates the formation of a β-1,4 glycosidic bond between the two monosaccharides. A rhamnose polysaccharide is then generated by extended from the rhamnose moiety at the non-reducing end of the disaccharide using the bacterial enzyme GacC or its enzymatically active homologue GbcC. WchF is derived from S. pneumoniae, this is heterologous to the bacteria (S. mutans and S. agalactiae) from which GacC or GbcC are derived. In this particular embodiment, the method was carried out in E. coli, which is also a different species to the bacteria from which WchF, GacC and GbcC are derived.

    [0328] This results in the formation of a synthetic streptococcal polysaccharide having a non-reducing end comprising a linear chain of rhamnose moieties and a reducing end comprising a glucose monosaccharide, the polysaccharide comprising a β-1,4 bond between the glucose and the linear chain of rhamnose moieties. As the skilled person will appreciate, this differs from the naturally occurring GAC (which is shown in FIG. 12) due to the monosaccharide at the reducing end being glucose rather than GlcNAc.

    EXAMPLE 2

    [0329] To further illustrate the invention, this Example is directed to further exemplary methods of synthesis and the rhamnose polysaccharide of the invention.

    [0330] FIG. 14 is another exemplary embodiment of the invention. FIG. 14 shows how the enzyme WbbL, which is derived from E. coli, can be used to transfer a rhamose moiety to a GlcNAc monosaccharide. This forms a disaccharide having the GlcNAc at its reducing end and the rhamnose moiety at the non-reducing end with an α-1,3 glycosidic bond between the rhamnose moiety and the GlcNAc. The rhamnose polysaccharide is then generated by extension from the rhamnose moiety at the reducing end of the disaccharide using the bacterial enzyme GacC or its enzymatically active homologue GbcC. Since WbbL is derived from E. coli, it is derived from a bacterial species heterologous to the bacterial species from which GacC and GbcC are derived.

    [0331] In this particular example, the method is performed in E. coli, although other bacteria can be envisaged for this purpose. Thus, in this particular embodiment, WbbL can be endogenous to the E. coli or it can be overexpressed in the E. coli.

    [0332] This method, as FIG. 14 shows, results in the generation of a synthetic streptococcal polysaccharide having a non-reducing end comprising a linear chain of rhamnose moieties and a reducing end comprising a GlcNAc monosaccharide, the polysaccharide comprising a α-1,3 bond between the GlcNAc and the linear chain of rhamnose moieties. This differs from the endogenous GAC (as shown in FIG. 12), as GAC contains a β-1,4 bond between the GlcNAc and the linear chain of rhamnoses. Any other enzyme which is a hexose-α-1,3-rhamnosyltransferase could be used instead of WbbL, as shown schematically in FIG. 15. FIG. 15 differs from FIG. 14 in that the monosaccharide is a glucose rather than a GlcNAc. Thus, the product of FIG. 14 is a synthetic Streptococcal polysaccharide having a non-reducing end comprising a linear chain of rhamnose moieties and a reducing end comprising a glucose monosaccharide, the polysaccharide comprising a α-1,3 bond between the glucose and the linear chain of rhamnose moieties. This differs from the endogenous GAC (shown in FIG. 12) with the inclusion of the glucose and the α-1,3 bond.

    [0333] Other methods of synthesis are within the scope of the present invention. FIG. 16 shows such an exemplary method. In this method, a diNAcBac-α-1,3-rhamnosyltransferase is used to transfer a rhamnose moiety to a diNAcBac monosaccharide. Thus, a disaccharide is formed having the diNAcBac at its reducing end and the rhamnose moiety at the non-reducing end. The two monosaccharides are linked with an α-1,3 glycosidic bond. The rhamnose polysaccharide is then generated by extended from the rhamnose moiety at the non-reducing end of the disaccharide using the bacterial enzyme GacC or its enzymatically active homologue GbcC. The diNAcBac-α-1,3-rhamnosyltransferase is derived from a bacterial species different to the bacterial species from which GacC or its enzymatically active homologue GbcC is derived.

    [0334] The method of FIG. 16 leads to the generation of a synthetic streptococcal polysaccharide having a non-reducing end comprising a linear chain of rhamnose moieties and a reducing end comprising diNAcBac monosaccharide, the polysaccharide comprising a α-1,3 bond between the diNAcBac and the linear chain of rhamnose moieties. This differs from the endogenous GAC (as shown in FIG. 12), as GAC contains a β-1,4 bond between a GlcNAc and the linear chain of rhamnoses.

    [0335] FIG. 17 demonstrates another exemplary method and product. In this method, a disaccharide, trisaccharide or tetrasaccharide can be formed before extending from the rhamnose moiety. For the disaccharide, the galactose-α-1,2-rhamnosyltransferase WbbR is used to transfer a rhamnose moiety to a galactose monosaccharide. This forms a disaccharide having the galactose at its reducing end and the rhamnose moiety at its non-reducing end. The rhamnose polysaccharide is then generated by extending from this rhamnose moiety to form a linear chain of rhamnose moieties. In this example, extension is using the enzymes GacC, GacG or GbcC (see penultimate schematic of FIG. 17 and top schematic). WbbR is derived from Shigella, which is a different bacterial species to the Streptococcus from which GacC, GacG or GbcC are each derived. This method leads to the production of a synthetic streptococcal polysaccharide having a non-reducing end comprising a linear chain of rhamnose moieties and a reducing end comprising a galactose monosaccharide, the polysaccharide comprising a α-1,2 bond between the diNAcBac and the linear chain of rhamnose moieties.

    [0336] An alternative embodiment, as also depicted by the top and penultimate schematics of FIG. 17, is the formation of a trisaccharide before extending from the rhamnose moiety. For the trisaccharide, the enzyme WbbP is used to transfer a galactose monosaccharide to a GlcNAc, thus forming an α-1,3 glycosidic bond between the two monosaccharides. The enzyme WbbR is then used as described above for the disaccharide such that a rhamnose moiety is transferred to the galactose. After this extension can occur as detailed for the disaccharide above.

    [0337] To the left of FIG. 17 is a spot blot (positive antibody blot). Each blot represents a sample from one experiment; each row represents a triplicate of the same conditions. For each experiment, the sample from the reaction was added as a spot, and an anti-GAC antibody used to determine if the reaction was successful in the formation of the rhamnose polysaccharide. The middle row shows triplicates of samples obtained from reactions where the enzyme WbbP is used to transfer a galactose monosaccharide to a GlcNAc, followed by the enzyme WbbR then GacG. The dot plot to the left confirms that this reaction is capable of producing the rhamnose polysaccharide of the invention.

    [0338] WbbP can alternatively be used to form a disaccharide (i.e., a galactose monosaccharide at its non-reducing end linked by an α-1,3 glycosidic bond to a GlcNAc at its reducing end, following which the rhamnose polysaccharide is generated by extended from the rhamnose moiety at the non-reducing end of the disaccharide (see bottom schematic of FIG. 17). The dot plot row to the left of this schematic confirms that this reaction is also capable of producing the rhamnose polysaccharide of the invention.

    [0339] Optionally, one or two additional rhamnose moieties can be transferred to the rhamnose moiety linked to the galactose to form a tetra or pentasaccharide, prior to the step of extension as detailed above. The one or two additional rhamnose moieties can be transferred using the enzyme WbbQ, followed by further extension using GacC using GbcC, as shown in the third schematic of FIG. 17. The dot plot row to the left of this Figure confirms that a reaction containing WbbP, WbbR, WbbQ and GacC was successful in generating a rhamnose polysaccharide according to the present invention.

    [0340] For the tri, tetra or pentasaccharide methods, these methods result in the generation of a synthetic Streptococcal polysaccharide having a reducing end comprising a linear chain of rhamnose moieties and a non-reducing end comprising a GlcNac and a galactose, the polysaccharide comprising a α-1,2 bond between the linear chain of rhamnose moieties and the galactose and a α-1,3 bond between the galactose and the GlcNAc.

    [0341] In embodiments wherein a rhamnose moiety is transferred to a disaccharide or trisaccharide, it is envisaged that any combination of hexoses may be used to form the di or trisaccharide using alpha or beta bonds as described herein. This is depicted in FIG. 18. Likewise, for the extension of the rhamnose polysaccharide from the rhamnose moiety, it is envisaged that any enzymatically active homologue of GacC, GacG, or a fragment or variant thereof, could be used, provided that α-1,2 and/or α-1,3 glycosidic bonds are formed between each pair of rhamnose moieties.

    [0342] FIG. 19 confirms that WbbL can be used instead of GacB or SccB in a method of the invention to produce the rhamnose polysaccharide. The figure shows an anti-GAC Western blot of total E. coli lysate from cells expressing the gene cluster RmlD-SccC-SccD-SccE-SccF-SccG (deltaSccB) and GacA-GacC-GacD-GacE-GacF-GacG (deltaGacB) complemented with empty plasmid controls or WbbL. The first column is a ladder. The second column confirms that GAC was not produced in E. coli cells having a RgpA deletion, while the third column confirms that the expression of WbbL alone in RgpA deficient cells did not restore GAC synthesis. The third column shows the lysate from E. coli cells having a RgpA deletion but also expressing the gene cluster GacA-GacC-GacD-GacE-GacF-GacG (deltaGacB). No GAC was found in these cells. However, the fourth column shows that when WbbL is expressed in the cells of the third column, GAC is produced. The same result is observed when rgpA deficient cells express the gene cluster RmlD-SccC-SccD-SccE-SccF-SccG (deltaSccB) together with WbbL (see duplicates of last two columns). This data confirms that WbbL can be used with heterologous enzymes from other species to produce a rhamnose polysaccharide according to the present invention.

    [0343] FIG. 20 confirms that GacC introduces up to five Rhamnose sugars onto the product generated from GacB. FIG. 20 shows radiolabelling of lipid-linked oligosaccharides (LLOS) in vivo (E. coli). Film exposure of a TLC plate with radiolabelled LLOS from E. coli CS2775 bearing gacB (lane 1) or gacBC (lane 2).

    [0344] Homologues to GacC can function in a similar manner. FIG. 21 shows results similar to that shown in FIG. 20, but using GbcC, GccC and GgcC, from homologous enzymes from Group B, C and G Streptococci. FIG. 21 shows a film exposure of a TLC plate with radiolabelled LLOS from E. coli CS2775 bearing gacB and gacC (lane 1), gacB alone (lane 2), gacB and gbcC (lane 3), gacB and gccC (lane 4), gacB and ggcC (lane 5). GacC, GbcC, GccC, GgcC are homologous enzymes from Group A, B, C and G Streptococci and the figure shows that all transfer 3-5 rhamnose sugars onto the product of GacB.

    [0345] Similarly, the inventor has shown that the GacC enzyme function is conserved amongst Streptococci and is able to complement SccC enzyme of E. coli. FIG. 22 shows: [0346] A) Gene complementation strategy. sccC gene replaced with homologous genes gacC, gbcC, gccC, ggcC. [0347] B) Immunoblots of whole-cell lysates for the bacterial complementation assay probed with anti-Group A antibody.

    [0348] Complementation study confirms that GacC enzyme function is conserved amongst Streptococci from Group B, C, G and S. mutans.

    [0349] Phylogenetic analysis of GacO, GacB and GacC enzymes show the high degree of similarity and hence function is conserved in Streptococci-Pathogenic strains are all expected to produce RhaPS with identical adapter/stem and as such, all are suitable for use in accordance with the present invention.

    [0350] FIG. 23 shows A) Phylogenetic tree based on GacB ortholog protein sequences identified from forty-eight pathogenic streptococci. An asterisk after the species name indicates that the ortholog sequence was not retrieved from a whole sequenced genome. Sequences were aligned using the default neighbour-joining clustering method of ClustalOmega and then plotted using iTOL online tool. B) The bar charts indicate the degree of homology in percentage to S. pyogenes GacO (red), GacB (blue) or GacC (green). The figures next to GacO, GacB and GacC labels represent the step catalysed by S. pyogenes. The figures in the indentation at the centre of the figure is based on our current knowledge of the role of S. pneumoniae Cps2E, Cps2T (WchF) and Cps2F (James 2013).

    [0351] FIG. 24 shows that GacC rhamnosylates synthetic LLO substrate (GacB product) in vitro. A) HPLC analysis showing that GacC extends a chemoenzymatic lipid-linked disaccharide generated using GacB with 3 additional rhamnose residues. The chemical linkage was subsequently analysed by NMR. B) Chemical drawing of GacB/C reactions with in vitro acceptor substrate

    [0352] Further studies, not all data shown, by the inventors using NMR and mass spectrometry techniques confirm that GacC can add up to 4 rhamnose sugars and that GacC is an inverting alpha-1,3 rhamnosyltransferase. FIG. 25 shows full assignment of protons and carbon sugar signals. .sup.1H assignments were based on the analysis of several F1-band-selective 2D TOCSY spectra. .sup.3C signals were assigned using 2D .sup.1H, .sup.13C HSQC. Linkages were assigned using a 2D NOESY experiment. Chemical shifts for each of the sugar residues agrees well with published data for 1H and 13C signals for glycopyranoses.

    [0353] The inventor has further shown that the rhamnose polysaccharide in accordance with the present invention may be generated using different enzyme combinations. FIG. 26 shows that the rhamnose polysaccharide according to the present invention may be generated using enzymes from Shigella dysenteriae in combination with E. coli and Shigella dysenteriae in combination with Streptococcus mutans. FIG. 26 shows a whole cell Western blot using anti-Group A Carbohydrate antibody. Total E. coli cell lysates were separated over SDS-PAGE. NewRhaPS are build by Shigella dysenteriae gene products combined with S. mutans/Group A Streptococcus gene products. RmlD_GacD_E_F_G plus WbbP_Q_R are sufficient to build NewRhaPS. NewRhaPS can also be build with RmlD_SccC_D_E_F_G plus WbbP_Q_R.

    [0354] Based on the above evidence, it is expected that Shigella spp. can be further used in order to provide the adaptor/stem and GAC repeat units, as shown schematically in FIG. 27. In a native system, GacB and GacC enzymes install the adaptor/stem region (red box) before GacG installs the immunogenic repeat unit. The figure shows as an example 3 alpha1,3-rhamnose sugars installed by GacC.

    [0355] Replacement of the GacB/C enzymes (replacement of the GlcNAc-beta1,4-rhamnose-alpha1,3-rhamnose adaptor/stem) to generate NewRhaPS, provides an alternative to maintain the immunogenic repeat unit (proposed to be introduced by GacG enzyme activity). Replacing the adaptor region (green box) with a O-Otase compatible polysaccharide/oligosaccharide is sufficient to build the immunogenic polysaccharide (alpha1,2-alpha1,3 rhamnose).

    [0356] As described herein, the rhamnose polysaccharides of the present invention may be conjugated with a suitable protein and presented on the surface of a bacterium. FIG. 28 shows that rhamnose polysaccharides prepared in accordance with the present invention are suitable substrates for use in an E. coli glycoconjugation system. A periplasmic expressin test system was set up in accordance with the procedure described by Reglinski et al., npj Vaccines (2108)3:53..sub.[HD(1]FIG. 28 shows that NewRhaPS are compatible substrate for O-Otase (PglB)/for Protein Glycan Coupling Technology (PGCT) Periplasmic expression of test protein NanA (in accordance with Reglinski)+/− active/inactive NewRhaPS system (1-8).

    [0357] Lanes 5 and 7 show that two different expression conditions for NewRhaPS system are positive for NanA-NewRhaPS glycosylation.

    [0358] Lane 9: GAC chemically extracted from S. pyogenes (positive control for GAC antibody).

    [0359] This description should not be construed as limiting and it will be appreciated that other variants and embodiments thereof fall within the scope of the present invention.

    REFERENCES

    [0360] 1. van Sorge, N. M., Cole, J. N., Kuipers, K., Henningham, A., Aziz, R. K., Kasirer-Friede, A., Lin, L., Berends, E. T. M., Davies, M. R., Dougan, G., Zhang, F., Dahesh, S., Shaw, L., Gin, J., Cunningham, M., Merriman, J. A., HQtter, J., Lepenies, B., Rooijakkers, S. H. M., Malley, R., Walker, M. J., Shattil, S. J., Schlievert, P. M., Choudhury, B., and Nizet, V. (2014) The Classical Lancefield Antigen of Group A Streptococcus Is a Virulence Determinant with Implications for Vaccine Design. Cell Host Microbe. 15, 729-740 [0361] 2. Kristian, S. A., Datta, V., Weidenmaier, C., Kansal, R., Fedtke, I., Peschel, A., Gallo, R. L., and Nizet, V. (2005) D-alanylation of teichoic acids promotes group a streptococcus antimicrobial peptide resistance, neutrophil survival, and epithelial cell invasion. J. Bacteriol. 187, 6719-6725 [0362] 3. Henningham, A., Davies, M. R., Uchiyama, S., Sorge, N. M. van, Lund, S., Chen, K. T., Walker, M. J., Cole, J. N., and Nizet, V. (2018) Virulence Role of the GlcNAc Side Chain of the Lancefield Cell Wall Carbohydrate Antigen in Non-M1-Serotype Group A Streptococcus. mBio. 9, e02294-17 [0363] 4. Le Breton, Y., Belew, A. T., Freiberg, J. A., Sundar, G. S., Islam, E., Lieberman, J., Shirtliff, M. E., Tettelin, H., El-Sayed, N. M., and McIver, K. S. (2017) Genome-wide discovery of novel M1T1 group A streptococcal determinants important for fitness and virulence during soft-tissue infection. PLoS Pathog. 13, e1006584 [0364] 5. Shelburne, S. A., Keith, D., Horstmann, N., Sumby, P., Davenport, M. T., Graviss, E. A., Brennan, R. G., and Musser, J. M. (2008) A direct link between carbohydrate utilization and virulence in the major human pathogen group A Streptococcus. Proc. Natl. Acad. Sci. U.S.A. 105, 1698-1703 [0365] 6. Lancefield, R. C. (1933) A Serological Differentiation of Human and Other Groups of Hemolytic Streptococci. J. Exp. Med. 57, 571-595 [0366] 7. McCarty, M. (1958) Further studies on the chemical basis for serological specificity of group a streptococcal carbohydrate. J. Exp. Med. 108, 311-323 [0367] 8. Rush, J. S., Edgar, R. J., Deng, P., Chen, J., Zhu, H., van Sorge, N. M., Morris, A. J., Korotkov, K. V., and Korotkova, N. (2017) The molecular mechanism of N-acetylglucosamine side-chain attachment to the Lancefield group A carbohydrate in Streptococcus pyogenes. J. Biol. Chem. 292, 19441-19457 [0368] 9. Mistou, M.-Y., Sutcliffe, I. C., and Sorge, N. M. van (2016) Bacterial glycobiology: rhamnose-containing cell wall polysaccharides in Gram-positive bacteria. FEMS Microbiol. Rev. 40, 464-479 [0369] 10. Coligan, J. E., Kindt, T. J., and Krause, R. M. (1978) Structure of the streptococcal groups A, A-variant and C carbohydrates. Immunochemistry. 15, 755-760 [0370] 11. Krause, R. M., and McCarty, M. (1961) Studies on the Chemical Structure of the Streptococcal Cell Wall. J. Exp. Med. 114, 127-140 [0371] 12. Edgar, R. J., Hensbergen, V. P. van, Ruda, A., Turner, A. G., Deng, P., Breton, Y. L., El-Sayed, N. M., Belew, A. T., McIver, K. S., McEwan, A. G., Morris, A. J., Lambeau, G., Walker, M. J., Rush, J. S., Korotkov, K. V., Widmalm, G., Sorge, N. M. van, and Korotkova, N. (2019) Discovery of glycerol phosphate modification on streptococcal rhamnose polysaccharides. Nat. Chem. Biol. 15, 463 [0372] 13. H. Heymann, Zeleznick, L. D., Boltralik, J. J., Barkulis, S. S., and Smith, C. (1963) Biosynthesis of Streptococcal Cell Walls: A Rhamnose Polysaccharide. Science. 140, 400-401 [0373] 14. Heymann, H., Manniello, J. M., and Barkulis, S. S. (1967) Structure of streptococcal cell walls. V. Phosphate esters in the walls of group A Streptococcus pyogenes. Biochem. Biophys. Res. Commun. 26, 486-491 [0374] 15. van Hensbergen, V. P., Movert, E., de Maat, V., Luchtenborg, C., Le Breton, Y., Lambeau, G., Payre, C., Henningham, A., Nizet, V., van Strijp, J. A. G., BrQgger, B., Carlsson, F., McIver, K. S., and van Sorge, N. M. (2018) Streptococcal Lancefield polysaccharides are critical cell wall determinants for human Group IIA secreted phospholipase A2 to exert its bactericidal effects. PLoS Pathog. 14, e1007348 [0375] 16. Sewell, E. W. C., and Brown, E. D. (2014) Taking aim at wall teichoic acid synthesis: new biology and new leads for antibiotics. J. Antibiot. (Tokyo). 67, 43-51 [0376] 17. Huang, D. H., Rama Krishna, N., and Pritchard, D. G. (1986) Characterization of the group A streptococcal polysaccharide by two-dimensional 1H-nuclear-magnetic-resonance spectroscopy. Carbohydr. Res. 155, 193-199 [0377] 18. van der Beek, S. L., Le Breton, Y., Ferenbach, A. T., Chapman, R. N., van Aalten, D. M. F., Navratilova, I., Boons, G.-J., McIver, K. S., van Sorge, N. M., and Dorfmueller, H. C. (2015) GacA is essential for Group A Streptococcus and defines a new class of monomeric dTDP-4-dehydrorhamnose reductases (RmlD). Mol. Microbiol. 98, 946-962 [0378] 19. Le Breton, Y., Belew, A. T., Valdes, K. M., Islam, E., Curry, P., Tettelin, H., Shirtliff, M. E., El-Sayed, N. M., and McIver, K. S. (2015) Essential Genes in the Core Genome of the Human Pathogen Streptococcus pyogenes. Sci. Rep. 5, 9838 [0379] 20. Shibata, Y., Yamashita, Y., Ozaki, K., Nakano, Y., and Koga, T. (2002) Expression and characterization of streptococcal rgp genes required for rhamnan synthesis in Escherichia coli. Infect. Immun. 70, 2891-2898 [0380] 21. Bruyere, T., Wachsmann, D., Klein, J. P., Schöller, M., and Frank, R. M. (1987) Local response in rat to liposome-associated Streptococcus mutans polysaccharide-protein conjugate. Vaccine. 5, 39-42 [0381] 22. Cartee, R. T., Forsee, W. T., Bender, M. H., Ambrose, K. D., and Yother, J. (2005) CpsE from type 2 Streptococcus pneumoniae catalyzes the reversible addition of glucose-1-phosphate to a polyprenyl phosphate acceptor, initiating type 2 capsule repeat unit formation. J. Bacteriol. 187, 7425-7433 [0382] 23. Ozaki, K., Shibata, Y., Yamashita, Y., Nakano, Y., Tsuda, H., and Koga, T. (2002) A novel mechanism for glucose side-chain formation in rhamnose-glucose polysaccharide synthesis. FEBS Lett. 532, 159-163 [0383] 24. Vetting, M. W., Frantom, P. A., and Blanchard, J. S. (2008) Structural and enzymatic analysis of MshA from Corynebacterium glutamicum: substrate-assisted catalysis. J. Biol. Chem. 283, 15834-15844 [0384] 25. Jurtshuk, P. (1996) Bacterial Metabolism. in Medical Microbiology, 4th Ed. (Baron, S. ed), University of Texas Medical Branch at Galveston, Galveston (Tex.) [0385] 26. Parsonage, D., Newton, G. L., Holder, R. C., Wallace, B. D., Paige, C., Hamilton, C. J., Dos Santos, P. C., Redinbo, M. R., Reid, S. D., and Claiborne, A. (2010) Characterization of the N-acetyl-α-D-glucosaminyl I-malate synthase and deacetylase functions for bacillithiol biosynthesis in Bacillus anthracis. Biochemistry (Mosc.). 49, 8398-8414 [0386] 27. Lombard, V., Golaconda Ramulu, H., Drula, E., Coutinho, P. M., and Henrissat, B. (2014) The carbohydrate-active enzymes database (CAZy) in 2013. Nucleic Acids Res. 42, D490-495 [0387] 28. James, D. B. A., and Yother, J. (2012) Genetic and Biochemical Characterizations of Enzymes Involved in Streptococcus pneumoniae Serotype 2 Capsule Synthesis Demonstrate that Cps2T (WchF) Catalyzes the Committed Step by Addition of β1-4 Rhamnose, the Second Sugar Residue in the Repeat Unit. J. Bacteriol. 194, 6479-6489 [0388] 29. Schägger, H. (2006) Tricine-SDS-PAGE. Nat. Protoc. 1, 16-22 [0389] 30. Waldo, G. S., Standish, B. M., Berendzen, J., and Terwilliger, T. C. (1999) Rapid protein-folding assay using green fluorescent protein. Nat. Biotechnol. 17, 691-695 [0390] 31. Druzhinina, T. N., Danilov, L. L., Torgov, V. I., Utkina, N. S., Balagurova, N. M., Veselovsky, V. V., and Chizhov, A. O. (2010) 11-Phenoxyundecyl phosphate as a 2-acetamido-2-deoxy-α-d-glucopyranosyl phosphate acceptor in O-antigen repeating unit assembly of Salmonella arizonae O:59. Carbohydr. Res. 345, 2636-2640 [0391] 32. Robinson, P. T., Pham, T. N., and Uhrin, D. (2004) In phase selective excitation of overlapping multiplets by gradient-enhanced chemical shift selective filters. J. Magn. Reson. San Diego Calif. 1997. 170, 97-103 [0392] 33. Rucker, F. J., and Osorio, D. (2008) The effects of longitudinal chromatic aberration and a shift in the peak of the middle-wavelength sensitive cone fundamental on cone contrast. Vision Res. 48, 1929-1939

    TABLE-US-00004 SEQUENCES GacC SEQ ID NO: 1 MNINILLSTYNGERFLAEQIQSIQRQTVNDWTLLIRDDGSTDGTQDIIRTFVKEDKRIQW INEGQTENLGVIKNFYTLLKHQKADVYFFSDQDDIWLDNKLEVTLLEAQKHEMTAPLLVYTD LKVVTQHLAVCHDSMIKTQSGHANTSLLQELTENTVTGGTMMITHALAEEWTTCDGLLMHD WYLALLASAIGKLVYLDIPTELYRQHDANVLGARTWSKRMKNWLTPHHLVNKYWWLITSSQ KQAQLLLDLPLKPNDHELVTAYVSLLDMPFTKRLATLKRYGFRKNRIFHTFIFRSLVVTLFGY RRK GacG SEQ ID NO: 2 MNRILLYVHFNKYNKISAHVYYQLEQMRSLFSKIVFISNSKVSHEDLKRLKNHCLIDEFL QRKNKGFDFSAWHDGLIIMGFDKLEEFDSLTIMNDTCFGPIWEMAPYFENFEEKETVDFWG ITNNRGTKAFKEHVQSYFMTFKNQVIQNKVFQQFWQSIIEYENVQEVIQHYETQLTSILLNEG FSYQTVFDTRKAESSFMPHPDFSYYNPTAILKHHVPFIKVKAIDANQHIAPYLLNLIRETTNYP IDLIVSHMSQISLPDTKYLLSQKYLNCQRLAKQTCQKVAVHLHVFYVDLLDEFLTAFENWNF HYDLFITTDSDIKRKEIKEILQRKGKTADIRVTGNRGRDIYPMLLLKDKLSQYDYIGHFHTKKS KEADFWAGESWRKELIDMLVKPADSILSAFETDDIGIIIADIPSFFRFNKIVNAWNEHLIAQEM MSLWRKMDVKKQIDFQAMDTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLPQNSILH AIERLLVYIAWGDSYDFRIVKNPYELTPFIDNKLLNLREDEGAHTYVNFNQMGGIKGALKYIIV GPAKAMKYIFLRLMEKLK RfbG SEQ ID NO: 3 MHSSDQKRVAVLMATYNGECWIEEQLKSIIEQKDVDISIFISDDLSTDNTLNICEEFQLS YPSIINILPSVNKFGGAGKNFYRLIKDVDLENYDYICFSDQDDIWYKDKIKNAIDCLVFN NANCYSSNVIAYYPSGRKNLVDKAQSQTQFDYFFEAAGPGCTYVIKKETLIEFKKFIINNKNA AQDICLHDWFLYSFARTRNYSWYIDRKPTMLYRQHENNQVGANISFKAKYKRLGLVRNKW YRKEVTKIANALADDSFVNNQLGKGYIGNLILALSFWKLRRKKADKIYILLMLILNIF GbcC SEQ ID NO: 4 MKVNILMATYNGEKFLAQQIESIQKQTFKEWNLLIRDDGSSDKTCDIIRNFTAKDSRIRF INENEHHNLGVIKSFFTLVNYEVADFYFFSDQDDVWLPEKLSVSLEAAKHKASDVPLLVYTD LKVVNQELNILQDSMIRAQSHHANTTLLPELTENTVTGGTMMINHALAEKWFTPNDILMHDW FLALLAASLGEIIYLDLPTQLYRQHDNNVLGARTMDKRFKILREGPKSIFTRYWKLIHDSQKQ ASLIVDKYGDIMTANDLELIKCFIKIDKQPFMTRLRWLWKYGYSKNQFKHQVVFKWLIATNYY NKR GccC SEQ ID NO: 5 MNINILLSTYNGERFLAEQIQSIQKQTIKDWTLLIRDDGSTDRTPDIIREFVKQDQRIQW INENQIENLGVIKNFYTLLKYQAADVYFFSDQDDIWLEDKLEVTLLEAQKHDLSKPLLVY TDLKVVNQQLEITHASMIKTQSAHANTTLLQELTENTVTGGTMMINQALAKEWNTCEGLLM HDWYLALVAAARGKLVCLDIPTELYRQHDANVLGARTWSKRMKHWLRPHQLIRKYWWLIT SSQQQAQLLLDLPLQPKDRDMVEAYVSLLTMSLTKRLATLKTYGFRKNRAFHTLVFWSLVIT LFGYRRK GqcC SEQ ID NO: 6 MNINILLSTYNGERFLAEQIQSIQKQTIKDWTLLIRDDGSTDRTPDIIREFVKQDQRIQW INENQIENLGVIKNFYTLLKYQAADVYFFSDQDDIWLEDKLEVTLLEAQKHDLSKPLLVY TDLKVVNQQLEITHASMIKTQSAHANTTLLQELTENTVTGGTMMINQALAKEWNTCEGLLM HDWYLALVAAARGKLVYLDIPTELYRQHDANVLGARTWSKRMKHWLRPHQLIRKYWWLIT SSQQQAQLLLDLPLQPKDRDMVEAYVSLLTMSLTKRLATLKTYGFRKNRAFHTLVFWSLVIT LFGYRRK SccC SEQ ID NO: 7 MKVNILMSTYNGQEFIAQQIQSIQKQTFENWNLLIRDDGSSDGTPKIIADFAKSDARIRF INADKRENFGVIKNFYTLLKYEKADYYFFSDQDDVWLPQKLELTLASVEKENNQIPLMVYTD LTVVDRDLQVLHDSMIKTQSHHANTSLLEELTENTVTGGTMMVNHCLAKQWKQCYDDLIM HDWYLALLAASLGKLIYLDETTELYRQHESNVLGARTWSKRLKNWLRPHRLVKKYWWLVT SSQQQASHLLELDLPAANKAIIRAYVTLLDQSFLNRIKWLKQYGFAKNRAFHTFVFKTLIITKF GYRRK SucC SEQ ID NO: 8 MKINILMSTYNGEKFLAEQIESIQKQTVTDWTLLIRDDGSSDRTPEIIQDFVAKDSRIHF INADHRINFGVIKNFFTLLKYEEADYYFFSDQDDVWLPHKIETSLNKAKELEKNRPFLIY TDLTIVNQSLETIHESMISFQSDHANTTLLEELTENTVTGGTALINHALAELWTDDKDLL MHDWFLALLASAMGNLVYINEATELYRQHDRNVLGARTWSKRLKTWSKPHLMLNKYWWLI QSSQQQAQKLLDLPLSSDKRKLVEHYVTLLEKPLMTRLRDLKKYGYKKNRAFHTFVFRMLII TKIGYRRTVKNGIIQ GccG SEQ ID NO: 9 MNRVLLYVHFNKYNKVSKHIYYQLEKLRPLFTTVVFISNSKVEQKELENLQKQRLIDSFI QRENKGFDFAAWHDGMMKIGFDDLTLCDSLTIMNDTCFGPLWGMAPYFEKFDNNQSVDF WGLTNNRKTSSFKEHIQSYFITFKQHVIQSDAFLNFWKTIKEYDDVQEVIQKYETQVTTTLLE AGFNYQTVFDTREADSSFMLHPDFSYYNPTAILQHRVPFIKVKAIDANQHITPYLLNMIEEET TYPVDLIISHMSQVGLPDAKYLLARKYLPFESLVTQNVPRIAVHLHVFYVDLLNEFLEGFASW EFQYDLYITTDTQEKKEAIEKLLVQSNRHAHLYVTGNVGRDVLPMLLLKDKLRDYDYIGHFH TKKSKEADFWAGESWRKELINMLIKPANEIVRSFENNDIGIVIADIPSFFRFNKIVDAWNEHLI APEMMRLWKEMGLKKEIDFQSMDTFVMSYGTFVWFKFDALKPLFDLDLTVDDIPKEPLPQN SILHAIERLLVYIAWDRFYDFRIVKNPYNLSPFIDNKLLNLRESGGARTYVNFDHMGGIKGAL KYIIIGPARAMKYIVKRVLKSKR GccG Protein 1 SEQ ID NO: 10 MNRVLLYVHFNKYNKVSKHIYYQLEKLRPLFTTVVFISNSKVEQKELENLQKQRLIDSFIQRE NKGFDFAAWHDGMMKIGFDDLTLCDSLTIMNDTCFGPLWGMAPYFEKFDNNQSVDFWGL TNNRKTSSFKEHIQSYFITFKQHVIQSDAFLNFWKTIKEYDDVQEVIQKYETQVTTTLLEAGF NYQTVFDTREADSSFMLHPDFSYYNPTAILQHRVPFIKVKAIDANQHITPYLLNMIEEETTYP VDLIISHMSQVGLPDAKYLLARKYLPFESLVTQNVPRIAVHLHVFYVDLLNEFLEGFASWEFQ YDLYITTDTQEKRKQLKNY GccG Protein 2 SEQ ID NO: 11 MGVSVRPLYYNRYSRKKEAIEKLLVQSNRHAHLYVTGNVGRDVLPMLLLKDKLRDYDYIGH FHTKKSKEADFWAGESWRKELINMLIKPANEIVRSFENNDIGIVIADIPSFFRFNKIVDAWNEH LIAPEMMRLWKEMGLKKEIDFQSMDTFVMSYGTFVWFKFDALKPLFDLDLTVDDIPKEPLP QNSILHAIERLLVYIAWDRFYDFRIVKNPYNLSPFIDNKLLNLRESGGARTYVNFDHMGGIKG ALKYIIIGPARAMKYIVKRVLKSKR GgcG Protein 1 SEQ ID NO: 12 MIGKIIRSYQDEGGRATLRKIRQRLQGGGHPQSAGKIDLNRIPIMPQLEDIAQADYINHP YQRPAKLDKKQLNIAWVSPPVGKGGGGHTTISRFVKYLQSQGHHITFYIYHNNTIEQSAKEA QEIFSKAYGIEVAVDDLKNFSNQDLVFATSWETAYAVFNLKSENLHKFYFVQDFEPIFYGVG SRYKLAEATYKFGFYGITAGKWLTHKLKDYHMDADYFNFGADTDIYKPKAPLQKKKKIAFYA RAHTERRGFELGVMALKIFKDKHPEYDIEFFGQDMSHYDIPFDFIDRGILNKEELAAIYHESV ACLVLSLTNVSLLPLELLVAGCIPVMNSGDNNTMVLGENDDIAYAEAYPVALAEELCKAVER SDIDTYANEMSQKYDGVSWENSYRKVEEIIRREVIND GgcG Protein 2 SEQ ID NO: 13 MTDKIKATVFIPVYNGENDHLEETLTALYTQKTDFSWNVMITDSESKDRSVAIIETFAER YGNLQLIKLKKSDYSHGATRQMAAELSSAEYMVYLSQDAVPANEHWLAEMLKPFTIHHDIV AVLGKQKPRIGCFPAMKYDINAVFNEQGVAGAITLWTRQEESLKGKYTKESFYSDVCSAAP RDFLVNEIGYRSVPYSEDYEYGKDILDAGYMKAYNSDAIVEHSNDVLLSEYKQRIFDETYNV RRNSGVTTPISVSTVLIQFLKSSVKDAMKIVSDQDYSWKRKLYWLAVNPLFHFEKWRGMRL ANSVDMTKDNSKHSLENSKSKG SucG SEQ ID NO: 14 MKRLLLYVHFNKYNRLSPHVLYQLKKMRPLFSNLIFISNSSLNDSDRQELLSSGLVNEVIQR QNIGFDFAAWRDGMATVGFESLSEYDNVTIMNDTCFGPLWDMKPYFLTYEDDEEVDFWGL TNNRQTKEFDEHIQSYFISFKKTVLSNETFLHFWRTVQDFTDVQDVIKNYETQVTTGLLKEG FRYKCIFNTVTADASGMLHADFSYYNPTAILKHQVPFIKVKTIDANQSIAPYLLQVIKNQTDYP VDLIVSHMSDIHYPDAPYLLSQKYLEKQEESDLKVSEHSIAVHLHVFYVDLLEEFLHAFTSFK FPFDLYITTDKSEKESEIKAILDSFRVSAKIVVTGNIGRDVLPMLKLKDELSQYDYIGHFHTKK SKEADFWAGESWRNELIDMLIKPANTIINQFEDPAIGIIIADIPSFFRFNKIVTPLNEHLIAPEMN KLWEKMNLSKTIDFEQFDTFVMSYGTFVWFKYDALKPLFDLNLKDGDVPKEPLPQNSILHA VERLLIYIAWDSHFDFRIAKNNVELTPFLDNKLLNDKSNSLPNTYVDFTYMGGIKGALKYIFIG PARAIKYIYIRTKEKIFNG SccG SEQ ID NO: 15 MKRLLLYVHFNKYNRVSSHVVYQLTQMRSLFSKVIFISNSQVADADVKMLREKHLIDDFIQR QNSGFDFAAWRDGMVFVGFDELVTYDSVTTMNDTCFGPLWEMYSIYQEFETKTTVDFWG LTNNRATKSFREHIQSYFISFKASVLRSTAFRDFWENIKEYQDVQKVIDQYETKVTTTLLDAG FQYDVVFDTTKEDASHMLHADFSYYNPTAILNHRVPFIKVKAIDNNQHITPYLLNDIQKNSTY PIDLIVSHMSEINYPDFSYLLGHKYVKKRERVDLKNQKVAVHLHVFYVDLLEEFLTAFKQFHF SYDLFITTDSDDKKAEIEEILSANGQEAQVFVTGNIGRDVLPMLKLKNYLSAYDFVGHFHTKK SKEADFWAGQSWREELIDMLVKPADNILAQLQQNPKIGLVIADMPTFFRYNKIVDAWNEHLI APEMNTLWQKMGMTKKIDFNAFHTFVMSYGTFVWFKYDALKPLFDLNLTDDDVPEEPLPQ NSILHAIERLLIYIAWNEHYDFRISKNPVDLTPFIDNKLLNERGNSAPNTFVDFNYMGGIKGAF KYIFIGPARAVKYILKRSLQKIKS GacA SEQ ID NO: 16 MLENTKILRKVFYLWQKGELMILITGSNGQLGTELRYLLDERGVDYVAVDVAEMDITNEDKV EAVFAQVKPTLVYHCAAYTAVDAAEDEGKALNEAINVTGSENIAKACGKYGATLVYISTDYV FDGNKPVGQEWVETDHPDPKTEYGRTKRLGELAVERYAEHFYIIRTAWVFGNYGKNFVFT MEQLAENHSRLTVVNDQHGRPTWTRTLAEFMCYLTENQKAFGYYHLSNDAKEDTTWYDF AKEILKDKAVEVVPVDSSAFPAKAKRPLNSTMNLDKAKATGFVIPTWQEALKAFYQQGLKK GacH SEQ ID NO: 17 MIKDTFLKTNWLNISHHIILLVFGFYFSFYSLAKELVSSTAQPVNYYAHLLNVSFVGYII SLIGLSYYLSRQVSRQLFLKTSFIVISYLIVSYWVQITQHLNDKRFDIWSLTKNQFYQFQ ALPSLLIILVMATLIKILVAYFAIEKDRFGLLGYQGNTFSVALILAVVPINDIHLLKLIS SRFSELVTAGNSQIALLKISGLLIVLLVIFATIIYVVLNALKHLKSNKPSFSVAATTSLF LALVFNYTFQYGVKGDEALLGYYVFPGATLFQIVAITLVALLAYVITNRYWPTTFFLLIL GTIISVVNDLKESMRSEPLLVTDFVWLQELGLVTSFVKKSVIVEMVVGLAICIVVAWYLH GRVLAGKLFMSPVKRASAVLGLFIVSCSMLIPFSYEKEGKILSGLPIISALNNDNDINWL GFSTNARYKSLAYVWTRQVTKKIMEKPTNYSQETIASIAQKYQKLAEDINKDRKNNIADQ TVIYLLSESLSDPDRVSNVTVSHDVLPNIKAIKNSTTAGLMQSDSYGGGTANMEFQTLTSLP FYNFSSSVSVLYSEVFPKMAKPHTISEFYQGKNRIAMHPASANNFNRKTVYSNLGFSKFLAL SGSKDKFKNIENVGLLTSDKTVYNNILSLINPSESQFFSVITMQNHIPWSSDYPEEIVAEGKN FTEEENHNLTSYARLLSFTDKETRAFLEKLTQINKPITVVFYGDHLPGLYPDSAFNKHIENKY LTDYFIWSNGTNEKKNHPLINSSDFTAALFEHTDSKVSPYYALLTEVLNKASVDKSPDSPEV KAIQNDLKNIQYDVTIGKGYLLKHKTFFKISR Group B RMID SEQ ID NO: 18 MILITGANGQLGSELRHLLDERTQEYVAVDVAEMDITNAEMVDKVFEEVKPSLVYHCAAYTA VDAAEDEGKELDFAINVTGTENVAKAAAKHDATLVYISTDYVFDGEKPVGQEWEVDDLPDP KTEYGRTKRMGEELVEKYASKFYTIRTAWVFGNYGKNFVFTMQNLAKTHKTLTVVNDQHG RPTWTRTLAEFMTYLAENQKDFGYYHLSNDAKEDTTWYDFAVEILKDTDVEVKPVDSSQFP AKAKRPLNSTMSLEKAKATGFVIPTWQDALKEFYKQEVKK Group C RMID SEQ ID NO: 19 MILITGSNGQLGTELRYLLDERHVDYVAVDVAEMDITDADKVEAVFAQVKPTLVYHCAAYTA VDAAEDEGKALNEAINVTGSENIAKACGKYGATLVYISTDYVFDGNKPVGQEWLETDVPDP QTEYGRTKRLGELAVEQYAEHFYIIRTAWVFGNYGKNFVFTMQQLAEKHPRLTVVNDQHG RPTWTRTLAEFMCYLAENQKAFGYYHLSNDAKEDTTWYDFAKEILKDKAVEVVPVDSSAFP AKAKRPLNSTMNLDKAKATGFVIPTWQEALKEFYQQDRHQ Group G RMID SEQ ID NO: 20 MILITGSNGQLGTELRYLLDERHVDYVAVDVAEMDITDADKVEAVFAQVKPTLVYHCAAYTA VDAAEDEGKALNEAINVTGSENIAKACGKYGATLVYISTDYVFDGNKPVGQEWLETDVPDP QTEYGRTKRLGELAVEQYAEHFYIIRTAWVFGNYGKNFVFTMQQLAEKHPRLTVVNDQHG RPTWTRTLAEFMCYLAENQKAFGYYHLSNDAKEDTTWYDFAKEILKDKAIEVVPVDSSAFP AKAKRPLNSTMNLDKAKATGFVIPTWQEALKEFYQQDRHQ RmID S. mutans SEQ ID NO: 21 MILITGSNGQLGTELRHLLNERNEDYVAVDVAEMDITKAEKVDEVFLQVKPSLVYHCAAYTA VDAAEDEGKELDYAINVTGTENIAKACEKYNATLVYISTDYVFDGEKPVGQEWEVDDKPDP KTEYGRTKRLGEEAVEKYVKNFYIIRTAWVFGNYGKNFVFTMQHLAKSHNSLTVVNDQHGR PTWTRTLAEFMTYLAENQKEYGYYHLSNDATEDTTWYDFALEILKDTDVVVKPVDSSQFPA KAKRPLNSTMSLTKAKATGFVIPTWQEALQEFYKQDVKK RmID S. uberis SEQ ID NO: 22 MILITGSNGQLGTELRYLLDERNVEYVAVDVAEMDITNPDMVDEVFAQVKPTLVYHCAAYTA VDAAEDEGKALNQAINVDGTVNIAKACQKYNATLVYISTDYVFDGTKTVGQEWLETDIPDPK TEYGRTKRLGEEAVEKYVDQFYIIRTAWVFGHYGKNFVFTMQNLAKTHPKLTVVNDQYGRP TWTRTLAEFMCHLTENQKDYGYYHLSNDSKEDTSWYDFAKEILKDTDVEVVPVDSSAFPAK AKRPLNSTMNLDKAKATGFVIPTWQEALNEFYKQEVKK GccD SEQ ID NO: 23 MNFLTKKNRILLREMVKTDFKLRYQGSAIGYLWSILKPLMMFTIMYLVFIRFLRLGGNIPHFPV ALLLANVIWSFFSEATSMGMVSIVSRGDLLRKLNFSKHIIVFSAILGALINFLINLVVVLIFALING VTISNYAYFSFFLFIELVVFVVGIALLLSTVFVYYRDLAQVWEVLLQAGMYATPIIYPITFVLEG HPLAAKILMLNPIAQMIQDFRYLLIDRANVTIWQMSTNWFYIAIPYLIPFILLFIGITVFKKNATKF AEII GccE SEQ ID NO: 24 MTNNKIAVKVEHVSKSFKLPTEATKSFRTTLVNRFRGIKGFTEQQVLKDINFEVHKGDFFGIV GRNGSGKSTLLKIISQIYVPEKGQVTVDGKMVSFIELGVGFNPELTGRENVYMNGAMLGFT KEEINAMYDDIVDFAELHDFMNQKLKNYSSGMQVRLAFSVAIKAQGDVLILDEVLAVGDEAF QRKCNDYFMERKDSGKTTILVTHDMGAVKKYCNRAVLIEDGLVKAYGEPFDVANQYSVDN TETKEELQDSEKVAISDIVQQLRVNLTSKQRITPKEIISFEVSYEVLRDEPTYIAFSLTDMDRNI WVYNDNSRDQLVEGIGKKTISYQCHLSHLNDIKLKLEVTVRDKDGQMLLFSTAEQSPKIIIQR DDITSDDFSALDSASGLYQRNGQWTFS GccF SEQ ID NO: 25 MHKVSIICTNYNKAPWLGEALDSFLNQKTNFEVDIIVIDDASTDESKTILEDYQTRFPEK ITLLFNDHNLGITKTWIKACLYAKGKYIARCDGDDYWTDDLKLQKQVDALEASKYSKWSNTD FDFVDNKGKVLHSNVFETGYIPFTDTYEKVLALKGMTMASTWVVDAELMRFVNQKINIETPD DTFDMQLELFQLTSLTYINDSTTVYRMTSNSDSRPADKKRMIHRIKQLLQTQVFYLAKYPQA NIPQIANLLMEQDGKNELRIHELSCLINDLRQELNEKTEQQKEREFEIKEIIENQSRQICELTH QYNCVINSRRWKYMSKLIDFIRRKK GgcD SEQ ID NO: 26 MNFLTKKNRILLREMVKTDFKLRYQGSFIGHLWSILKPMLLFTIMYLVFVRFLKFDDGTPHYA VSLLLGMVTWNFFTEATNMGMLSIVSRGDLLRKINFPKEIIVISSVVGATINYFINILVVFAFALI NGVQPSFGVFILIPLFLELFLFATGVAFILATLFVKYRDMGPIWEVMLQAGMYGTPHYSITYIIQ RGHLGIAKVMMMNPLAQIIQELRHFIVYSGATINWDIFENKFFTLIPIILSLSAFVIGYVIFKRNA KKFAEIL GcgE SEQ ID NO: 27 MSEKKVVLSVDSVSKSFKLPTEASNSLRTSLVNYFKGIKGYTEQHVLDDISFQVEEGDFFGI VGRNGSGKSTLLKIISKIYEPEKGTVTVDGKLVPFIELGVGFNPELTGRENVFMNGALLGFSR DEVAAMYDDIVSFAELHDFMDQKLKNYSSGMQVRLAFSIAIKAKGDILILDEVLAVGDEAFQR KCFDYFAQLKREHKTVILVTHSMEQVQRFCNKAMLIDKGHHMEVGTPLEISQIYKQLNGLNV AKESAKETENNGISLSSQFINHKDDTLTFTFDVHFEQTIEDPVLTFTIHKDTGELLYRWVSDE EVEGSIMIKNHKVSIDFAIQNIFPNGKFTTEFGVKSRDRSKEYAMFSGICNFELINRGKSGNNI YWKPETTVKLS GgcF SEQ ID NO: 28 MRMYQGKRFLLTHIWLRGFSGAEINILELATYLKEAGAQVEVFTFLAKSPMLDEFQKNGIPVI DDSDYPFDVSQYDVVCSAQNIIPPAMIEALGKSQEKLPKFIFFHMAALPEHVLEQPYIYQLEK KISSATLAISEEIVNKNLKRFFKDIPNLHYYPNPAPESYAAMEHLKKQSPERILVISNHPPQEVI DMEPLLAKKGIHVDYFGVWSDHYELVTPELLASYDCVVGIGKNAQYCLVMGKPIYIYDHFKG PGYLTETNFEAAALNNFSGRGFEEQEKTAEELVDDLLEHYQSAQAFQHNHLYDYRSRYTIS TIVDHIYKSINIIPKAIAPLEQVDVEYIKAITLFIRTRLVRLENDVANLWEAVHRYEQLDRKATAK REALEQLLTAKTTELNLIKTSRMFKLYQLLWRIKGFFFRKEHLKRAK SccD SEQ ID NO: 29 MDFFSRKNRILLKELIKTDFKLRYQGSAIGYLWSILKPLMLFAIMYIVFVRFLPLGGDVP HWPVALLLGNVIWTFFQETTMMGMVSVVTRGDLLRKLNFSKQTIVFSAVSGAAINFGINVIV VLIFALLNGVTFTFRWNLFLLIPLFLELLLFSTGIAFILSTLYVRYRDIGPVWEVILQ GGFYGTPIIYSLTYIATRSVVGAKLLLLSPIAQIIQDMRHILIDPANVTIWQMINHKSIA VIPYLVPIFVFIIGFLVFNYNAKKFAEII SccE SEQ ID NO: 30 MTKNNIAVKVDHVSKYFKLPVESTQSLRTALVNRFKGIKGYKKQHVLRDIDFEVEKGDFFGI VGRNGSGKSTLLKIISQIYVPEQGKVTVDGKLVSFIELGVGFNPELTGRENVYMNGAMLGFT TEEVDTMYQDIVDFAELQDFMNQKLKNYSSGMQVRLAFSVAIKAQGDVLILDEVLAVGDEA FQRKCNDYFLERKNSGKTTILVTHDMAAVKKYCNKAVLIDDGLIKAIGEPFDVANQYSLDNT DQIVEDKQEEEAAVQEEEQIVVDNLEVKLLSANRMTPRDSIRFEISYNVLADVGTYIALSLTD VDRNIWIYNDNSLDYLSSGSGKKRVFYECHLKSLNDIKLKLEVTVRDKQGQMLAFSSATNTP IISINRDDLEGDDKSAMDSASGLIQRNGQWQFS SccF SEQ ID NO: 31 MVKVSIICTNYNKGSWIGEAIDSFLKQETSFPYEIIIVDDASTDHSVHIIKTYQKQYPDL IRAFFNQENQGITKTWSDICKKARGQYIARCDGDDYWIDPFKLQKQIDLLETSPESKWSNTD FDMVDSKGNIIHKDVLKNNIIPFMDSYEKMLALKGMTMASTWLVETKLMLEINDRINKDAVD DTFNIQLELFKKTKLAFLRDSTTVYRMDAESDSRSKDSEKLAQRFDRLLETQLEYIEKYPDS DYKKVLEYLLPKHNDFEKVLAQDGKNVWDNQQITIYLAKGDDQEFSEENCFQFPLQHSGNI QLTFPENIRKIRIDLSEIPSYYRQVSLVNTTVNTELLPTWTNAKVFGYSYYFI APDPQMIYDLTAQEGQDFKLTYEWFNVDQPSQPDFLANHLVKELDQKKVELKMLSPYKYQ YQKAVAERDLYLEQLNEMVVRYNSVTHSRRWTIPTKIINLFRRKK SucD SEQ ID NO 32 MELFSKKNRILLKELVKTDFKLRYQGSAIGYLWSILKPLLMFTIMYLVFIRFLRLGGSVPHFPV ALLLANVIWSFFSEATGMGMVSIVTRGDLLRKLNFSKHTIVFSAVLGALINFSINLVVVLIFALI NGVTISPFAYMAIPLFIELLILAVGVALLLSTLFVYYRDLAQVWEVLMQAAMYATPIIYPITFVS DKNPLAAKILMLNPLAQMIQDLRFLLIDRANATIWQMSNHWYYVMIPYLIPFLVLALGILVFNK NAKKFAEII SucE SEQ ID NO 33 MSTRDIAVKVEHVSKSFKLPTEATKSFRTTLVNRFRGIKGYTEQKVLKDINFEVKKGDFFGIV GRNGSGKSTLLKIISQIYVPEKGTVTVEGKMVSFIELGVGFNPELTGRENVYMNGAMLGFTQ EEVDAMYEDIVDFAELHDFMNQKLKNYSSGMQVRLAFSVAIKAQGDVLILDEVLAVGDEAF QRKCNDYFMERKESGKTTILVTHDMAAVKKYCNRAVLIEDGLVKALGDPDDVANQYSFDNA IASETVEKKEDGKSTEKKESQLISDFSAQLLTKPQISPDEDITISFSYNVLKNMETHVALSFIDI DTNLGLYNDNSMSLKTNGQGQKTVTMTCQMSYLNHAKLKLAATVRDKDKHPLAFLPVNEIP VILIDRKVDASNESEWDANTGILRRSSQWT* SucF SEQ ID NO 34 MKKILFVSPTGTLDNGAEISITNLMVLLTQEGYDIINVIPKIKHSTHDAYLHKMRENQIK VYELDYTNWWWESAPGDKIGHLEDRSAYYQKYIYEIRKIIAEEAVDLVITSTANLFQGALAAA CERIPHYWIIHEFPLDEFAYYKELIPFIEEYSDKIFTVEGKLTEFLRPLLKESQKLF PFVPFVNIKKNNNLKTGEETRLISISRINENKNQLELLKAYQSMAEPKPELLFVGDWDDSYKE KCDDFIQSHQLKTVRFLGHQSNPWNLMTDKDILVLNSKMETFGLVFVEALIQGIPVLASNNY GYSSVVDYFGCGKLYHLGDEKELVALLNEFVTNFSEEKKKSLTQSFMVEEKYTIEKSYCALL DAISNENSVKSDRPIWLSQFLGAYNPLSTFSPAGKESISIYYRDENGNWSENQKLVFSLFNR DSFTFSVPKGMTRIRLDMSERPSYYDKITLVDSDTMTQLLPTNVSGFEENNSFYFNHSDPQ MEFNVSFSKNNVFQLSYQLANLENIFQDSFLPNQLVQKLLSFKEKQSDLEMLKIENHQLQEK NKLKQEQLEEMVVRYNSVIHSRRWSIPTKMINFLRRKK SccH SEQ ID NO: 35 MKQLKKIWDMLGKQKLLIFIFIFALNVTLRNYDLLIGRRANSSLSFKVISKNFDIMIEHWEALPS HFKIIGGVCLVIYVLSILGLSFYLSKNLKKTFFIELLLGYGLYIVISYFLAVTRELNNESFKIWDLA KNHFFQPYFLPTLVLIIVCTLALNYLIRVKMKRSHLSRKMTLLLENFSETEFLLTGLIVSFILSDT LYVKLLQESLRAYYHKPLAYESLLFLYTLLTLILFSVIVEACFNAYRSIKLNRPNLSLAFVSSLL FATIFNYAFQYGLKNDADLLGKYIVPGATAYQILVLTAAGFFLYLIINRYLLVTFLIVILGSIITVV NVLKVGMRNEPLLVTDFAWVTNIRLLARSVNANIIFSTLLILAALILLYLFLRKRLLQGKITENH RLKVGLISSICLLGFSIFIIFRNEKGSKIVNGIPVISQVNNWVDIGYQGFYSNASYKSLMYVWT KQVTKSIMDKPSDYSKERILKLAKKYNNVANKINKVRTENISNQTVIYILSESFSDPDRVKGV NLSRDVIPNIKQIKEKTTSGLMHSDGYGGGTANMEFQSLTGLPYYNFNSSVSTLYTEVVPD MSVFPSISNQFKSKNRVVIHPSSASNYSRKYVYDKLKFPTFVASSGTSDKITHSEKVGLNVS DKTTYQNILDKINPSQSQFFSVMTMQNHVPWASDEPSDVVATGKGYTKDENGSLSSYARL LTYTDKETKDFLAQLSQLKHKVTVVFYGDHLPGLYPESAFKKDPDSQYQTDYFIWSNYNTK TLNHSYVNSSDFTAELLEHTNSKVSPYYALLTEVLDNTTVGHGKLTKEQKEIANDLKLIQYDI TVGKGYIRNYKGFFDIR WchF_pHD0486 SEQ ID NO: 36 MKQSVYIIGSKGIPAKYGGFETFVEKLTEYQKDGNIQYYVACMRENSAKSGFTADTFEYNG AICYNIDVPNIGPARAIAYDIAAVNKAIELSKGNKDEAPIFYILACRIGPFISGLKKKIRSIGGRLL VNPDGHEWLRAKWSLPVRKYWKFSEQLMVKHADLLVCDSKNIEKYIREDYKQYQPKTTYIA YGTDTTPSSLKSEDAKVRNWYREKGVSENGYYLVVGRFVPENNYETMIREFIKSKSNKDFV LITNVEQNKFYDQLLKETGFDKDLRVKFVGTVYDQELLKYIRENAFAYFHGHEVGGTNPSLL EALASTKLNLLLDVGFNREVGEDGAIYWKKDELAHVIEEVERFDEGDITELDEKSSQRIADAF TWEKIVSDYEEVFTV WbbR SEQ ID NO: 37 MNKYCILVLFNPDISVFIDNVKKILSLDVSLFVYDNSANKHAFLALSSQEQTKINYFSICENIGL SKAYNETLRHILEFNKNVKNKSINDSVLFLDQDSEVDLNSINILFETISAAESNVMIVAGNPIRR DGLPYIDYPHTVNNVKFVISSYAVYRLDAFRNIGLFQEDFFIDHIDSDFCSRLIKSNYQILLRK DAFFYQPIGIKPFNLCGRYLFPIPSQHRTYFQIRNAFLSYRRNGVTFNFLFREIVNRLIMSIFS GLNEKDLLKRLHLYLKGIKDGLKM WbbL_pHD0480 SEQ ID NO: 38 MVYIIIVSHGHEDYIKKLLENLNADDEHYKIIVRDNKDSLLLKQICQHYAGLDYISGGVYGFGH NNNIAVAYVKEKYRPADDDYILFLNPDIIMKHDDLLTYIKYVESKRYAFSTLCLFRDEAKSLHD YSVRKFPVLSDFIVSFMLGINKTKIPKESIYSDTVVDWCAGSFMLVRFSDFVRVNGFDQGYF MYCEDIDLCLRLSLAGVRLHYVPAFHAIHYAHHDNRSFFSKAFRWHLKSTFRYLARKRILSN RNFDRISSVFHP WbbL SEQ ID NO: 39 MVAVTYSPGPHLERFLASLSLATERPVSVLLADNGSTDGTPQAAVQRYPNVRLLPTGANLG YGTAVNRTIAQLGEMAGDAGEPWGDDWVIVANPDVQWGPGSIDALLDAASRWPRAGALG PLIRDPDGSVYPSARQMPSLIRGGMHAVLGPFWPRNPWTTAYRQERLEPSERPVGWLSG SCLLVRRSAFGQVGGFDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKAHSTGRD PASHLAAHHKSTYIFLADRHSGWWRAPLRWTLRGSLALRSHL MVRSSLRRSRRRKLKLVEGRH RfbF SEQ ID NO: 40 MNSNIYAVIVTYNPELKNLNALITELKEQNCYVVVVDNRTNFTLKDKLADIEKVHLICLGRNEG IAKAQNIGIRYSLEKGAEKIIFFDQDSRIRNEFIKKLSCYMDNENAKIAGPVFIDRDKSHYYPIC NIKKNGLREKIHVTEGQTPFKSSVTISSGTMVSKEVFEIVGMMDEELFIDYVDTEWCLRCLN YGILVHIIPDIEMVHAIGDKSVKICGINIPIHSPVRRYYRVRNAFLLLRKNHVPLLLSIREVVFSLI HTTLIIATQKNKIEYMKKHILATLDGIRGITGGGRYNA WsaD SEQ ID NO: 41 MDISIIIVNYNTPKLTVEAIESILKSKTKYSYEIIVVDNHSSDDSVRILKGKFPNIVVIENKQNVGF SKANNQAIKLSKGRYILLLNSDTIVKEDTIEKMIEFMDKSKKVGASGCEVVLPNGELDRACHR GFPTPEASFYYLVGLARLFPRSRRFNQYHLGYMNLNEPHPIDCLVGAFMMVRREVIEQVGL LDEEFFMYGEDIDWCYRIKQAGWEIYYCPFTSIIHYKGASSKKKPFKIVYEFHRAMFLFHRKH YARKYPFIVNCLVYTGIAAKFILSAIINTFRKIGG WbbP SEQ ID NO: 42 MKISIIGNTANAMILFRLDLIKTLTKKGISVYAFATDYNDSSKEIIKKAGAIPVDYNLSR SGINLAGDLWNTYLLSKKLKKIKPDAILSFFSKPSIFGSLAGIFSGVKNNTAMLEGLGFL FTEQPHGTPLKTKLLKNIQVLLYKIIFPHINSLILLNKDDYHDLIDKYKIKLKSCHILGG IGLDMNNYCKSTPPTNEISFIFIARLLAEKGVNEFVLAAKKIKKTHPNVEFIILGAIDKE NPGGLSESDVDTLIKSGVISYPGFVSNVADWIEKSSVFVLPSYYREGVPRSTQEAMAMGRP ILTTNLPGCKETIIDGVNGYVVKKWSHEDLAEKMLKLINNPEKIISMGEESYKLARERFDANV NNVKLLKILGIPD WsaP SEQ ID NO: 43 MVKVIRGRERFLTKLYAFVDFAMMQGAFFLAWVLKFKVFHNGVGGHLPLEDYLFWSFVYG AIAIVIGYLVELYAPKRKEKFSNELAKVLQVHTLSMFVLLSVLFTFKTVDVSRSFLLLYFAWNLI LVSIYRYIVKQSLRTLRKKGYNKQFVLIIGAGSIGRKYFENLQMHPEFGLEVVGFLDDFRTKH APEFAHYKPIIGQTADLEHVLSHQLIDEVIVALPLQAYPKYREIIAVCEKMGVRVSIIPDFYDILP AAPHFEIFGDLPIINVRDVPLDELRNRVLKRSFDIVFSLVAIIVTS PIMLLIAIGIKLTSPGPIIFKQERVGLNRRTFYMYKFRSMKPMPQSVSDTQWTVESDPRRTKF GAFLRKTSLDELPQFFNVLKGDMSIVGPRPERPFFVEKFKKEIPKYMIKHHVRPGITGWAQV CGLRGDTSIQERIEHDLFYIENWSLWLDIKIILLTITNGLVNKNAY WsaC SEQ ID NO: 44 MEMPLVSIVVATYFPRTDFFEKQLQSLNNQTYENIEIIICDDSANDAEYEKVKKMVENII SRFPCKVIRNEKNVGSNKTFERLTQEANGDYICYCDQDDIWLSEKVERLVNHITKHHCTLVY SDLSLIDENDRIIHKSFKRSNFRLKHVHGDNTFAHLINRNSVTGCAMMIRADVAKSAIPFPDY DEFVHDHWLAIHAAVKGSLGYIKEPLVWYRIHLGNQIGNQRLVNITNINDYIRHRIEKQGNKY RLTLERLSLTLQQKQLVYFQIHLTEARKKFSQKPCLGNFFKIVPLIKYDIILFLFELMIFTVPFTC SIWIFKKLKY WsaE SEQ ID NO: 45 MERCRMNKKIPFDQYQRYKNAAEIINLIREENQSFTILEVGANEHRNLEHFLPKDQVTYLDIE VPEHLKHMTNYIEADATNMPLDDNAFDFVIALDVFEHIPPDKRNQFLFEINRVAKEGFLIAAP FNTEGVEETEIRVNEYYKALYGEGFRWLEEHRQYTLPNLEETEDILRKENIEYVKFEHGSLL FWEKLMRLHFLVADRNVLHDYRFMIDDFYNKNIYEVDYIGPCYRNFIVVCRDKAKREFIQSIY EKRKQNSYLKNSTISKLNELENSIYSLKIIDKENQIYKKSLEITEQLLEDLKLKEQQIIEKIQTIKK KTEMIELQNQKIQELKIECENKSIENNNLYSQLLEKENYIKQ LQNQAESMRIKNRLKKILNFSFIKYVRKIINIIFRRKFKFKLQPVHHLEWSNGKWLVLGR DPHFILKGGSYPSSVVTIIQWRASANSSALLRLYYDTGGGFSENQSFNLGKIGNDINRDYECV ICLPENIHLLRLDIEGEISEFELENLTFTSISRLEVFYKSFINHCRKRNIKNYKELYS LIKKLFILVRREGLKSIWYRAKQKLSMELLSEDPYEVFLNVSSKVDKEIVLSEIKKLKYK PKFSVILPVYNVEEKWLRKCIDSVLNQWYPYWELCIVDDNSSKDYIKPVLEEYSNRDSRIKT VFRSNNGHISEASNTALEIATGDFIALLDHDDELAPEALYENAVLLNEHPDADMIYSDEDKITK DGKRHSPLFKPDWSPDTLRSQMYIGHLTVYRTNLVRQLGGFRKGFEGSQDYDLALRVAEK TNNIYHIPKILYSWREIETSTAVNPSSKPYAHEAGLKALNEHLERVFGKGKAWAEETEYLFVY DVRYAIPEDYPLVSIIIPTKDNIELLSSCIQSILDKTTYPNYEILIMNNNSVMEETYSWFDKQKE NSKIRIIDAMYEFNWSKLNNHGIREANGEVFVFLNNDTIVISEDWLQRLVEKALREDVGTVG GLLLYEDNTIQHAGVVIGMGGWADHVYKGMHPVHNTSPFISPVINRNVSASTGACLAIAKKV IEKIGGFNEEFIICGSDVEISLRALKMGYVNIYDPYVRLYHLESKTRDSFIPERDFELSAKYYS PYREIGDPYYNQNLSYNHLIPTIRS WbbQ SEQ ID NO: 46 MARSGGVVIKKKVAAIIITYNPDLTILRESYTSLYKQVDKIILIDNNSTNYQELKKLFEK KEKIKIVPLSDNIGLAAAQNLGLNLAIKNNYTYAILFDQDSVLQDNGINSFFFEFEKLVS EEKLNIVAIGPSFFDEKTGRRFRPTKFIGPFLYPFRKITTKNPLTEVDFLIASGCFIKLE CIKSAGMMTESLFIDYIDVEWSYRMRSYGYKLYIHNDIHMSHLVGESRVNLGLKTISLHGPLR RYYLFRNYISILKVRYIPLGYKIREGFFNIGRFLVSMIITKNRKTLILYTIKAIKDG INNEMGKYKG