ANTIBODY LIBRARY AND ANTIBODY SCREENING METHOD USING SAME

20220275360 · 2022-09-01

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention relates to a novel antibody library and an antibody-screening method using same. Having a human sequence-derived specific VH or VL scaffold, the antibody library according to the present invention exhibits high thermodynamic stability and enjoys the advantages of allowing high soluble expression as well as reversible folding. In addition, the antibody according to the present invention includes a variety of rationally controlled CDRs so as to exhibit high specificity and high affinity to all antigens and thus can be advantageously used for selecting an adequate candidate antibody against a target antigen.

    Claims

    1. A set of antibodies or fragments thereof, wherein each antibody or fragment thereof comprises a pair of a heavy-chain variable region and a light-chain variable region, wherein the heavy-chain variable region comprises: a framework region included in a heavy-chain variable region selected from the group consisting of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) and VH1-69 (SEQ ID NO: 11); and a combination of a heavy-chain complementarity-determining region 1 (CDRH1), a heavy-chain complementarity-determining region 2 (CDRH2), and a heavy-chain complementarity-determining region 3 (CDRH3), which are different for each heavy-chain variable region, and the light-chain variable region comprises: a framework region included in a light-chain variable region selected from the group consisting of Vκ1-39 (SEQ ID NO: 16), Vκ3-20 (SEQ ID NO: 21), Vκ3-20-2 (SEQ ID NO: 26) and Vλ1-51 (SEQ ID NO: 31); and a combination of a light-chain complementarity-determining region 1 (CDRL1), a light-chain complementarity-determining region 2 (CDRL2), and a light-chain complementarity-determining region 3 (CDRL3), which are different for each light-chain variable region.

    2. The set of antibodies or fragments thereof according to claim 1, wherein the set of antibodies or fragments thereof comprises: a framework region included in a pair of heavy- and light-chain variable regions selected from the group consisting of VH3-15 (SEQ ID NO: 1)/Vκ1-39 (SEQ ID NO: 16), VH3-15 (SEQ ID NO: 1) Vκ3-20 (SEQ ID NO: 21), VH3-15 (SEQ ID NO: 1)/Vκ3-20-2 (SEQ ID NO: 26), VH3-15 (SEQ ID NO: 1)/Vλ1-51 (SEQ ID NO: 31), VH3-23 (SEQ ID NO: 6)/Vκ1-39 (SEQ ID NO: 16), VH3-23 (SEQ ID NO: 6)/Vκ3-20 (SEQ ID NO: 21), VH3-23 (SEQ ID NO: 6)/Vκ3-20-2 (SEQ ID NO: 26), VH3-23 (SEQ ID NO: 6)/Vλ1-51 (SEQ ID NO: 31), VH1-69 (SEQ ID NO: 11)/Vκ1-39 (SEQ ID NO: 16), VH1-69 (SEQ ID NO: 11)/Vκ3-20 (SEQ ID NO: 21), VH1-69 (SEQ ID NO: 11)/Vκ3-20-2 (SEQ ID NO: 26) and VH1-69 (SEQ ID NO: 11)/Vλ1-51 (SEQ ID NO: 31); and a combination of CDRH1, CDRH2 and CDRH3 different for each heavy-chain variable region and a combination of CDRL1, CDRL2 and CDRL3 different for each light-chain variable region.

    3. The set of antibodies or fragments thereof according to claim 1, wherein the framework region in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1) comprises FR1 (SEQ ID NO: 2), FR2 (SEQ ID NO: 3), FR3 (SEQ ID NO: 4) and FR4 (SEQ ID NO: 5), the framework region in the heavy-chain variable region having the sequence of VH3-23 (SEQ ID NO: 6) comprises FR1 (SEQ ID NO: 7), FR2 (SEQ ID NO: 8), FR3 (SEQ ID NO: 9) and FR4 (SEQ ID NO: 10), the framework region in the heavy-chain variable region having the sequence of VH1-69 (SEQ ID NO: 11) comprises FR1 (SEQ ID NO: 12), FR2 (SEQ ID NO: 13), FR3 (SEQ ID NO: 14) and FR4 (SEQ ID NO: 15), the framework region in the light-chain variable region having the sequence of Vκ39 (SEQ ID NO: 16) comprises FR1 (SEQ ID NO: 17), FR2 (SEQ ID NO: 18), FR3 (SEQ ID NO: 19) and FR4 (SEQ ID NO: 20), the framework region in the light-chain variable region having the sequence of Vκ3-20 (SEQ ID NO: 21) comprises FR1 (SEQ ID NO: 22), FR2 (SEQ ID NO: 23), FR3 (SEQ ID NO: 24) and FR4 (SEQ ID NO: 25), the framework region in the light-chain variable region having the sequence of Vκ3-20-2 (SEQ ID NO: 26) comprises FR1 (SEQ ID NO: 27), FR2 (SEQ ID NO: 28), FR3 (SEQ ID NO: 29), and FR4 (SEQ ID NO: 30), and the framework region in the light-chain variable region having the sequence of Vλ1-51 (SEQ ID NO: 31) comprises FR1 (SEQ ID NO: 32), FR2 (SEQ ID NO: 33), FR3 (SEQ ID NO: 34) and FR4 (SEQ ID NO: 35).

    4. The set of antibodies or fragments thereof according to claim 1, wherein, in the antibody or fragment thereof, the complementarity-determining region (CDR) included in each variable region of the pair of the heavy-chain variable region and the light-chain variable region is designed to prevent the occurrence of modification after translation through alteration of an amino acid that has the potential to undergo post-translational modification (PTM).

    5. The set of antibodies or fragments thereof according to claim 1, wherein the amino acid ratio for each position in the heavy-chain complementarity-determining region 1 (CDRH1) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1) comprises the range of Table 3, the amino acid ratio for each position in the heavy-chain complementarity-determining region 2 (CDRH2) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1) comprises the range of Table 4, the amino acid ratio for each position in the heavy-chain complementarity-determining region 1 (CDRH1) in the heavy-chain variable region having the sequence of VH3-23 (SEQ ID NO: 6) comprises the range of Table 3, the amino acid ratio for each position in the heavy-chain complementarity-determining region 2 (CDRH2) in the heavy-chain variable region having the sequence of VH3-23 (SEQ ID NO: 6) comprises the range of Table 4, the amino acid ratio for each position in the heavy-chain complementarity-determining region 1 (CDRH1) in the heavy-chain variable region having the sequence of VH1-69 (SEQ ID NO: 11) comprises the range of Table 5, the amino acid ratio for each position in the heavy-chain complementarity-determining region 2 (CDRH2) in the heavy-chain variable region having the sequence of VH1-69 (SEQ ID NO: 11) comprises the range of Table 6, when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 9 amino acids, the amino acid ratio for each position in the CDRH3 comprises the range of Table 7, when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 10 amino acids, the amino acid ratio for each position in CDRH3 comprises the range of Table 8, when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 11 amino acids, the amino acid ratio for each position in the CDRH3 comprises the range of Table 9, when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 12 amino acids, the amino acid ratio for each position in CDRH3 comprises the range of Table 10, when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 13 amino acids, the amino acid ratio for each position in CDRH3 comprises the range of Table 11, when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 14 amino acids, the amino acid ratio for each position in CDRH3 comprises the range of Table 12, the amino acid ratio for each position in the light-chain complementarity-determining region 1 (CDRL1) in the light-chain variable region having the sequence of Vκ1-39 (SEQ ID NO: 16) comprises the range of Table 13, the amino acid ratio for each position in the light-chain complementarity-determining region 2 (CDRL2) in the light-chain variable region having the sequence of Vκ1-39 (SEQ ID NO: 16) comprises the range of Table 14, the amino acid ratio for each position in the light-chain complementarity-determining region 3 (CDRL3) in the light-chain variable region having the sequence of Vκ1-39 (SEQ ID NO: 16) comprises the range of Table 15, the amino acid ratio for each position in the light-chain complementarity-determining region 1 (CDRL1) in the light-chain variable region having the sequence of Vκ3-20 (SEQ ID NO: 21) comprises the range of Table 16, the amino acid ratio for each position in the light-chain complementarity-determining region 2 (CDRL2) in the light-chain variable region having the sequence of Vκ3-20 (SEQ ID NO: 21) comprises the range of Table 17, the amino acid ratio for each position in the light-chain complementarity-determining region 3 (CDRL3) in the light-chain variable region having the sequence of Vκ3-20 (SEQ ID NO: 21) comprises the range of Table 18, the amino acid ratio for each position in the light-chain complementarity-determining region 1 (CDRL1) in the light-chain variable region having the sequence of Vκ3-20-2 (SEQ ID NO: 26) comprises the range of Table 19, the amino acid ratio for each position in the light-chain complementarity-determining region 2 (CDRL2) in the light-chain variable region having the sequence of Vκ3-20-2 (SEQ ID NO: 26) comprises the range of Table 17, the amino acid ratio for each position in the light-chain complementarity-determining region 3 (CDRL3) in the light-chain variable region having the sequence of Vκ3-20-2 (SEQ ID NO: 26) comprises the range of Table 18, the amino acid ratio for each position in the light-chain complementarity-determining region 1 (CDRL1) in the light-chain variable region having the sequence of Vλ1-51 (SEQ ID NO: 31) comprises the range of Table 20, the amino acid ratio for each position in the light-chain complementarity-determining region 2 (CDRL2) in the light-chain variable region having the sequence of Vλ1-51 (SEQ ID NO: 31) comprises the range of Table 21, and the amino acid ratio for each position in the light-chain complementarity-determining region 3 (CDRL3) in the light-chain variable region having the sequence of Vλ1-51 (SEQ ID NO: 31) comprises the range of Table 22.

    6. The set of antibodies or fragments thereof according to claim 1, wherein the fragment of the antibody has one or more forms selected from the group consisting of Fab, Fab′, F(ab′).sub.2, scFv (scFv).sub.2, scFv-Fc, and Fv.

    7. The set of antibodies or fragments thereof according to claim 1, wherein the set of antibodies or fragments thereof has one or more characteristics selected from the following i) to iv): i) redundancy (percentage of repetitive sequences) of 10% or less; ii) p-value of CDR composition >0.05; iii) thermal stability of 70° C. or higher; and iv) diversity (library size) of 10.sup.7 or more.

    8. The set of antibodies or fragments thereof according to claim 1, wherein the set of antibodies or fragments thereof is expressed on a surface of a phage or host cell introduced with a nucleic acid encoding the set of antibodies or fragments thereof.

    9. The set of antibodies or fragments thereof according to claim 8, wherein the host cell is E. coli or yeast.

    10. A nucleic acid encoding the set of antibodies or fragments thereof according to claim 1.

    11. A method of identifying an antibody or fragment thereof specific for an antigen comprising: (a) contacting an antigen with the set of antibodies or fragments thereof according to claim 1; and (b) selecting one or more antibodies or antibody fragments that bind to the antigen.

    12. The method according to claim 11, wherein the set of antibodies or fragments thereof is expressed on a surface of a phage or host cell introduced with the nucleic acid encoding the set of antibodies or fragments thereof.

    Description

    DESCRIPTION OF DRAWINGS

    [0026] The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.

    [0027] FIG. 1 is a schematic diagram showing a process of constructing a library vector according to the present invention.

    [0028] FIG. 2 is a graph showing the distribution of amino acids at different positions of the heavy-chain complementarity-determining region (CDRH3) of the library constructed in an embodiment of the present invention.

    [0029] FIG. 3 is a graph showing the result of analysis of the ratio of the repetitive sequence of the library sequence constructed in an embodiment of the present invention.

    [0030] FIG. 4 shows the result of analysis of the distribution of the length of the heavy-chain complementarity-determining region (CDRH3) of the library constructed in an embodiment of the present invention.

    BEST MODE

    [0031] Unless defined otherwise, all technical and scientific terms used herein have the same meanings as appreciated by those skilled in the field to which the present invention pertains. In general, the nomenclature used herein is well-known in the art and is ordinarily used.

    [0032] In the present invention, it was found that an antibody library having high diversity and stability can be constructed when constructing an antibody library using a trimer codon in order to secure VH and VL clones with high stability of the framework region, minimize posttranslational modification (PTM), and precisely synthesize only amino acids that minimize immunogenicity.

    [0033] That is, in one embodiment of the present invention, of the human variable region from Asian and Caucasian cDNA, VH1 and VH3 genes for the heavy-chain variable region and Vκ1, Vκ3 and Vλ1 genes for the light-chain variable region were obtained, and combinations of amino acids of the complementarity-determining region (CDR) included in the human antibody variable region were analyzed, and in particular, the heavy-chain complementarity-determining region 3 (CDRH3) was analyzed for each of 9 to 14 lengths. Asian and Caucasian variable region amino acid combinations obtained after analysis showed similarity without significant difference, and the average of the secured Asian and Caucasian combinations was calculated and then reflected in the library primer design. In the case of heavy-chain complementarity-determining region 2 (CDRH2), the possibility of occurrence of N-glycosylation sites was found to be 5% due to N-X-S/T amino acids in the analyzed combination, and the probability of occurrence of N-glycosylation sites was adjusted to 1% or less in order to prevent PTM from inhibiting the antibody-binding ability and stability in the future. Through the above method, primers for constructing a library having high diversity were designed. As a result of constructing a Fab library based on the primers, a library having a diversity of 1.54×10.sup.11 was obtained (FIG. 1).

    [0034] In one aspect, the present invention is directed to a set of antibodies or fragments thereof, wherein each antibody or fragment thereof includes a pair of a heavy-chain variable region and a light-chain variable region, wherein the heavy-chain variable region includes a framework region included in a heavy-chain variable region selected from the group consisting of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) and VH1-69 (SEQ ID NO: 11), and a combination of a heavy-chain complementarity-determining region 1 (CDRH1), a heavy-chain complementarity-determining region 2 (CDRH2), and a heavy-chain complementarity-determining region 3 (CDRH3), which are different for each heavy-chain variable region, and the light-chain variable region includes a framework region included in a light-chain variable region selected from the group consisting of Vκ1-39 (SEQ ID NO: 16), Vκ3-20 (SEQ ID NO: 21), Vκ3-20-2 (SEQ ID NO: 26) and Vλ1-51 (SEQ ID NO: 31), and a combination of a light-chain complementarity-determining region 1 (CDRL1), a light-chain complementarity-determining region 2 (CDRL2), and a light-chain complementarity-determining region 3 (CDRL3), which are different for each light-chain variable region.

    [0035] Preferably, the set of antibodies or fragments thereof according to the present invention includes:

    [0036] a framework region included in a pair of heavy and light-chain variable regions selected from the group consisting of VH3-15 (SEQ ID NO: 1)/Vκ1-39 (SEQ ID NO: 16), VH3-15 (SEQ ID NO: 1)/Vκ3-20 (SEQ ID NO: 21), VH3-15 (SEQ ID NO: 1)/Vκ3-20-2 (SEQ ID NO: 26), VH3-15 (SEQ ID NO: 1)/Vλ1-51 (SEQ ID NO: 31), VH3-23 (SEQ ID NO: 6)/Vκ1-39 (SEQ ID NO: 16), VH3-23 (SEQ ID NO: 6)/Vκ3-20 (SEQ ID NO: 21), VH3-23 (SEQ ID NO: 6)/Vκ3-20-2 (SEQ ID NO: 26), VH3-23 (SEQ ID NO: 6)/Vλ1-51 (SEQ ID NO: 31), VH1-69 (SEQ ID NO: 11)/Vκ1-39 (SEQ ID NO: 16), VH1-69 (SEQ ID NO: 11)/Vκ3-20 (SEQ ID NO: 21), VH1-69 (SEQ ID NO: 11)/Vκ3-20-2 (SEQ ID NO: 26) and VH1-69 (SEQ ID NO: 11)/Vλ1-51 (SEQ ID NO: 31), and

    [0037] a combination of CDRH1, CDRH2 and CDRH3 different for each heavy-chain variable region and a combination of CDRL1, CDRL2 and CDRL3 different for each light-chain variable region.

    [0038] In addition, in the set of antibodies or fragments thereof according to the present invention,

    [0039] the framework region in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1) includes FR1 (SEQ ID NO: 2), FR2 (SEQ ID NO: 3), FR3 (SEQ ID NO: 4) and FR4 (SEQ ID NO: 5),

    [0040] the framework region in the heavy-chain variable region having the sequence of VH3-23 (SEQ ID NO: 6) includes FR1 (SEQ ID NO: 7), FR2 (SEQ ID NO: 8), FR3 (SEQ ID NO: 9) and FR4 (SEQ ID NO: 10),

    [0041] the framework region in the heavy-chain variable region having the sequence of VH1-69 (SEQ ID NO: 11) includes FR1 (SEQ ID NO: 12), FR2 (SEQ ID NO: 13), FR3 (SEQ ID NO: 14) and FR4 (SEQ ID NO: 15),

    [0042] the framework regions in the light-chain variable region having the sequence of Vκ1-39 (SEQ ID NO: 16) includes FR1 (SEQ ID NO: 17), FR2 (SEQ ID NO: 18), FR3 (SEQ ID NO: 19) and FR4 (SEQ ID NO: 20),

    [0043] the framework region in the light-chain variable region having the sequence of Vκ3-20 (SEQ ID NO: 21) includes FR1 (SEQ ID NO: 22), FR2 (SEQ ID NO: 23), FR3 (SEQ ID NO: 24) and FR4 (SEQ ID NO: 25),

    [0044] the framework region in the light-chain variable region having the sequence of Vκ3-20-2 (SEQ ID NO: 26) includes FR1 (SEQ ID NO: 27), FR2 (SEQ ID NO: 28), FR3 (SEQ ID NO: 29), and FR4 (SEQ ID NO: 30), and

    [0045] the framework region in the light-chain variable region having the sequence of Vλ1-51 (SEQ ID NO: 31) includes FR1 (SEQ ID NO: 32), FR2 (SEQ ID NO: 33), FR3 (SEQ ID NO: 34) and FR4 (SEQ ID NO: 35).

    [0046] The antibody or fragment thereof may be characterized in that the complementarity-determining region (CDR) included in each variable region of the pair of the heavy-chain variable region and the light-chain variable region is designed to prevent occurrence of post-traditional modification through alteration of an amino acid that has the potential to undergo post-translational modification (PTM).

    [0047] In particular, regarding the CDR sequences included in the set of antibodies or fragments thereof according to the present invention,

    [0048] the amino acid ratio for each position in the heavy-chain complementarity-determining region 1 (CDRH1) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1) includes the range of Table 3,

    [0049] the amino acid ratio for each position in the heavy-chain complementarity-determining region 2 (CDRH2) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1) includes the range of Table 4,

    [0050] the amino acid ratio for each position in the heavy-chain complementarity-determining region 1 (CDRH1) in the heavy-chain variable region having the sequence of VH3-23 (SEQ ID NO: 6) includes the range of Table 3,

    [0051] the amino acid ratio for each position in the heavy-chain complementarity-determining region 2 (CDRH2) in the heavy-chain variable region having the sequence of VH3-23 (SEQ ID NO: 6) includes the range of Table 4,

    [0052] the amino acid ratio for each position in the heavy-chain complementarity-determining region 1 (CDRH1) in the heavy-chain variable region having the sequence of VH1-69 (SEQ ID NO: 11) includes the range of Table 5,

    [0053] the amino acid ratio for each position in the heavy-chain complementarity-determining region 2 (CDRH2) in the heavy-chain variable region having the sequence of VH1-69 (SEQ ID NO: 11) includes the range of Table 6,

    [0054] when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 9 amino acids, the amino acid ratio for each position in the CDRH3 includes the range of Table 7,

    [0055] when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 10 amino acids, the amino acid ratio for each position in CDRH3 includes the range of Table 8,

    [0056] when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 11 amino acids, the amino acid ratio for each position in the CDRH3 includes the range of Table 9,

    [0057] when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 12 amino acids, the amino acid ratio for each position in CDRH3 includes the range of Table 10,

    [0058] when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 13 amino acids, the amino acid ratio for each position in CDRH3 includes the range of Table 11,

    [0059] when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 14 amino acids, the amino acid ratio for each position in CDRH3 includes the range of Table 12,

    [0060] the amino acid ratio for each position in the light-chain complementarity-determining region 1 (CDRL1) in the light-chain variable region having the sequence of Vκ1-39 (SEQ ID NO: 16) includes the range of Table 13,

    [0061] the amino acid ratio for each position in the light-chain complementarity-determining region 2 (CDRL2) in the light-chain variable region having the sequence of Vκ1-39 (SEQ ID NO: 16) includes the range of Table 14,

    [0062] the amino acid ratio for each position in the light-chain complementarity-determining region 3 (CDRL3) in the light-chain variable region having the sequence of Vκ1-39 (SEQ ID NO: 16) includes the range of Table 15,

    [0063] the amino acid ratio for each position in the light-chain complementarity-determining region 1 (CDRL1) in the light-chain variable region having the sequence of Vκ3-20 (SEQ ID NO: 21) includes the range of Table 16,

    [0064] the amino acid ratio for each position in the light-chain complementarity-determining region 2 (CDRL2) in the light-chain variable region having the sequence of Vκ3-20 (SEQ ID NO: 21) includes the range of Table 17,

    [0065] the amino acid ratio for each position in the light-chain complementarity-determining region 3 (CDRL3) in the light-chain variable region having the sequence of Vκ3-20 (SEQ ID NO: 21) includes the range of Table 18,

    [0066] the amino acid ratio for each position in the light-chain complementarity-determining region 1 (CDRL1) in the light-chain variable region having the sequence of Vκ3-20-2 (SEQ ID NO: 26) includes the range of Table 19,

    [0067] the amino acid ratio for each position in the light-chain complementarity-determining region 2 (CDRL2) in the light-chain variable region having the sequence of Vκ3-20-2 (SEQ ID NO: 26) includes the range of Table 17,

    [0068] the amino acid ratio for each position in the light-chain complementarity-determining region 3 (CDRL3) in the light-chain variable region having the sequence of Vκ3-20-2 (SEQ ID NO: 26) includes the range of Table 18,

    [0069] the amino acid ratio for each position in the light-chain complementarity-determining region 1 (CDRL1) in the light-chain variable region having the sequence of Vλ1-51 (SEQ ID NO: 31) includes the range of Table 20,

    [0070] the amino acid ratio for each position in the light-chain complementarity-determining region 2 (CDRL2) in the light-chain variable region having the sequence of Vλ1-51 (SEQ ID NO: 31) includes the range of Table 21, and

    [0071] the amino acid ratio for each position in the light-chain complementarity-determining region 3 (CDRL3) in the light-chain variable region having the sequence of Vλ1-51 (SEQ ID NO: 31) includes the range of Table 22.

    [0072] In particular, the set of antibodies or fragments thereof according to the present invention has one or more characteristics selected from i) to iv) below:

    [0073] i) redundancy (percentage of repetitive sequences) of 10% or less;

    [0074] ii) p-value of CDR composition >0.05;

    [0075] iii) thermal stability of 70° C. or higher; and

    [0076] iv) diversity (library size) of 10.sup.7 or more.

    [0077] As used herein, the term “antibody” means an immunoglobulin that is selected from the group consisting of IgA, IgE, IgM, IgD, IgY and IgG and is capable of specifically binding to a target antigen. It consists of two light chains and two heavy chains, and each chain includes a variable domain having a variable amino acid sequence and a constant domain having a constant amino acid sequence. An antigen-binding site is located at the end of the three-dimensional structure of the variable domain, and this site is formed by combining three complementarity-determining regions present in each of the light and heavy chains. The complementarity-determining region is a part having particularly high variability in an amino acid sequence among the variable domains, and antibodies specific for various antigens can be found due to this high variability. The scope of the present invention includes not only a complete antibody form, but also an antigen-binding fragment of the antibody molecule.

    [0078] The term “complete antibody” refers to a structure having two full-length light chains and two full-length heavy chains, wherein each light chain is linked to a corresponding heavy chain by a disulfide bond. The heavy-chain constant domain has gamma (γ), mu (μ), alpha (α), delta (δ) and epsilon (ε) types, and is subclassified into gamma 1 (γ1), gamma 2 (γ2), gamma 3 (γ3), gamma 4 (γ4), alpha 1 (α1) and alpha 2 (α2). The constant domain of the light chain has kappa (κ) and lambda (λ) types.

    [0079] The term “antigen-binding fragment” according to the present invention refers to a fragment of an antibody that has antigen-binding capacity, and includes Fab, Fab′, F(ab′).sub.2, scFv (scFv).sub.2, scFv-Fc, Fv and the like. In the present specification, the term “antigen-binding fragment” is used interchangeably with “antibody fragment”, and has the same meaning.

    [0080] Among the antibody fragments, Fab refers to a structure including a variable domain of each of the heavy chain and the light chain, the constant domain of the light chain, and the first constant domain (CH1) of the heavy chain, each having one antigen-binding site. Fab′ is different from Fab in that it further includes a hinge region including at least one cysteine residue at the C-terminus of the CH1 domain of the heavy chain. F(ab′).sub.2 is created by a disulfide bond between cysteine residues in the hinge region of Fab′. Fv is the minimal antibody fragment having only a heavy-chain variable domain and a light-chain variable domain, and recombinant technology for producing Fv is disclosed in PCT International Publications such as WO 88/10649, WO 88/106630, WO 88/07085, WO 88/07086 and WO 88/09344. A two-chain Fv is a fragment wherein the variable domain of the heavy chain and the variable domain of the light chain are linked by a non-covalent bond, and a single-chain Fv (scFv) is a fragment wherein the variable domain of the heavy chain and the variable domain of the light chain are generally linked by a covalent bond via a peptide linker therebetween, or are directly linked at the C-terminus, forming a dimer-shaped structure, like the two-chain Fv. Such antibody fragments may be obtained using proteases (e.g., Fab can be obtained by restriction-cleaving a whole antibody with papain, and the F(ab′).sub.2 fragment can be obtained by restriction-cleaving a whole antibody with pepsin), and may be produced using genetic recombination techniques.

    [0081] As used herein, the term “ScFv” (single-chain Fv, single-chain fragment antibody or antibody fragment) refers to an antibody in which the variable domains of the light and heavy chains are linked. In some cases, an ScFv may include a linker (linking site) consisting of a peptide chain having about 15 linked amino acids, and in this case, ScFv may have a structure including a light-chain variable domain, a linking site, and a heavy-chain variable domain, or including a heavy-chain variable domain, a linking site, and a light-chain variable domain, and has antigen specificity the same as or similar to that of the original antibody.

    [0082] As used herein, the term “antibody library” refers to a combination of various antibodies having different sequences, and means a set of a combination of specific heavy-chain variable-region and light-chain variable-region pairs in the present invention.

    [0083] Nucleic acids encoding individual antibodies or fragments thereof included in the antibody library are individually contained in separate phage or host cells, and the antibodies or fragments thereof preferably are each expressed (displayed) on the surfaces of the phages or host cells, but the present invention is not limited thereto.

    [0084] Examples of the host cells used for the surface expression (display) of the antibodies or fragments thereof according to the present invention include yeasts such as Escherichia coli, Saccharomyces cerevisiae, Pichia pastoris, and B cells of humans and mice, but are not limited thereto.

    [0085] The library according to the present invention may be referred to as a “Fab library” or “scFv library” depending on the type of antibody or fragment thereof that is expressed on the surface of the phage or host cell.

    [0086] In addition, as herein used, the term “antibody library” means not only a combination of specific heavy-chain variable-region and light-chain variable-region pairs at the protein level, but also combinations at the gene level encoding each specific heavy-chain variable-region and light-chain variable-region pair.

    [0087] In order to separate antibodies specific for an antigen from the antibody library, very high diversity is required, and a library consisting of different antibody clones is constructed and used. The antibody genes constituting such an antibody library may be cloned into, for example, a phagemid vector and transformed into a transformant (host cell like E. coli).

    [0088] As used herein, the term “nucleic acid” may be used interchangeably with “gene” or “nucleotide”, and may be, for example, selected from the group consisting of natural/synthetic DNA, genomic DNA, natural/synthetic RNA, cDNA and cRNA, but is not limited thereto.

    [0089] As used herein, the term “phagemid” vector refers to a plasmid DNA that is used for phage display and has a phage origin of replication, and generally has an antibiotic resistance gene as a selection marker. The phagemid vector used for phage display includes the gIII gene of the M13 phage or a portion thereof, and the ScFv gene is ligated to the 5′ end of the gIII gene and is expressed through a transformant.

    [0090] As used herein, the term “helper phage” refers to a phage that provides the necessary genetic information so that the phagemid is packaged into phage particles. Since only gIII of the phage genes or a portion thereof is present in the phagemid, host cells (transformants) transformed with the phagemid are infected with a helper phage to thereby supply the remaining phage genes. There are types such as M13K07 or VCSM13, and most thereof include antibiotic resistance genes such as kanamycin, so that transformants infected with the helper phage can be selected. In addition, because the packaging signal is defective, phagemid genes, rather than helper phage genes, are selectively packaged into phage particles.

    [0091] As used herein, the term “signal sequence” refers to a base sequence or an amino acid sequence corresponding thereto, which is located at the 5′ end of a gene and functions as a necessary signal when the protein encoded from the gene is secreted to the outside.

    [0092] As used herein, the term “phage display” is a technique for displaying a mutant polypeptide as a fusion protein with at least a part of a coat protein, for example, on the surface of the particle of a phage, for example, a fibrous phage. The usefulness of phage display is to rapidly and efficiently classify sequences that bind to target antigens with high affinity in large libraries of randomized protein mutants. Displaying peptides and protein libraries on phages has been used to screen millions of polypeptides in order to identify polypeptides with specific binding properties.

    [0093] Phage display technology has offered a powerful tool for generating and screening novel proteins that bind to specific ligands (e.g., antigens). Using phage display technology, large libraries of protein mutants can be produced and sequences binding with high affinity to target antigens can be rapidly classified. A nucleic acid encoding a mutant polypeptide is fused with a nucleic acid sequence encoding a viral coat protein, e.g., a gene III or gene VIII protein. A monophasic phage display system, in which a nucleic acid sequence encoding a protein or polypeptide is fused with a nucleic acid sequence encoding a part of the gene III protein, has been developed. In the monophasic display system, a fused gene is expressed at a low level and a wild-type gene III protein is also expressed, and thus particle infectivity is maintained.

    [0094] It is important to demonstrate the expression of peptides on the fibrous phage surface and the expression of functional antibody fragments in the peripheral cytoplasm of E. coli for the development of antibody phage display libraries. Libraries of antibody or antigen-binding polypeptides are prepared by a number of methods, for example, methods of modifying a single gene by inserting a random DNA sequence or cloning a related gene sequence. The libraries can be screened for the expression of antibody or antigen-binding proteins having desired characteristics.

    [0095] Phage display technology has several advantages over conventional hybridomas and recombinant methods for producing antibodies having desired characteristics. This technique provides the production of large antibody libraries with a variety of sequences within a short time without using animals. The production of hybridomas and the production of humanized antibodies may require a production time of several months. In addition, since no immunity is required, the phage antibody libraries is capable of producing antibodies against antigens that are unsensitized toxic or have low antigenicity. The phage antibody libraries can also be used to produce and identify novel therapeutic antibodies.

    [0096] Techniques for generating human antibodies from immunized humans, non-immunized humans, germline sequences, or unsensitized B-cell Ig repertoires using phage display libraries can be used. Various lymphatic tissues can be used to produce unsensitized or non-immunogenic antigen-binding libraries.

    [0097] Techniques for identifying and separating high-affinity antibodies from phage display libraries are important for the separation of new therapeutic antibodies. The separation of high-affinity antibodies from the libraries depends on the size of the libraries, the production efficiency in bacterial cells, and the variety of libraries. The size of the libraries is reduced by inappropriate folding of the antibody- or antigen-binding protein and inefficient production due to the presence of a stop codon. Expression in bacterial cells can be inhibited when the antibody- or antigen-binding domain is not properly folded. Expression can be improved by alternately mutating residues on the surface of the variable/constant interfaces or the selected CDR residues. The sequence of the framework region is an element for providing appropriate folding when producing antibody phage libraries in bacterial cells.

    [0098] It is important to generate various libraries of antibody- or antigen-binding proteins in the separation of high-affinity antibodies. CDR3 regions have often been found to participate in antigen binding. Since a CDR3 region on a heavy chain varies considerably in terms of size, sequence and structural/dimensional morphology, various libraries can be prepared using the same.

    [0099] Also, diversity can be created by randomizing the CDR regions of variable heavy and light chains using all 20 amino acids at each position. The use of all 20 amino acids results in antibody sequences with great diversity and an increased chance of identifying new antibodies.

    [0100] As used herein, the term “antibody variable domain” refers to the light- and heavy-chain regions of an antibody molecule including the amino acid sequences of a complementarity-determining region (CDR; i.e., CDR1, CDR2, and CDR3) and a framework region (FR). VH refers to a variable domain of a heavy chain. VL refers to a variable domain of a light chain.

    [0101] The term “complementarity-determining region” (CDR; i.e., CDR1, CDR2, and CDR3) refers to an amino acid residue of the antibody variable domain that is necessary for antigen binding. Each variable domain typically has three CDR regions, identified as CDR1, CDR2, and CDR3.

    [0102] The term “framework region” (FR) refers to a variable domain residue other than a CDR residue. Each variable domain typically has four FRs, identified as FR1, FR2, FR3, and FR4.

    [0103] Preferably, the set of antibodies or fragments thereof according to the present invention includes:

    [0104] a framework region included in a pair of heavy and light-chain variable regions selected from the group consisting of VH3-15 (SEQ ID NO: 1)/Vκ1-39 (SEQ ID NO: 16), VH3-15 (SEQ ID NO: 1)/Vκ3-20 (SEQ ID NO: 21), VH3-15 (SEQ ID NO: 1)/Vκ3-20-2 (SEQ ID NO: 26), VH3-15 (SEQ ID NO: 1)/Vλ1-51 (SEQ ID NO: 31), VH3-23 (SEQ ID NO: 6)/Vκ1-39 (SEQ ID NO: 16), VH3-23 (SEQ ID NO: 6)/Vκ3-20 (SEQ ID NO: 21), VH3-23 (SEQ ID NO: 6)/Vκ3-20-2 (SEQ ID NO: 26), VH3-23 (SEQ ID NO: 6)/Vλ1-51 (SEQ ID NO: 31), VH1-69 (SEQ ID NO: 11)/Vκ1-39 (SEQ ID NO: 16), VH1-69 (SEQ ID NO: 11)/Vκ3-20 (SEQ ID NO: 21), VH1-69 (SEQ ID NO: 11)/Vκ3-20-2 (SEQ ID NO: 26) and VH1-69 (SEQ ID NO: 11)/Vλ1-51 (SEQ ID NO: 31), and a combination of CDRH1, CDRH2 and CDRH3 different for each heavy-chain variable region, and a combination of CDRL1, CDRL2 and CDRL3 different for each light-chain variable region.

    [0105] In the present invention, the framework region in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1) includes FR1 (SEQ ID NO: 2), FR2 (SEQ ID NO: 3), FR3 (SEQ ID NO: 4) and FR4 (SEQ ID NO: 5),

    [0106] the framework region in the heavy-chain variable region having the sequence of VH3-23 (SEQ ID NO: 6) includes FR1 (SEQ ID NO: 7), FR2 (SEQ ID NO: 8), FR3 (SEQ ID NO: 9) and FR4 (SEQ ID NO: 10),

    [0107] the framework region in the heavy-chain variable region having the sequence of VH1-69 (SEQ ID NO: 11) includes FR1 (SEQ ID NO: 12), FR2 (SEQ ID NO: 13), FR3 (SEQ ID NO: 14) and FR4 (SEQ ID NO: 15),

    [0108] the framework region in the light-chain variable region having the sequence of Vκ1-39 (SEQ ID NO: 16) includes FR1 (SEQ ID NO: 17), FR2 (SEQ ID NO: 18), FR3 (SEQ ID NO: 19) and FR4 (SEQ ID NO: 20),

    [0109] the framework region in the light-chain variable region having the sequence of Vκ3-20 (SEQ ID NO: 21) includes FR1 (SEQ ID NO: 22), FR2 (SEQ ID NO: 23), FR3 (SEQ ID NO: 24) and FR4 (SEQ ID NO: 25),

    [0110] the framework region in the light-chain variable region having the sequence of Vκ3-20-2 (SEQ ID NO: 26) includes FR1 (SEQ ID NO: 27), FR2 (SEQ ID NO: 28), FR3 (SEQ ID NO: 29), and FR4 (SEQ ID NO: 30), and

    [0111] the framework region in the light-chain variable region having the sequence of Vλ1-51 (SEQ ID NO: 31) includes FR1 (SEQ ID NO: 32), FR2 (SEQ ID NO: 33), FR3 (SEQ ID NO: 34) and FR4 (SEQ ID NO: 35).

    [0112] The sequences of the heavy-chain variable region, the light-chain variable region, and the framework regions within each variable region of the present invention are summarized as follows:

    TABLE-US-00001 TABLE 1 Amino acid sequences of variable regions and framework regions SEQ ID Sequence information NO VH3-15 EVQLVESGGGLVKPGGSLRLSCAASG-X-WVRQAPGKGLEWV- 1 X- YAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR-X- WGQGTLVTVSS FR1 EVQLVESGGGLVKPGGSLRLSCAASG 2 FR2 WVRQAPGKGLEWV 3 FR3 YAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR 4 FR4 WGQGTLVTVSS 5 VH3-23 EVQLVESGGGLVQPGGSLRLSCAASG-X-WVRQAPGKGLEWV- 6 X- YADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR- X- WGQGTLVTVSS FR1 EVQLVESGGGLVQPGGSLRLSCAASG 7 FR2 WVRQAPGKGLEWV 8 FR3 YADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR 9 FR4 WGQGTLVTVSS 10 VH1-69 QVQLVQSGAEVKKPGSSVKVSCKASG-X- 11 WVRQAPGQGLEWM-X- YAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR-X- WGQGTLVTVSS FR1 QVQLVQSGAEVKKPGSSVKVSCKASG 12 FR2 WVRQAPGQGLEWM 13 FR3 YAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR 14 FR4 WGQGTLVTVSS 15 Vκ1-39 DIQMTQSPSSLSASVGDRVTITCRASQ-X- 16 WYQQKPGKAPKLLIY-X- GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQ-X- TFGQGTKVEIK FR1 DIQMTQSPSSLSASVGDRVTITCRASQ 17 FR2 WYQQKPGKAPKLLIY 18 FR3 GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQ 19 FR4 TFGQGTKVEIK 20 Vκ3-20 EIVLTQSPGTLSLSPGERATLSCRASQ-X-WYQQKPGQAPRLLI- 21 X- IPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQ-X- TFGQGTKVEIK FR1 EIVLTQSPGTLSLSPGERATLSCRASQ 22 FR2 WYQQKPGQAPRLLI 23 FR3 IPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQ 24 FR4 TFGQGTKVEIK 25 Vκ3-20-2 EIVLTQSPGTLSLSPGERATLSCRASQ-X-WYQQKPGQAPRLLI- 26 X- IPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQ-X- TFGQGTKVEIK FR1 EIVLTQSPGTLSLSPGERATLSCRASQ 27 FR2 WYQQKPGQAPRLLI 28 FR3 IPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQ 29 FR4 TFGQGTKVEIK 30 Vλ1-51 QSVLTQPPSVSAAPGQKVTISCSG-X-WYQQLPGTAPKLLI-X- 31 RPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYC-X- FGGGTKLTVL FR1 QSVLTQPPSVSAAPGQKVTISCSG 32 FR2 WYQQLPGTAPKLLI 33 FR3 RPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYC 34 FR4 FGGGTKLTVL 35

    TABLE-US-00002 TABLE 2 Sequences of nucleic acid encoding variable regions and framework regions SEQ ID Sequence information NO VH3-15 Gaagtgcaacttgtcgaatctggcggcggcttagtgaaaccaggcggcagccttcgtttaagctgtgc 36 agcatctggt-N-tgggttcgtcaggcaccaggtaaaggtcttgaatgggtg-N- tacgcagcaccggtcaaaggtcgttttacgattagtcgcgatgattcgaaaaacactctttacctgcaga tgaattctctgaaaacagaagataccgcagtgtattactgtgcacgt-N- tggggtcaaggtacactggttaccgttagctcg FR1 gaagtgcaacttgtcgaatctggcggcggcttagtgaaaccaggcggcagccttcgtttaagctgtgc 37 agcatctggt FR2 tgggttcgtcaggcaccaggtaaaggtcttgaatgggtg 38 FR3 tacgcagcaccggtcaaaggtcgttttacgattagtcgcgatgattcgaaaaacactctttacctgcaga 39 tgaattctctgaaaacagaagataccgcagtgtattactgtgcacgt FR4 tggggtcaaggtacactggttaccgttagctcg 40 VH3-23 Gaagtgcaacttgtcgaatctggcggcggcttagtgcagccaggcggcagccttcgtttaagctgtg 41 cagcatctggt-N-tgggttcgtcaggcaccaggtaaaggtcttgaatgggtg-N- tatgcggatagcgttaagggtcgttttaccatcagtcgcgacaactccaaaaataccctgtacttacaaa tgaatagcttacgtgcggaagataccgcagtgtattactgtgcacgt-N- tggggtcaaggtacactggttaccgttagctcg FR1 gaagtgcaacttgtcgaatctggcggcggcttagtgcagccaggcggcagccttcgtttaagctgtgc 42 agcatctggt FR2 tgggttcgtcaggcaccaggtaaaggtcttgaatgggtg 43 FR3 tatgcggatagcgttaagggtcgttttaccatcagtcgcgacaactccaaaaataccctgtacttacaaa 44 tgaatagcttacgtgcggaagataccgcagtgtattactgtgcacgt FR4 tggggtcaaggtacactggttaccgttagctcg 45 VH1-69 Caggtccaactggttcagtctggtgcggaagttaaaaagccaggaagttcagttaaagtcagttgtaa 46 agcgtctggt-N-tgggttcgtcaagcaccaggacagggcttagaatggatg-N- tatgcacagaaattccaaggtcgtgttacgattacggccgatgagtccactagtaccgcctatatggaa ctctccagccttcgctctgaagataccgcagtgtattactgtgcacgt-N- tggggtcaaggtacactggttaccgttagctcg FR1 caggtccaactggttcagtctggtgcggaagttaaaaagccaggaagttcagttaaagtcagttgtaaa 47 gcgtctggt FR2 tgggttcgtcaagcaccaggacagggcttagaatggatg 48 FR3 tatgcacagaaattccaaggtcgtgttacgattacggccgatgagtccactagtaccgcctatatggaa 49 ctctccagccttcgctctgaagataccgcagtgtattactgtgcacgt FR4 tggggtcaaggtacactggttaccgttagctcg 50 Vκ-39 Gacatccaaatgacacagagcccttcttccttatccgcgtcggtaggagatcgcgttacaatcacctgc 51 cgtgcgagtcag-N-tggtatcagcagaaaccagggaaagcaccgaagctcctgatttat-N- ggcgttccgagccgttttagtggctcggggtccggcaccgacttcaccctgactatctcttcgctgcag cctgaggattttgctacctattactgtcaacag-N-acattcgggcagggtaccaaagtggaaattaaa FR1 gacatccaaatgacacagagcccttcttccttatccgcgtcggtaggagatcgcgttacaatcacctgc 52 cgtgcgagtcag FR2 tggtatcagcagaaaccagggaaagcaccgaagctcctgatttat 53 FR3 ggcgttccgagccgttttagtggctcggggtccggcaccgacttcaccctgactatctcttcgctgcag 54 cctgaggattttgctacctattactgtcaacag FR4 acattcgggcagggtaccaaagtggaaattaaa 55 Vκ3-20 Gaaattgtactgacccaaagtcctgggacactgagtctgagtccaggtgaacgtgctacccttagctg 56 ccgtgcgagtcaa-N-tggtaccaacaaaagcctggtcaggcaccacgtctgctgatc-N- attccggaccgtttctctggctccggctcgggtactgattttaccctgactatctctcgtttagaacctgag gattttgctgtttattactgtcaacag-N-acattcgggcagggtaccaaagtggaaattaaa FR1 gaaattgtactgacccaaagtcctgggacactgagtctgagtccaggtgaacgtgctacccttagctgc 57 cgtgcgagtcaa FR2 tggtaccaacaaaagcctggtcaggcaccacgtctgctgatc 58 FR3 attccggaccgtttctctggctccggctcgggtactgattttaccctgactatctctcgtttagaacctgag 59 gattttgctgtttattactgtcaacag FR4 acattcgggcagggtaccaaagtggaaattaaa 60 Vκ3-20-2 Gaaattgtactgacccaaagtcctgggacactgagtctgagtccaggtgaacgtgctacccttagctg 61 ccgtgcgagtcaa-N-tggtaccaacaaaagcctggtcaggcaccacgtctgctgatc-N- attccggaccgtttctctggctccggctcgggtactgattttaccctgactatctctcgtttagaacctgag gattttgctgtttattactgtcaacag-N-acattcgggcagggtaccaaagtggaaattaaa FR1 gaaattgtactgacccaaagtcctgggacactgagtctgagtccaggtgaacgtgctacccttagctgc 62 cgtgcgagtcaa FR2 tggtaccaacaaaagcctggtcaggcaccacgtctgctgatc 63 FR3 attccggaccgtttctctggctccggctcgggtactgattttaccctgactatctctcgtttagaacctgag 64 gattttgctgtttattactgtcaacag FR4 acattcgggcagggtaccaaagtggaaattaaa 65 Vλ1-51 Caatcagttctgacccaacccccctctgtatccgcggcacccggtcaaaaggtgaccatctcgtgctc 66 tggc-N-tggtatcaacagcttccaggtacagcaccgaagttattgatt-N- cgtccttccggtattccggatcgtttttcggggagtaaaagtggcacctcagcaacacttggtattaccg gactgcagaccggcgacgaagccgattactactgc-N- ttcggtggtggcaccaaacttacggtcctg FR1 caatcagttctgacccaacccccctctgtatccgcggcacccggtcaaaaggtgaccatctcgtgctct 67 ggc FR2 tggtatcaacagcttccaggtacagcaccgaagttattgatt 68 FR3 cgtccttccggtattccggatcgtttttcggggagtaaaagtggcacctcagcaacacttggtattaccg 69 gactgcagaccggcgacgaagccgattactactgc FR4 ttcggtggtggcaccaaacttacggtcctg 70

    [0113] In the present invention, the antibody or fragment thereof may be characterized in that in that the complementarity-determining region (CDR) included in each variable region of the pair of the heavy-chain variable region and the light-chain variable region is designed to prevent occurrence of post-traditional modification through alteration of an amino acid that has the potential to undergo post-translational modification (PTM).

    [0114] In the present invention, the amino acid ratio for each position in the heavy-chain complementarity-determining region 1 (CDRH1) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1) includes the range of Table 3,

    [0115] the amino acid ratio for each position in the heavy-chain complementarity-determining region 2 (CDRH2) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1) includes the range of Table 4,

    [0116] the amino acid ratio for each position in the heavy-chain complementarity-determining region 1 (CDRH1) in the heavy-chain variable region having the sequence of VH3-23 (SEQ ID NO: 6) includes the range of Table 3,

    [0117] the amino acid ratio for each position in the heavy-chain complementarity-determining region 2 (CDRH2) in the heavy-chain variable region having the sequence of VH3-23 (SEQ ID NO: 6) includes the range of Table 4,

    [0118] the amino acid ratio for each position in the heavy-chain complementarity-determining region 1 (CDRH1) in the heavy-chain variable region having the sequence of VH1-69 (SEQ ID NO: 11) includes the range of Table 5,

    [0119] the amino acid ratio for each position in the heavy-chain complementarity-determining region 2 (CDRH2) in the heavy-chain variable region having the sequence of VH1-69 (SEQ ID NO: 11) includes the range of Table 6,

    [0120] when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 9 amino acids, the amino acid ratio for each position in the CDRH3 includes the range of Table 7,

    [0121] when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 10 amino acids, the amino acid ratio for each position in CDRH3 includes the range of Table 8,

    [0122] when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 11 amino acids, the amino acid ratio for each position in the CDRH3 includes the range of Table 9,

    [0123] when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 12 amino acids, the amino acid ratio for each position in CDRH3 includes the range of Table 10,

    [0124] when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 13 amino acids, the amino acid ratio for each position in CDRH3 includes the range of Table 11,

    [0125] when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 14 amino acids, the amino acid ratio for each position in CDRH3 includes the range of Table 12,

    [0126] the amino acid ratio for each position in the light-chain complementarity-determining region 1 (CDRL1) in the light-chain variable region having the sequence of Vκ1-39 (SEQ ID NO: 16) includes the range of Table 13,

    [0127] the amino acid ratio for each position in the light-chain complementarity-determining region 2 (CDRL2) in the light-chain variable region having the sequence of Vκ1-39 (SEQ ID NO: 16) includes the range of Table 14,

    [0128] the amino acid ratio for each position in the light-chain complementarity-determining region 3 (CDRL3) in the light-chain variable region having the sequence of Vκ1-39 (SEQ ID NO: 16) includes the range of Table 15,

    [0129] the amino acid ratio for each position in the light-chain complementarity-determining region 1 (CDRL1) in the light-chain variable region having the sequence of Vκ3-20 (SEQ ID NO: 21) includes the range of Table 16,

    [0130] the amino acid ratio for each position in the light-chain complementarity-determining region 2 (CDRL2) in the light-chain variable region having the sequence of Vκ3-20 (SEQ ID NO: 21) includes the range of Table 17,

    [0131] the amino acid ratio for each position in the light-chain complementarity-determining region 3 (CDRL3) in the light-chain variable region having the sequence of Vκ3-20 (SEQ ID NO: 21) includes the range of Table 18,

    [0132] the amino acid ratio for each position in the light-chain complementarity-determining region 1 (CDRL1) in the light-chain variable region having the sequence of Vκ3-20-2 (SEQ ID NO: 26) includes the range of Table 19,

    [0133] the amino acid ratio for each position in the light-chain complementarity-determining region 2 (CDRL2) in the light-chain variable region having the sequence of Vκ3-20-2 (SEQ ID NO: 26) includes the range of Table 17,

    [0134] the amino acid ratio for each position in the light-chain complementarity-determining region 3 (CDRL3) in the light-chain variable region having the sequence of Vκ3-20-2 (SEQ ID NO: 26) includes the range of Table 18,

    [0135] the amino acid ratio for each position in the light-chain complementarity-determining region 1 (CDRL1) in the light-chain variable region having the sequence of Vλ1-51 (SEQ ID NO: 31) includes the range of Table 20,

    [0136] the amino acid ratio for each position in the light-chain complementarity-determining region 2 (CDRL2) in the light-chain variable region having the sequence of Vλ1-51 (SEQ ID NO: 31) includes the range of Table 21, and

    [0137] the amino acid ratio for each position in the light-chain complementarity-determining region 3 (CDRL3) in the light-chain variable region having the sequence of Vλ1-51 (SEQ ID NO: 31) includes the range of Table 22, but is not limited thereto.

    TABLE-US-00003 TABLE 3 Amino acid distribution ratio for each position of amino acid(%) - VH3_CDR1 Type of AA 27 28 29 30 31 32 Alanine(A) 0-0.001   2-6 5-15    1-5      1-4 1-5      Serine(S) 20-30       0.1-0.5 0.01-0.1       0-0.001 0.01-0.1 0.01-0.1       Glycine(G) 0-0.001 0.5-3 0-0.001 1-5      10-20 0.5-2       Phenylalanine(F) 0-0.001  0.01-0.1 0-0.001 0.1-1       0.5-3  0-0.001 Proline(P) 60-70     0.5-3 80-90     0.1-1       0.5-3  3-8     Valine(V) 0.01-0.1       0.1-1 0.1-1        1-3        5-15 0-0.001 Tyrosine(Y) 0.01-0.1              0-0.001 0-0.001 0.5-3        1-3 5-15    Methionine(M) 0-0.001     5-12 0.1-1        1-4     0.5-3  0.3-2       Threonine(T) 0-0.001   1-5 0-0.001 0.5-3        1-5 5-15    Lysine(K) 1-4      0.01-0.1 2-6     1-4     0.3-2  3-8     Isoleucine(I) 0-0.001 0.5-2 0-0.001 0-0.001       0-0.001 0-0.001 Tryptophan(W) 0-0.001 0.1-1 0-0.001 10-20      20-30 3-9     Aspartic acid(D) 0-0.001 0.5-8 0-0.001 5-15     0.05-0.5 0.1-1       Histidine(H) 0-0.001    5-15 0-0.001 0.5-3       0.5-2  0.1-0.5     Asparagine(N) 5-15    0.5-3 0.01-0.1       1-5      1-4 0.1-1       Arginine(R) 0.1-1           5-15 0.1-1        30-40      15-25 2-7     Glutamic acid(E) 0-0.001   50-60 0.01-0.1       15-25       5-10 0.5-2       Cysteine(C) 0.01-0.1         0.01-0.05 0.05-0.5       0.1-1       0.1-2  0.1-0.5     Leucine(L) 0-0.001  0.05-0.1 0-0.001 0-0.001 0.01-0.1 0-0.001 Glutamine(Q) 0.05-0.3         2-6 0.01-0.1       0-0.001 0.5-3  45-55     Type of AA 33 34 35 Alanine(A)   20-30 0.01-0.1      1-5     Serine(S) 0.1-1 0-0.001 0.01-0.05     Glycine(G)   3-9 0.01-0.1      0.5-3       Phenylalanine(F) 0.5-3 0-0.001 5-15    Proline(P) 0.5-3 0.5-2      0-0.001 Valine(V)   15-25 0.1-0.5     1-5     Tyrosine(Y) 0.5-3 0-0.001 35-45     Methionine(M) 0.5-3 5-12    0.5-3       Threonine(T)  0.01-0.1 0-0.001 0-0.001 Lysine(K) 0.5-3 15-25    0.05-0.5      Isoleucine(I)        0-0.001 0-0.001 0-0.001 Tryptophan(W) 0.5-3 0-0.001 15-25     Aspartic acid(D) 0.5-3 0-0.001 0.1-1       Histidine(H)   0.1-0.5 0-0.001 1-4     Asparagine(N)   2-6 0.1-0.5     0.1-1       Arginine(R)   3-8 0.1-0.5     10-20     Glutamic acid(E)   1-4 0-0.001 1-4     Cysteine(C) 0.5-3 65-75    0.1-0.5     Leucine(L)   10-20 0-0.001 0-0.001 Glutamine(Q)     5-15 0.1-0.5     0.5-3      

    TABLE-US-00004 TABLE 4 Amino acid distribution ratio for each position of amino acid(%) - VH3_CDR2 Type of AA 49 50 51 52 52a 53 54 55 Alanine(A)  35-45  5-15 0-0.001 0.5-3 2-6  25-35     0-0.01   3-8 Serine(S)  50-60 10-20 0.01-0.1        55-65 15-25  3-9  20-30   30-40 Glycine(G)  1-4 10-20 0-0.001   1-4 10-20 0.01-0.1  70-80   10-20 Phenylalanine(F)      0-0.001 3-9 0-0.01   0.05-0.1 1-4 0.01-0.1      0-0.001 0.5-3 Proline(P) 0.01-0.1 0.01-0.05 0-0.001 0.1-1 1-4 0.01-0.1      0-0.001  0.01-0.1 Valine(V) 0.01-0.1 15-25 0.01-0.1           0-0.01 0.5-3   0.01-0.1  0.01-0.2    1-4 Tyrosine(Y)     0-0.01 15-25 0-0.01  0.5-3 10-20 0.01-0.1      0-0.001 0.5-3 Methionine(M)      0-0.001     0-0.01 0-0.01       0-0.01    0-0.01  1-4     0-0.01       0-0.01 Threonine(T) 0.01-0.1 3-8 0.1-0.5       2-6 1-5      0-0.01      0-0.001    5-10 Lysine(K)      0-0.001 0.1-1   0-0.001   15-25 1-4 0.1-1      0-0.01 0.5-2 Isoleucine(I)      0-0.001 1-4 95-99.98  0.1-1 0.5-3        0-0.01  0.01-0.05 0.5-3 Tryptophan(W)     0-0.01     0-0.001 0-0.001   3-9  5-15  50-60 0.01-0.1    0.01-0.05 Aspartic acid(D)     0-0.01 0.01-0.05 0-0.01         0-0.001 0.01-0.05 0.5-3  0.01-0.1     5-15 Histidine(H) 0.01-0.1 1-4 0-0.01  0.5-3 2-6 0.01-0.1      0-0.001 0.5-3 Asparagine(N)      0-0.001     0-0.01 0.01-0.05         0.01-0.005  4-10 0.3-2   0.01-0.05    5-15 Arginine(R) 0.01-0.1 0.05-2    0-0.001   1-4 0.5-3   0.5-2   0.01-0.05 0.5-1 Glutamic acid(E) 0.01-0.1     0-0.01 0-0.001  0.01-0.1 1-4      0-0.01     0-0.01   1-4 Cysteine(C)       0-0.001 0.01-0.05 0-0.001  0.01-0.1 0.01-0.1  0.01-0.1 0.01-0.1   0.01-0.05 Leucine(L) 0.01-0.1 3-8 0-0.03    1-3 1-4      0-0.01     0-0.01   1-4 Glutamine(Q) 0.01-0.1     0-0.01 0-0.001 0.5-2   5-12 0.5-3     0-0.01       0-0.01 Type of AA 56 57 58 59 60 Alanine(A) 1-5 0.5-3 1-4 0-0.001 95-99.99  Serine(S) 10-20 0.5-3 0.01-0.1  0-0.01  0-0.01  Glycine(G) 1-4      0-0.01 1-5 0-0.001 0-0.001 Phenylalanine(F) 0.5-2        0-0.01 3-9 0-0.01   0-0.0001 Proline(P) 0.1-1.5 0.1-1    0-0.01 0-0.001 0-0.01  Valine(V) 0.5-3   0.5-3 0.1-1   0-0.001 0.01-0.1      Tyrosine(Y) 3-9      0-0.01 55-65 95-99.99  0-0.001 Methionine(M)    0-0.01 0.5-3    0-0.01 0.01-0.1      0-0.001 Threonine(T)  5-15   20-30 0.01-0.1  0-0.001 0.01-0.1      Lysine(K) 2-6   30-40 0.5-3   0-0.001 0-0.001 Isoleucine(I) 1-5   20-30 0.1-2   0-0.01  0-0.501 Tryptophan(W)    0-0.01       0-0.001 0.5-2   0-0.001 0-0.001 Aspartic acid(D) 3-9      0-0.01 2-8 0-0.01  0-0.001 Histidine(H) 1-4   0.01-0.05  4-10 0.01-0.1       0-0.0051 Asparagine(N) 25-35  0.01-0.1  4-10 0-0.01  0-0.001 Arginine(R) 0.5-3   0.5-3 0.1-1   0-0.001 0.01-0.1      Glutamic acid(E)   5-12   3-8 0.5-3   0-0.001 0.01-0.1      Cysteine(C) 0.01-0.05      0-0.01 0.01-0.1  0.01-0.1      0.01-0.1      Leucine(L) 1-4   1-4 0.5-3   0.01-0.1      0-0.001 Glutamine(Q) 0.5-3     1-4 0.5-3   0-0.001 0-0.001

    TABLE-US-00005 TABLE 5 Amino acid distribution ratio for each position of amino acid(%) - VH1-69_CDR1 Type of AA 27 28 29 30 31 32 33 34 35 Alanine(A)      0-0.01   2-5 0-0.001 1-5 1-4 2-5   30-40 0.05-0.5 1-7 Serine(S) 0.5-3   10-20 0.05-0.5      40-50 20-30 4-8   3-6 0.01-0.1 10-20 Glycine(G)   2-6 0.1-1  0-0.001 1-4 1-4     0-0.001    5-15 0.5-3  1-5 Phenyl-   40-50  0.01-0.1 95-99.99  0.01-0.1  0.01-0.05 4-8 0.5-3 0.01-0.1 0.01-0.05 alanine(F) Proline(P)       0-0.001 0.5-3 0-0.01  0.5-3   0.01-0.05 0.01-0.05 0.5-3      0-0.01 0.01-0.1  Valine(V) 0.5-2  0.01-0.1 0.01-0.05     0.1-1  0.0-0.5 0.1-0.5 0.5-3  80-90 0.1-0.5 Tyrosine(Y)   30-40  0.01-0.1 0.01-0.05     0.01-0.05 0.5-2   55-68    5-15 0.01-0.1 0.5-3   Meth-       0-0.001 0.5-3 0-0.001     0-0.01    0-0.01    0-0.01     0-0.01       0-0.001     0-0.001 ionine(M) Threonine(T)  0.01-0.1   55-65 0.01-0.05     15-25  5-15 0.1-1     1-5   0.01-0.05 1-4 Lysine(K)  0.01-0.1   1-5 0-0.01  0.5-3   1-5 0.5-3         0-0.001      0-0.01 0.01-0.05 Isoleucine(I) 0.5-3    6-12 0.01-0.05     1-5 0.5-3   0.01-0.1  0.5-3  3-9 0.5-2   Trypto-       0-0.001        0-0.001 0-0.001      0-0.001      0-0.001    0-0.01   10-20      0-0.01     0-0.001 phan(W) Aspartic   1-5 0.5-3 0-0.001 3-7 10-20 0.5-3      4-10  0.01-0.05 0.5-3   acid(D) Histidine(H) 0.5-3  0.01-0.1 0-0.001 0.01-0.05 0.5-3    5-15 0.5-3      0-0.01 40-50 Aspara- 0.5-3   0.1-0.8 0-0.01  10-20 25-35  3-10 0.5-3 0.01-0.1 15-25 gine(N) Arginine(R)      0-0.01 0.5-3 0-0.001 1-4 1-4 0.1-1   0.1-1  0.1-0.5 0.1-0.5 Glutamic       0-0.001   0.01-0.05 0-0.001 0.1-1   1-4    0-0.01   1-4 0.01-0.1    0-0.01 acid(E) Cysteine(C)  0.01-0.1        0-0.001 0-0.01      0-0.01    0-0.01 0.01-0.1   0.01-0.1      0-0.01 0.01-0.05 Leucine(L)   1-4  0.01-0.1 0.05-0.5      0.05-0.5   0.01-0.1   0.5-3    0.01-0.1   4-10 0.01-0.05 Gluta-       0-0.001        0-0.001 0.01-0.05     0.01-0.1  0.01-0.05 0.01-0.05  0.01-0.1      0-0.01 0.5-3   mine(Q)

    TABLE-US-00006 TABLE 6 Amino acid distribution ratio for each position of amino acid(%) - VH1-69_CDR2 Type of AA 49 50 51 52 52a 53 54 Alanine(A) 35-45         3-10     0-0.001   0.1-0.8  5-15 0.5-3     1-5 Serine(S) 25-35         5-15 0.01-0.1    55-65 10-20 25-35   15-25 Glycine(G) 25-35         5-15     0-0.001 0.5-3  3-10 3-7   30-40 Phenylalanine(F) 0-0.01    1-5    0-0.01 0.1-1 1-4 0.5-2     1-7 Proline(P) 0-0.01        0-0.02     0-0.001   0.01-0.05 15-25 0.01-0.05   0.01-0.05 Valine(V) 0.01-0.1          5-12    0-0.01 0.5-3 0.5-3   0.5-3   0.5-3 Tyrosine(Y) 0-0.01     5-15 0.01-0.1  0.5-3  5-15 2-7 0.1-2 Methionine(M) 0-0.001 0.5-3    0-0.01        0-0.001    0-0.01 0.5-3         0-0.01 Threonine(T) 0.01-0.1         1-4    0-0.03   1-5 1-5 1-3   1-5 Lysine(K) 0-0.001 0.5-2     0-0.001    5-15 0.5-3   1-4 0.5-3 Isoleucine(I) 0-0.001   3-9    95-99.99    6-10 0.5-3   2-7 0.5-3 Tryptophan(W) 0-0.001   10-20     0-0.001   1-5 2-7    0-0.01   0.01-0.05 Aspartic acid(D) 0-0.01  0.5-3 0.01-0.05   1-5 1-5 30-40   2-7 Histidine(H) 0-0.01  0.5-3 0.01-0.05 0.5-3 2-7 1-4       0-0.01 Asparagine(N) 0-0.001    5-15    0-0.02   0.01-0.05 1-5 0.01-0.05   10-20 Arginine(R) 0-0.001 0.5-3    0-0.01 0.5-3 0.1-2  0.5-2   0.5-2 Glutamic acid(E) 0-0.01         0-0.001     0-0.001       0-0.05 1-4 1-4 0.5-3 Cysteine(C) 0.01-0.1        0.01-0.1     0-0.001        0-0.001 0.01-0.1  0.01-0.1      0.01-0.005 Leucine(L) 0.01-0.1         3-9 0.01-0.05   1-4 0.5-3   1-4   3-9 Glutamine(Q) 0-0.01        0-0.01     0-0.001 0.5-3 2-7    0-0.01       0-0.01 Type of AA 55 56 57 58 Alanine(A)   2-6   2-7    4-10 1-4 Serine(S)   25-35    5-15 0.5-3 2-6 Glycine(G)   30-40   1-5      0-0.01 1-5 Phenylalanine(F)   0.01-0.05 0.5-2      0-0.01 1-5 Proline(P)       0-0.01 0.1-1 0.5-3 0.01-0.05 Valine(V) 0.5-3   1-4 0.5-3 0.1-2   Tyrosine(Y) 0.5-3   2-8       0-0.001 25-35 Methionine(M)       0-0.01 0.1-2 0.5-3    0-0.01 Threonine(T)   3-8    5-15   30-40 0.5-3   Lysine(K) 0.5-3    3-10   25-35   5-15 Isoleucine(I) 0.5-3   2-6   15-25 1-4 Tryptophan(W)  0.01-0.1      0-0.01      0-0.01     0-0.001 Aspartic acid(D)    5-15    5-15      0-0.01 2-5 Histidine(H) 0.5-3   1-4  0.01-0.1 4-8 Asparagine(N)    4-10   25-35 0.5-3 15-25 Arginine(R) 0.5-3 0.5-3 0.5-3 0.5-3   Glutamic acid(E) 0.5-3    5-12       0-0.001 1-4 Cysteine(C)   0.01-0.05   0.01-0.05      0-0.01 0.01-0.1  Leucine(L)  0.05-0.1 0.5-3 0.5-3 0.5-3   Glutamine(Q)       0-0.01 0.5-3 0.5-3 0.5-3  

    TABLE-US-00007 TABLE 7 Amino acid distribution ratio for each position of amino acid(%) - VH_CDR3_9AA Type of AA 96 97 98 99 100 100a 100b 101 102 Alanine(A)   3-8 3-8 3-8  5-15  4-10 10-20 0.5-3 0.5-3 0.5-3   Serine(S)   1-5  6-12  5-15 10-20 10-20 10-20    4-10 0.5-3 1-5 Glycine(G)    5-15  5-15  5-15  5-12  5-15  5-15   1-5 0.5-3 0.1-0.5 Phenylalanine(F)   0.1-0.8 0.5-3   0.5-3   2-5 0.5-3   1-5   45-55   0.1-0.5 1-5 Proline(P) 0.5-3  5-15 1-5 0.5-3   0.1-1   2-6 0.5-3   0.1-0.5 0.5-3   Valine(V)   3-8 3-9 10-20 3-8 3-7 3-8    4-10   1-5  4-10 Tyrosine(Y) 0.5-3 2-7  4-10 15-25 15-25 15-25    5-12 0.5-3 60-70 Methionine(M)   0.01-0.05 1-4 1-4 0.1-1   0.1-1   0.1-0.5   1-5 0.5-3 0.5-3   Threonine(T)    5-15 2-6  4-10 3-9  5-15 3-8   2-5 0.5-3 0.5-3   Lysine(K) 0.5-3 0.5-3   1-4 1-5 0.5-3   0.5-3    0.01-0.1 0.1-1     0-0.001 Isoleucine(I) 0.5-3 1-5 0.5-3   1-4 1-4 3-8    5-12   2-6 1-5 Tryptophan(W) 0.5-3 3-9 1-4 0.5-3   0.5-3   0.5-3   0.1-1        0-0.001 0.01-0.1  Aspartic acid(D)   25-35 2-7 3-9  4-10  4-10  4-10 0.5-3   70-80 1-5 Histidine(H)   1-5 0.5-3   1-3 0.5-3   0.5-3   1-5 0.5-3   0.1-0.5 1-5 Asparagine(N) 0.5-3 1-5 2-6 2-6 3-8 0.5-3   0.5-3   1-4 0.5-3   Arginine(R)   1-4  4-10  5-15 1-5 1-4 1-4 0.1-1   0.1-0.5 0.1-0.5 Glutamic acid(E)    5-15 1-4 1-4 1-5 1-4 0.5-3   0.5-3   2-5 0.1-0.5 Cysteine(C)        0-0.001 0.01-0.05 0.01-0.05 0.01-0.1  0.01-0.1  0.01-0.05        0-0.001        0-0.001 0.01-0.05 Leucine(L)   1-4  5-15 1-5 0.5-2   0.5-3   0.5-3     1-4   0.1-0.5 0.5-3   Glutamine(Q)    5-15 2-6 0.5-3   0.5-2   0.5-3   0.1-1     0.1-0.5 0.5-3 0.1-1  

    TABLE-US-00008 TABLE 8 Amino acid distribution ratio for each position of amino acid(%) - VH_CDR3_10AA Type of AA 96 97 98 99 100 100a 100b 100c 101 102 Alanine(A)  5-15 3-9  4-10  4-10  5-15  4-10  5-15 1-4 0.5-3 0.5-3   Serine(S) 3-8  5-15 10-20 10-20 10-20  5-15  5-12 2-6 0.5-3 2-6 Glycine(G)  5-15  5-15  5-15 10-20  5-15 10-20 10-20 1-4   1-4 0.01-0.1  Phenylalanine(F) 0.1-0.5 1-4 0.5-3   1-5 1-4 1-4 0.5-3   25-35 0.1-1 2-6 Proline(P) 0.5-3   2-6 1-5 1-4 1-4 0.5-3   2-6 1-4 0.1-1 3-8 Valine(V) 2-6 2-6 2-6 2-6 2-5 0.5-3   1-4 1-4 0.5-3  5-12 Tyrosine(Y) 1-4 3-8  5-12  5-15  5-15 10-20 15-25 3-8 0.5-3 45-55 Methionine(M) 0.5-2   0.5-3   1-3 0.5-3   0.1-1   0.5-3   0.01-0.1  10-20  0.01-0.1 0.01-0.05 Threonine(T) 1-4 2-6 3-9 2-8 3-9 2-6 1-5 0.5-3   0.5-3 0.1-0.5 Lysine(K) 1-4 2-6 1-4 0.5-3   0.5-3   0.5-3   0.5-3   0.01-0.1    0.01-0.05     0-0.001 Isoleucine(I) 1-4 2-6 1-4 1-4 1-4 0.5-3   1-4 3-8  0.1-1  1-5 Tryptophan(W) 0.5-3   0.5-3   1-4 1-4 3-8 3-8 3-8 0.1-1     0.01-0.05 0.1-1   Aspartic acid(D) 25-35 3-8  4-10  4-10 3-9  4-10 3-8 1-4   75-85 1-5 Histidine(H) 1-5 2-6 1-4 0.5-3   1-4 1-4 1-5 0.01-0.1  0.5-3 3-8 Asparagine(N) 0.5-3   1-5 1-4 2-6 1-7  5-12 1-5 0.5-3   0.5-3 1-5 Arginine(R) 1-4 2-6 1-4 1-4 0.5-3   0.5-3   0.5-3   0.5-3   0.1-1 0.01-0.05 Glutamic acid(E)  5-15 1-5 2-5 1-4 1-4 1-4 1-4 0.5-3     1-4 0.01-0.05 Cysteine(C)      0-0.001 0.01-0.05 0.01-0.05 0.01-0.1  0.01-0.1  0.01-0.05 0.01-0.05     0-0.001   0.01-0.05 0.01-0.1  Leucine(L) 3-9 10-20  5-15  4-10  5-12 3-9  4-10 15-25   2-5  4-10 Glutamine(Q) 0.5-3   1-4 1-4 1-4 1-4 1-4 1-4 0.01-0.1    1-4     0-0.001

    TABLE-US-00009 TABLE 9 Amino acid distribution ratio for each position of amino acid(%) - VH_CDR3_11AA Type of AA 96 97 98 99 100 100a 100b Alanine(A)    5-12 3-9  4-10  5-12  5-15  5-15  4-10 Serine(S)   2-6  5-15  5-15 10-20 10-20  5-15  5-15 Glycine(G)    5-15  5-15  5-15 10-20  5-15  5-15  5-15 Phenylalanine(F) 0.1-1 1-4 0.5-3   1-4 0.5-3   1-4 1-4 Proline(P) 0.5-3 2-5 1-5 1-4 0.5-3   2-5 1-4 Valine(V)   2-6 2-6 2-6 3-8 2-5 2-5 2-5 Tyrosine(Y) 0.5-3 3-8  5-12  5-15  5-15  5-15 10-20 Methionine(M) 0.5-3 0.5-3   0.5-3   0.5-3   0.1-1   0.01-0.1  0.01-0.1  Threonine(T) 0.5-3 2-6 3-8 3-8 3-9 3-8 3-9 Lysine(K) 0.5-3 2-6 1-4 1-4 1-4 0.5-3   0.5-3   Isoleucine(I)   1-4 1-5 1-4 1-4 1-4 1-5 1-4 Tryptophan(W) 0.5-3 1-4 1-4 1-4 2-6 2-6 3-8 Aspartic acid(D)   25-35 3-8  4-10  4-10  4-10  4-10 3-8 Histidine(H)   1-4 2-6 1-4 0.5-3   1-4 1-4 1-6 Asparagine(N)   1-4 1-5 2-5 3-8 2-6 3-7 3-9 Arginine(R)   1-4 1-5 1-4 1-4 0.5-3   0.5-3   1-4 Glutamic acid(E)   10-20 1-5 2-6 1-4 1-4 1-4 1-4 Cysteine(C)   0.01-0.05 0.01-0.05      0-0.001      0-0.001 0.01-0.05 0.01-0.1  0.01-0.1  Leucine(L)   3-8 10-20  5-15 3-9  5-12   5-15  5-15 Glutamine(Q)   1-4 1-4 1-4 1-4 1-5 0.5-3   1-4 Type of AA 100c 100d 101 102 Alanine(A)  4-10 1-4   1-4 0.1-1   Serine(S)  5-12 2-5 0.5-3 3-8 Glycine(G)  5-15 1-4 0.5-3 0.5-3   Phenylalanine(F) 1-4 25-35   0.1-0.5 1-5 Proline(P) 2-5 1-4 0.5-3 1-5 Valine(V) 0.5-3   1-5 0.5-3  4-10 Tyrosine(Y) 15-25 1-5 0.5-3 45-55 Methionine(M) 0.5-3    5-15  0.05-0.2 0.01-0.1  Threonine(T) 2-6 0.5-3   0.1-1 0.5-3   Lysine(K) 1-4 0.01-0.05   0.01-0.05      0-0.001 Isoleucine(I) 1-4 3-8   0.1-0.5 1-5 Tryptophan(W) 3-8 0.5-3     0.01-0.05      0-0.001 Aspartic acid(D) 3-8 1-4   75-85 1-4 Histidine(H) 1-4 0.5-3     1-4  4-10 Asparagine(N) 3-8 1-4   1-4 2-6 Arginine(R) 1-4 0.5-3   0.5-2 0.01-0.1  Glutamic acid(E) 1-4 0.5-3     1-5 0.01-0.1  Cysteine(C) 0.01-0.1       0-0.001   0.01-0.05 0.01-0.1  Leucine(L)  5-15 20-30   1-4  5-12 Glutamine(Q) 0.5-3   0.5-3     1-4 0.5-3  

    TABLE-US-00010 TABLE 10 Amino acid distribution ratio for each position of amino acid(%) - VH_CDR3_12AA Type of AA 96 97 98 99 100 100a 100b Alanine(A)    4-10 3-9  4-10  5-12  4-10  5-15  4-10 Serine(S)   1-5   5-15  5-15 10-20  5-15  5-15  5-15 Glycine(G)   10-20   5-15  5-15 10-20  5-15  5-15  5-15 Phenylalanine(F) 0.1-1 1-4 0.5-3   1-4 1-4 1-5 1-4 Proline(P) 0.5-3 1-5 1-5 1-5 1-4 2-5 1-4 Valine(V)   1-5 2-6 2-6 2-6 2-5 2-5 2-5 Tyrosine(Y)   1-4 3-8  5-12  5-15  5-15  5-15 10-20 Methionine(M) 0.1-1 0.5-3   1-4 0.5-3   0.1-1   0.01-0.05 0.01-0.05 Threonine(T) 0.5-3 2-6 3-8 2-6 3-9 3-8 3-8 Lysine(K) 0.5-3 2-6 1-4 0.5-3   0.5-3   0.5-3   0.5-3   Isoleucine(I) 0.5-3 1-5 1-4 1-4 1-4 1-5 1-8 Tryptophan(W) 0.5-3 0.5-3   1-4 1-5 3-8 3-8 3-8 Aspartic acid(D)   35-45 2-6  4-10  4-10  4-10  5-12 3-9 Histidine(H)   1-5 2-6 1-4 0.5-3   1-4 1-4 1-5 Asparagine(N)   1-4 1-5 2-5 2-6 2-6 2-5 3-8 Arginine(R) 0.5-3 1-5 1-5 1-4 0.5-3   0.5-3   1-8 Glutamic acid(E)    5-15 1-4 2-5 2-5 1-5 1-4 1-8 Cysteine(C)        0-0.001 0.01-0.1  0.01-0.05 0.01-0.1  0.01-0.1  0.01-0.05 0.01-0.1  Leucine(L)   2-6 15-25  5-15  4-10  5-15  5-12  5-15 Glutamine(Q) 0.5-4 1-4 1-4 1-5 1-4 0.5-3   1-5 Type of AA 100c 100d 100e 101 102 Alanine(A)  4-10  5-15   1-4 0.5-3 0.1-1   Serine(S)  5-15 3-8   1-4 0.5-3 2-6 Glycine(G)  5-15  5-15 0.5-3 0.5-3 0.01-0.05 Phenylalanine(F) 1-4 1-4   30-40   0.1-0.5 1-4 Proline(P) 2-5 2-6 0.5-3 0.1-1 3-8 Valine(V) 0.5-3   1-4   1-4   0.1-0.5  5-15 Tyrosine(Y) 15-25 20-30   1-4 0.1-1 45-55 Methionine(M) 0.5-4   0.01-0.1    10-20  0.01-0.1 0.01-0.05 Threonine(T) 1-5 1-5 0.5-3 0.5-3 0.5-3   Lysine(K) 1-4 0.5-3         0-0.001   0.01-0.05      0-0.001 Isoleucine(I) 1-4 1-5   3-8 0.1-1 3-8 Tryptophan(W) 2-6 3-8 0.5-3       0-0.001 0.01-0.05 Aspartic acid(D) 2-6 2-5 0.5-3   75-85 0.5-3   Histidine(H) 1-6 1-5 0.5-3 0.5-3  4-10 Asparagine(N) 3-9 1-5 0.5-3   1-4 1-5 Arginine(R) 1-4 0.5-3   0.1-1 0.1-1 0.5-3   Glutamic acid(E) 1-4 1-4 0.5-2   1-4 0.01-0.1  Cysteine(C) 0.01-0.1  0.01-0.1    0.01-0.05   0.01-0.05 0.01-0.1  Leucine(L)  5-12  9-15   20-30 0.5-3  5-12 Glutamine(Q) 0.5-3   0.5-3         0-0.001   1-4 0.01-0.05

    TABLE-US-00011 TABLE 11 Amino acid distribution ratio for each position of amino acid(%) - VH_CDR3_13AA Type of AA 96 97 98 99 100 100a 100b 100c Alanine(A)    4-10 3-9 3-9  5-12  5-12  5-15  4-10  4-10 Serine(S)   1-5  5-15  5-15 10-20 10-20  5-15  5-15  5-15 Glycine(G)    5-15  5-15  5-15 10-20  5-15  5-15  5-12  5-15 Phenylalanine(F) 0.5-3 1-4 0.5-3   1-4 0.5-3   1-5 1-5 1-4 Proline(P) 0.5-3 2-6 2-5 1-4 1-4 2-5 1-5 2-6 Valine(V)   2-6 1-5 2-6 2-6 2-5 2-5 2-5 0.5-3   Tyrosine(Y) 0.5-3 3-8  5-12  5-15  5-15  5-15 10-20 15-25 Methionine(M) 0.1-1 0.5-3   1-4 0.5-3   0.1-1   0.01-0.05 0.01-0.05 0.5-3   Threonine(T) 0.5-3 2-6 3-8 2-6 3-9 3-8 3-8 2-6 Lysine(K) 0.5-3 2-6 1-4 1-4 1-4 0.5-3   0.5-3   0.5-3   Isoleucine(I) 0.5-3 2-6 1-4 1-4 1-5 1-4 1-4 1-4 Tryptophan(W) 0.5-3 1-4 1-4 2-5 2-6 2-6 3-8 2-6 Aspartic acid(D)   35-45 2-6  4-10  4-10  4-10  4-10 3-9 3-8 Histidine(H)   1-5 2-6 1-5 0.5-3   1-4 0.5-3   1-5 1-5 Asparagine(N) 0.5-3 1-4 1-5 2-6 3-8 3-8 3-9 3-9 Arginine(R) 0.5-3 2-5 1-4 1-4 0.5-3   0.5-3   1-5 1-4 Glutamic acid(E)    5-15 2-5 2-6 1-4 1-4 1-5 1-4 1-5 Cysteine(C)   0.01-0.05      0-0.001 0.01-0.05 0.01-0.1  0.01-0.05 0.01-0.05 0.01-0.05 0.01-0.1  Leucine(L)   2-6 10-20  5-15  4-10  5-15  5-12  5-15   5-12 Glutamine(Q)   1-4 1-4 1-4 1-4 1-4 0.5-3   1-5 0.5-8   Type of AA 100d 100e 100f 101 102 Alanine(A) 2-6  5-15   1-4 0.3-1 0.1-1 Serine(S)  5-15 3-8 0.5-3 0.5-3   1-5 Glycine(G)  4-10 10-20 0.5-3 0.5-3        0-0.001 Phenylalanine(F) 1-4 1-4   35-45 0.5-3   1-4 Proline(P) 1-5 3-8 0.5-3 0.1-1   3-9 Valine(V) 1-4 0.5-3     1-4 0.1-1   10-20 Tyrosine(Y) 20-30 25-35   2-5 0.1-1   40-50 Methionine(M) 0.01-0.05 0.01-0.1    15-25  0.01-0.1 0.5-3 Threonine(T) 1-5 1-4 0.5-3  0.01-0.1 0.1-1 Lysine(K) 0.5-3   0.01-0.05        0-0.001       0-0.001        0-0.001 Isoleucine(I) 1-5 0.5-3     2-6 0.1-1    4-10 Tryptophan(W) 1-5  4-10 0.1-1        0-0.001   0.01-0.05 Aspartic acid(D)  4-10 1-5 0.5-3   85-95 0.5-3 Histidine(H) 1-5 1-5 0.5-3 0.5-3   4-10 Asparagine(N)  4-10 1-5 0.5-3 0.1-1   1-4 Arginine(R) 0.5-3   0.5-3     0.01-0.05 0.1-1  0.01-0.1 Glutamic acid(E) 2-6 0.5-3   0.5-3 0.5-3   0.01-0.05 Cysteine(C) 0.01-0.05 0.02-0.2   0.01-0.1       0-0.001  0.01-0.1 Leucine(L)  5-15 3-8   15-25 0.5-3    5-12 Glutamine(Q) 0.5-3   0.5-3          0-0.001 0.5-3  0.01-0.1

    TABLE-US-00012 TABLE 12 Amino acid distribution ratio for each position of amino acid(%) - VH_CDR3_14AA Type of AA 96 97 98 99 100 100a 100b 100c 100d Alanine(A)    4-10 0.1-1  5-12  5-12  5-12  5-15  4-10  4-10 2-6 Serine(S)   2-6   2-6  5-15 10-20 10-20   5-15  5-15  5-15  5-15 Glycine(G)    5-15  0.05-0.5 10-20 10-20  5-15 10-20  5-15  5-15  5-12 Phenylalanine(F) 0.5-3   1-5 0.5-3   1-5 1-3 1-4 1-4 1-4 1-5 Proline(P) 0.5-3   3-8 1-4 1-4 1-4 1-5 1-4 2-6 1-4 Valine(V)   3-8   10-20 2-6 2-6 1-5 2-5 2-5 1-4 1-4 Tyrosine(Y) 0.1-1   40-50  4-10  5-15  5-15  5-15 10-20 15-25 20-30 Methionine(M) 0.1-1 0.5-3 1-4 0.5-3   0.1-1   0.01-0.05     0-0.001 0.5-3      0-0.001 Threonine(T) 0.5-3  0.05-0.5 3-8 2-6 3-9 3-8 3-8 1-5 1-5 Lysine(K) 0.5-3       0-0.001 1-4 1-4 0.5-3   0.5-3   1-4 1-4 0.5-3   Isoleucine(I) 0.5-3    4-10 1-4 1-5 1-4 2-5 1-4 1-5 1-5 Tryptophan(W) 0.1-1  0.05-0.5 1-4 1-5 3-8 3-8 3-8 2-6 1-5 Aspartic acid(D)   35-45 0.5-3  4-10  4-10  4-10  4-10 3-9 3-8 3-9 Histidine(H)   1-4    4-10 1-5 0.5-3   1-4 0.5-8   1-5 1-4 1-5 Asparagine(N)   1-4   1-4 1-5 2-6 3-8 3-8 3-9 3-8 3-9 Arginine(R) 0.5-3       0-0.001 1-4 1-4 0.5-3   0.5-3   1-5 1-5 1-4 Glutamic acid(E)    5-15  0.01-0.1 2-6 2-5 1-4 1-4 1-5 1-4 2-5 Cysteine(C)  0.01-0.1  0.05-0.5 0.01-0.05     0-0.001 0.01-0.1  0.01-0.05 0.01-0.05 0.01-0.05     0-0.001 Leucine(L)   3-8    4-10  5-15 3-9  5-12  5-15  5-15   5-15  5-15 Glutamine(Q) 0.5-3  0.01-0.1 1-4 1-4 1-3 0.5-3   1-5 0.5-3   0.5-3   Type of AA 100e 100f 100g 101 102 Alanine(A) 1-4  5-15 1-4 0.5-3 0.5-3 Serine(S)  5-12 1-5 1-4 0.1-1   2-6 Glycine(G)  5-15 10-20 0.3-2   0.5-8       0-0.001 Phenylalanine(F) 1-4 1-4 30-40 0.1-1 0.5-3 Proline(P) 1-4 3-8 0.5-3   0.5-3   3-9 Valine(V) 0.5-3   1-4 0.5-3   0.1-1   15-25 Tyrosine(Y) 25-35 25-35 1-4   0.01-0.05   35-45 Methionine(M) 0.5-3   0.5-3   20-30   0.01-0.05        0-0.001 Threonine(T) 1-5 0.5-3   0.1-1   0.3-3 0.1-1 Lysine(K) 0.5-3       0-0.001      0-0.001        0-0.001        0-0.001 Isoleucine(I) 0.5-3   0.5-3   1-5 0.1-1   2-6 Tryptophan(W) 2-6  5-12 0.1-0.5        0-0.001   0.01-0.05 Aspartic acid(D)  4-10 0.5-3   0.1-1     80-90 0.5-3 Histidine(H) 2-6 1-5 0.5-3   0.5-3    4-10 Asparagine(N)  5-15 1-5 0.1-1   0.5-3   1-4 Arginine(R) 0.5-3   0.5-3   0.01-0.1  0.1-1   0.01-0.05 Glutamic acid(E) 1-4 0.5-3   0.1-1     1-4        0-0.001 Cysteine(C) 0.01-0.1  0.01-1    0.01-0.1         0-0.001  0.01-0.1 Leucine(L) 2-6  4-10 15-25 0.5-3    5-15 Glutamine(Q) 0.5-3   0.1-1        0-0.001   1-4        0-0.001

    TABLE-US-00013 TABLE 13 Amino acid distribution ratio for each position of amino acid(%) - Vx1-39_CDR1 Type of AA 24 25 26 27 28 29 30 Alanine(A)  0-0.001 95-99.99  0-0.01  0-0.001 3-6 0-0.1   3-7     Serine(S) 90-95    0-0.05  95-99.99  0-0.03  33-38 0-0.05  30-40    Glycine(G) 4-8    0-0.05  0-0.1   0-0.001  8-12 0-0.001 4-10   Phenylalanine(F)  0-0.001 0-0.001 0-0.001 0-0.001 0.5-1.5 0-0.001 0-1     Proline(P)  0-0.001 0-0.01  0-0.001 0-0.001 0.5-1.5 0-0.001 0-0.05  Valine(V) 0-0.01  0-0.3   0-0.1   0-0.001 0.5-1.5 80-90     0-1     Tyrosine(Y)  0-0.001 0-0.001 0-0.001 0-0.001 0.5-1.5 0-0.09  1-4     Methionine(M) 0-0.03  0-0.001 0-0.001 0-0.001    0-0.05 0-0.001 0-0.001 Threonine(T)  0-0.001 0-0.05  0-0.001 0-0.01   6-10 0-0.001 3-7     Lysine(K) 0-0.01  0-0.001 0-0.001 0-0.01  0.4-1.0 0-0.01  1-5     Isoleucine(I) 0-0.05  0-0.001 0-0.08  0-0.001 0.5-1.5 10-15     1-5     Tryptophan(W)  0-0.001 0-0.001 0-0.001 0-0.001    0-0.01 0-0.001 0-0.001 Aspartic acid(D) 0-0.01  0-0.001 0-0.001 0-0.05  29-33 0-0.01  4-10    Histidine(H)  0-0.001 0-0.001 0-0.001 0-0.3   1.0-2.0 0-0.001 0.5-3      Asparagine(N) 0-0.05  0-0.001 0-0.08  0-0.001     0-0.005 0-0.001 20-25    Arginine(R) 0-0.3   0-0.1   0-0.05  93-96       0-1.0 0-0.03  2-6     Glutamic acid(E) 0-0.01  0-0.05  0-0.03  0-0.1      0-0.03 0-0.01  0.5-3      Cysteine(C) 0-0.03  0-0.01  0-0.001 0-0.001    0-0.05 0-0.03  0-0.01  Leucine(L)  0-0.001 0-0.001 0-0.001 0-0.8     0-0.1 1-5     1-3     Glutamine(Q) 0-0.01  0-0.001 0-0.001 1-5        0-0.03 0-0.01  0-0.01  Type of AA 31 32 33 34 Alanine(A) 0.5-3 0.5-3 0-0.01 40-45    Serine(S)   10-20    5-10 0-0.03 1-4    Glycine(G) 0.5-3 0.5-3 0-0.01 1-4    Phenylalanine(F) 0.1-2    5-10  0-0.001 0-0.01 Proline(P) 0.5-3      0-0.07 0-0.1  0-0.01 Valine(V)  0.05-0.3      0-0.05 0-0.03 0.5-2      Tyrosine(Y) 0.5-3   35-45 0-0.03 0-0.03 Methionine(M)   0.1-0.8       0-0.001  0-0.001  0-0.001 Threonine(T)    5-15     0-0.1 0-0.01 0-0.1  Lysine(K)    5-15      0-0.03 0-0.01 0-0.05 Isoleucine(I)   1-5       0-0.001 3-8     0-0.1  Tryptophan(W)       0-0.001   10-20  0-0.001  0-0.001 Aspartic acid(D)   3-8   3-8 0-0.01 0.5-1.5    Histidine(H)   1-4    5-10  0-0.001 1-3    Asparagine(N)   35-45   3-8  0-0.001 40-50    Arginine(R)   1-4 0.5-3  0-0.001 0-0.03 Glutamic acid(E) 0.1-2 0.5-3  0-0.001 0-0.05 Cysteine(C)      0-0.01     0-0.1  0-0.001  0-0.001 Leucine(L) 0.1-1   2-6 90-99.99  0-0.001 Glutamine(Q)      0-0.01 0.5-3  0-0.001  0-0.001

    TABLE-US-00014 TABLE 14 Amino acid distribution ratio for each position of amino acid (%)-V.sub.K1-39_CDR2 Type of AA 50 51 52 53 54 55 56 Alanine (A) 20~30 75~85 0~0.001 1~5 0~0.001 1~3 1~5 Serine (S) 5~10 1~5 0.01~0.1 20~30 0~0.001 0~0.03 60~70 Glycine (G) 3~8 0.5~3 0~0.001 0.1~1 0~0.001 0.5~3 2~6 Phenylalanine (F) 0.1~0.8 0~0.01 0~0.01 0.5~3 0.01~0.3 0.1~2 0.5~2 Proline (P) 0.1~0.5 0.5~2 0~0.001 0~0.01 0.05~0.3 0.1~2 0.5~2 Valine (V) 0.5~3 2~6 0~0.001 0.5~3 0.01~0.03 0.1~2 0.5~2 Tyrosine (Y) 0.5~3 0~0.01 0~0.001 1~3 0.01~0.03 0.5~3 0.1~1.5 Methionine (M) 0.5~3 0~0.001 0~0.001 0~0.001 0~0.01 0~0.03 0~0.03 Threonine (T) 2~6 4~9 3~7 15~25 0~0.01 0~0.01 5~15 Lysine (K) 15~25 0~0.01 0.01~0.1 1~5 0~0.001 1~5 0.1~1.5 Isoleucine (I) 0.5~3 0.5~3 0~0.03 3~8 0~0.01 0~0.01 1~3 Tryptophan (W) 1~3 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 0~0.01 Aspartic acid (D) 10~20 0~0.03 0~0.05 1~5 0~0.001 1~4 3~7 Histidine (H) 0.1~0.8 0~0.001 0~0.001 0.1~1 5~15 5~8 0~0.01 Asparagine (N) 0.01~0.03 0~0.001 90~99 20~30 0~0.03 0.5~3 0.5~3 Arginine (R) 0.5~3 0~0.01 0~0.001 0.5~3 0~0.03 0.5~2 0.5~3 Glutamic acid (E) 5~10 1~3 0~0.001 0.01~0.05 0~0.001 35~45 0~0.05 Cysteine (C) 0.01~0.08 0~0.03 0~0.001 0~0.01 0~0.001 0~0.01 0.01~0.1 Leucine (L) 0.5~3 0~0.001 0~0.001 0.1~1 85~95 1~3 1~5 Glutamine (Q) 0.5~3 0~0.01 0~0.001 0.01~0.03 0~0.001 33~42 0~0.001

    TABLE-US-00015 TABLE 15 Amino acid distribution ratio for each position of amino acid (%)-V.sub.K1-39_CDR3 Type of AA 89 90 91 92 93 94 95 96 Alanine (A) 0~0.001 0.01~0.03 2~6 0.5~1.5 1~5 8~15 0.01~00.5 0.1~1 Serine (S) 0~0.01 0.01~0.03 10~20 3~8 40~50 3~10 0.1~0.5 0.5~2 Glycine (G) 0.01~0.05 0~0.005 0.5~3 0.5~1.5 1~5 0.1~1.0 0~0.001 0.5~2 Phenylalanine (F) 0~0.001 0~0.001 1~4 2~6 0.5~1.5 5~13 0~0.001 3~9 Proline (P) 0.01~0.03 0.01~0.03 0.01~0.1 0.01~0.05 0.01~0.1 1~3 90~99.99 2~8 Valine (V) 0~0.001 0~0.001 0.5~2 0.1~0.5 0.5~1.5 1~4 0~0.001 0.5~3 Tyrosine (Y) 0~0.001 0~0.01 50~60 30~40 0.5~1.5 20~30 0~0.001 10~15 Methionine (M) 0~0.001 0~0.01 0~0.001 0~0.01 0~0.001 1~3 0~0.001 0.01~0.05 Threonine (T) 0~0.001 0~0.001 2~6 0.5~2 8~13 10~20 0.01~0.1 0.01~0.05 Lysine (K) 0~0.001 0.01~0.05 0.01~0.05 1~5 0.5~3 0~0.001 0~0.001 0.5~2 Isoleucine (I) 0~0.01 0~0.001 0.01~0.05 0.5~2 1~5 2~6 0~0.001 0.5~3 Tryptophan (W) 0.01~0.1 0~0.001 0~0.001 0~0.001 0~0.001 0.01~0.05 0~0.001 10~20 Aspartic acid (D) 0~0.001 0.1~0.5 1~4 5~15 3~8 0.5~2 0~0.001 0.1~1 Histidine (H) 0~0.001 6~12 6~10 3~9 0.5~2 1~3 0~0.001 1~4 Asparagine (N) 0~0.001 0~0.001 0.5~3 20~30 10~20 3~5 0~0.001 0.5~2 Arginine (R) 90~98 0.01~0.05 0.01~0.05 0.1~1.0 0.5~3 0.1~0.5 0.01~0.1 3~8 Glutamic acid (E) 0~0.001 1~4 0~0.01 0.5~3 0.5~3 0~0.001 0~0.001 0.1~1 Cysteine (C) 0~0.001 0~0.001 0.01~0.05 0.01~0.1 0.01~0.05 0.01~0.05 0~0.001 0.01~0.05 Leucine (L) 4~10 0.01~0.05 3~7 0.5~3 1~3 8~13 0.01~0.1 35~45 Glutamine (Q) 0.01~0.1 85~95 0~0.01 0.1~1.0 0.01~0.05 0~0.001 0.01~0.1 1~5

    TABLE-US-00016 TABLE 16 Amino acid distribution ratio for each position of amino acid (%)-V.sub.K3-20_CDR1 Type of AA 3 4 5 6 7 8 9 10 11 12 13 14 Alanine (A) 0~0.001 95~99.99 0~0.001 0~0.001 0.5~2 0.5~2 0~0.001 0~0.001 0~0.001 0~0.01 0~0.001 95~99.99 Serine (S) 90~99.99 0.01~0.05 95~99.99 0.1~0.5 65~75 0.01~0.1 0~0.001 0~0.001 0~0.001 5~15 0.05~0.5 0.01~0.1 Glycine (G) 2~10 0.01~0.05 0.05~0.5 0~0.001 0.01~0.1 0~0.01 0~0.001 0~0.001 0~0.001 0~0.05 80~90 0~0.01 Phenylalanine (F) 0~0.001 0~0.001 0~0.001 0~0.001 0.5~2 1~3 0~0.001 0~0.001 0~0.001 5~15 0~0.01 0~0.001 Proline (P) 0~0.001 0~0.001 0~0.001 0.01~0.1 0.1~0.1 0.01~0.1 0~0.001 0~0.001 0~0.001 0.01~0.1 0~0.001 0~0.05 Valine (V) 0.01~0.05 0.01~0.1 0.01~0.1 0~0.01 0.05~0.5 50~60 0~0.001 0~0.001 0~0.001 0~0.001 2~8 0.01~0.1 Tyrosine (Y) 0.005~0.03 0~0.001 0.01~0.1 0~0.001 0.5~2 0.01~0.1 0~0.001 0~0.001 0~0.001 55~65 0~0.001 0~0.001 Methionine (M) 0.005~0.03 0~0.001 0~0.001 0~0.001 0~0.001 0.5~1.5 0~0.001 0~0.001 0~0.001 0.01~0.1 0~0.05 0~0.001 Threonine (T) 0~0.001 0.01~0.1 0~0.01 0~0.05 5~15 0.01~0.05 0~0.001 0~0.001 0~0.001 0.01~0.1 0~0.001 0.01~0.1 Lysine (K) 0.01~0.05 0~0.001 0~0.001 2~8 0~0.05 0~0.001 0~0.001 0~0.001 0~0.001 0.5~2 0~0.001 0~0.001 Isoleucine (I) 0~0.01 0~0.001 0.01~0.1 0~0.001 1~5 20~30 0~0.001 0~0.001 0~0.001 0~0.001 0~0.01 0~0.001 Tryptophan (W) 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 0~0.05 0~0.001 0~0.001 0~0.001 0.5~1.5 0~0.001 0~0.001 Aspartic acid (D) 0~0.001 0~0.001 0~0.001 0~0.001 0.5~2 0~0.01 0~0.001 0~0.001 0~0.001 1~4 4~10 0~0.001 Histidine (H) 0~0.001 0~0.001 0~0.001 2~8 0.3~1.5 0~0.001 0~0.001 0~0.001 0~0.001 3~9 0~0.01 0~0.001 Asparagine (N) 0.01~0.1 0~0.001 0.01~0.1 0.1~1.0 3~9 0~0.01 0~0.001 0~0.001 0~0.001 3~9 0~0.05 0~0.001 Arginine (R) 0.01~0.1 0.01~0.1 0.01~0.1 0.05~0.5 0.5~2 0.01~0.05 0~0.001 0~0.001 0~0.001 0.1~1 0.05~0.5 0.01~0.1 Glutamic acid (E) 0.01~0.1 0~0.01 0.01~0.1 0~0.05 0~0.05 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 0~0.01 0.01~0.1 Cysteine (C) 0.01~0.05 0.01~0.1 0.01~0.1 0~0.001 0~0.05 0.01~0.1 0~0.001 0~0.001 0~0.001 0.01~0.1 0.01~0.1 0~0.01 Leucine (L) 0~0.001 0~0.001 0~0.001 0~0.05 0.01~0.5 10~20 0~0.001 0~0.001 0~0.001 0.5~3 0~0.05 0.01~0.1 Glutamine (Q) 0~0.01 0~0.001 0~0.001 85~95 0~0.001 0~0.01 0~0.001 0~0.001 0~0.001 0.5~3 0~0.001 0.01~0.1

    TABLE-US-00017 TABLE 17 Amino acid distribution ratio for each position of amino acid (%)-V.sub.K3-20 & 20-2_CDR2 Type of AA 3 4 5 6 7 8 9 10 11 Alanine (A) 0~0.001 5~15 70~80 0.5~2 0.5~3 0~0.001 90~99.99 60~70 0.01~0.05 Serine (S) 3~9 3~8 2~7 80~90 20~30 0.01~0.1 0.01~0.5 5~10 0~0.01 Glycine (G) 0~0.01 25~35 0.5~2 0~0.01 0.5~2 0.01~0.1 0~0.01 0~0.001 3~8 Phenylalanine (F) 4~10 0.01~0.05 0.01~0.1 2~7 0.5~2 0~0.001 0~0.01 0~0.01 0~0.001 Proline (P) 0.01~0.1 0.01~0.05 0.1~1 0.1~1 0.01~0.05 0.01~0.1 0~0.01 5~15 0~0.001 Valine (V) 0~0.001 0.5.~1.5 2~6 0.5~1.5 0.1~1 0.01~0.1 1~3 0.01~0.05 0~0.01 Tyrosine (Y) 65~75 0.1~1 0.01~0.1 1~3 0.5~2 0~0.001 0~0.001 0~0.001 0.01~0.05 Methionine (M) 0~0.001 0~0.001 0~0.001 0~0.001 0.1~2 0~0.001 0~0.001 0~0.001 0~0.001 Threonine (T) 0.01~0.1 0.5~3 5~15 1~4 10~20 0~0.01 0.01~0.1 10~20 0~0.01 Lysine (K) 0~0.01 0~0.01 0~0.001 0~0.001 4~10 0~0.001 0~0.001 0~0.001 0~0.001 Isoleucine (I) 0~0.001 0~0.01 1~4 0.5~1.5 2~7 0~0.001 0~0.001 0~0.01 0~0.001 Tryptophan (W) 0~0.001 0~0.01 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 Aspartic acid (D) 0~0.001 35~45 0.01~0.1 0~0.001 1~4 0~0.001 00.1~0.05 0.01~0.05 88~98 Histidine (H) 0~0.001 0.5~3 0.01~0.1 0.1~0.8 1~4 0.01~0.1 0~0.001 0~0.001 0~0.01 Asparagine (N) 0~0.001 1~4 0.01~0.1 0.1~0.8 30~40 0~0.001 0~0.001 0~0.001 0.01~0.05 Arginine (R) 0~0.001 0.5~2 0~0.01 0~0.01 1~4 95~99.99 0~0.01 0~0.001 0~0.001 Glutamic acid (E) 0~0.001 1~5 0.5~2 0~0.01 0~0.01 0~0.001 0~0.001 0~0.001 0.01~0.05 Cysteine (C) 0~0.001 0.01~0.1 0.01~0.1 0~0.05 0~0.01 0.01~0.2 0.01~0.05 0.01~0.05 0~0.001 Leucine (L) 0~0.001 0.5~2 0.5~1.5 0.5~2 0.5~2 0.01~0.2 0.01~0.05 0.01~0.05 0~0.001 Glutamine (Q) 0~0.001 0.01~0.1 0.10~0.1 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001

    TABLE-US-00018 TABLE 18 Amino acid distribution ratio for each position of amino acid (%)-V.sub.K3-20 & 20-2_CDR3 Type of AA 4 5 6 7 8 9 10 11 Alanine (A) 0~0.001 0.01~0.05 4~10 2~6 1~3 3~8 0.01~0.05 0.1~0.5 Serine (S) 0~0.01 0.01~0.05 4~10 8~18 20~30 30~40 0.05~0.3 0.5~2 Glycine (G) 0~0.01 0~0.001 1~4 10~20 2~4 0.1~1 0~0.001 0.5~2 Phenylalanine (F) 0~0.001 0~0.001 2~5 0.5~2 0.1~1 0.5~3 0~0.001 2~7 Proline (P) 0~0.001 0~0.001 0.01~0.1 0.01~0.1 0.01~0.1 1~4 95~99.99 2~7 Valine (V) 0~0.001 0~0.001 0.1~0.5 0.5~2 0.1~1 0.1~1 0~0.001 0.5~3 Tyrosine (Y) 0~0.001 0~0.01 55~65 10~20 0.5~3 1~5 0~0.001 5~15 Methionine (M) 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 0~0.01 Threonine (T) 0~0.001 0~0.001 0.5~2 2~6 4~10 6~15 0.01~0.05 0.01~0.05 Lysine (K) 0~0.001 0~0.02 0.01~0.05 0.5~2 1~4 0~0.001 0~0.001 0.1~1 Isoleucine (I) 0~0.001 0~0.001 0.01~0.05 1~3 1~4 0.5~3 0~0.001 0.5~2 Tryptophan (W) 0.05~0.5 0~0.001 0.1~0.5 0~0.02 0~0.001 20~30 0~0.001 10~20 Aspartic acid (D) 0~0.001 0~0.001 0.5~2 4~10 3~10 0.01~0.05 0~0.001 0.1~1 Histidine (H) 0~0.001 5~15 2~6 1~5 3~8 0~0.01 0~0.001 1~5 Asparagine (N) 0~0.001 0~0.001 0.5~2 10~20 20~30 0.5~3 0~0.001 0.1~1 Arginine (R) 88~98 0.03~0.3 4~8 0.1~1 0.5~3 0.1~1 0.02~0.1 3~9 Glutamic acid (E) 0~0.001 0~0.01 0~0.02 0.5~3 0.5~3 0~0.001 0~0.001 0.1~1 Cysteine (C) 0~0.001 0~0.001 0.1~0.5 0.01~0.05 0.01~0.05 0~0.01 0~0.001 0.01~0.1 Leucine (L) 2~5 0~0.05 0.5~2 5~15 1~3 5~10 0.05~0.5 38~48 Glutamine (Q) 0.01~0.1 85~95 0.01~0.1 0~0.01 6~10 0~0.001 0.05~0.5 1~6

    TABLE-US-00019 TABLE 19 Amino acid distribution ratio for each position of amino acid (%)-V.sub.K3-20-2_CDR1 Type of AA 3 4 5 6 7 8 9 10 11 12 Alanine (A) 0~0.001 95~99.99 0~0.001 0~0.001 0.5~3 0.5~3 2~6 0.5~2 0.1~1 0.01~0.1 Serine (S) 90~99.99 0.01~0.1 95~99.99 0.01~0.1 60~70 0.1~1 30~40 25~35 4~10 0.01~0.1 Glycine (G) 3~9 0.01~0.1 0.01~0.1 0~0.01 1~4 0~0.01 6~15 1~4 0.1~0.5 80~90 Phenylalanine (F) 0~0.001 0~0.001 0~0.001 0~0.001 0.01~0.1 0.5~3 0.1~1 0.5~2 3~6 0~0.01 Proline (P) 0~0.001 0~0.01 0~0.001 0.01~0.1 0.1~1 0~0.01 0.01~0.1 0.1~1 0.01~0.05 0~0.001 Valine (V) 0.01~0.05 0.01~0.1 0.01~0.1 0~0.01 0.01~0.1 40~50 0.5~2 0.5~2 0~0.001 2~7 Tyrosine (Y) 0~0.001 0~0.001 0~0.001 0~0.01 0.5~3 0.01~0.1 0.5~3 1~4 20~30 0~0.01 Methionine (M) 0.01~0.05 0~0.001 0~0.001 0~0.001 0~0.001 0~0.01 0~0.01 0~0.01 0~0.01 0~0.01 Threonine (T) 0~0.01 0.01~0.1 0~0.01 0~0.01 3~8 0.01~0.1 3~8 10~20 0.5~2 0~0.01 Lysine (K) 0~0.01 0~0.001 0~0.01 0~0.01 0.01~0.05 0~0.001 0.5~3 2~5 2~6 0~0.001 Isoleucine (I) 0.01~0.05 0~0.001 0.01~0.1 0~0.01 0.5~2 30~40 1~4 3~7 0.01~0.05 0~00.1 Tryptophan (W) 0~0.001 0~0.01 0~0.001 0~0.001 0~0.001 0~0.01 0~0.01 0~0.01 0.5~2 0~0.001 Aspartic acid (D) 0~0.01 0~0.001 0~0.001 0.01~0.1 1~4 0~0.01 3~10 2~5 2~6 4~10 Histidine (H) 0~0.001 0~0.001 0~0.001 0~0.001 0~0.01 0.01~0.1 0.5~2 0.5~2 3~7 0~0.001 Asparagine (N) 0.05~0.1 0~0.001 0.01~0.1 0~0.01 10~20 0.01~0.1 15~25 25~35 35~45 0~0.01 Arginine (R) 0.01~0.1 0.01~0.1 0.01~0.1 90~99.99 0.5~3 0.01~0.1 2~5 1~5 0.1~1 0.01~0.1 Glutamic acid (E) 0.01~0.1 0.01~0.1 0.01~0.1 0.01~0.1 0~0.01 0~0.01 0.5~3 0~0.01 0.5~2 0.01~0.1 Cysteine (C) 0~0.01 0.01~0.1 0~0.01 0~0.01 0.01~0.1 0.01~0.1 0.01~0.05 0.01~0.05 0.01~0.1 0.01~0.1 Leucine (L) 0~0.001 0~0.001 0~0.001 0.01~0.1 0.1~0.5 10~20 1~4 0.05~0.1 1~4 0.1~1 Glutamine (Q) 0~0.01 0~0.001 0~0.001 2~7 0~0.01 0~0.01 0.01~0.05 0.01~0.05 0.5~2 0~0.001

    TABLE-US-00020 TABLE 20 Amino acid distribution ratio for each position of amino acid (%)-Vλ1-51_CDR1 Type of AA 3 4 5 6 7 8 9 Alanine (A) 0~0.01 0.01~0.1 0.5~3 1~3 0.01~0.1 0~0.001 0.1~0.5 Serine (S) 95~99.99 0.01~0.1 75~85 45~55 95~99.99 0.01~0.1 0.01~0.1 Glycine (G) 0~0.001 95~99.99 4~10 2~7 0~0.001 0~0.001 0.01~0.1 Phenylalanine (F) 0.1~0.1 0~0.001 0.01~0.1 0.1~1.5 0.1~0.5 0~0.001 0.01~0.1 Proline (P) 0.~0.5 0~0.001 0.1~0.5 0.01~0.1 0.01~0.1 0~0.001 0~0.001 Valine (V) 0~0.001 0.01~0.1 0.01~0.1 0.01~0.1 0~0.001 0~0.001 85~95 Tyrosine (Y) 0.01~0.05 0~0.001 0.01~0.1 0.5~2 0.01~0.1 0~0.01 0.01~0.1 Methionine (M) 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 0.1~0.5 0~0.001 Threonine (T) 0.01~0.05 0~0.001 3~9 6~15 0~0.01 0.01~0.1 0~0.001 Lysine (K) 0~0.001 0~0.001 0~0.01 0.5~3 0~0.001 0.01~0.1 0~0.001 Isoleucine (I) 0~0.001 0~0.001 0.5~3 0.5~3 0~0.01 0.01~0.1 5~15 Tryptophan (W) 0~0.001 0.01~0.1 0~0.001 0~0.01 0~0.001 0~0.001 0~0.001 Aspartic acid (D) 0~0.001 0.01~0.1 0.5~3 1~4 0~0.001 0~0.01 0~0.001 Histidine (H) 0~0.001 0~0.001 0~0.01 0.5~3 0~0.001 0~0.001 0~0.001 Asparagine (N) 0~0.001 0~0.001 0.5~3 15~25 0~0.001 95~99.99 0~0.001 Arginine (R) 0~0.001 0.01~0.1 0.5~3 1~4 0~0.001 0~0.001 0~0.001 Glutamic acid (E) 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 Cysteine (C) 0.01~0.1 0.01~0.1 0~0.01 0~0.01 0.01~0.1 0~0.01 0.1~0.5 Leucine (L) 0.01~0.1 0~0.001 0.1~0.5 0.01~0.5 0.1~0.5 0~0.001 0.1~0.5 Glutamine (Q) 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 Type of AA 10 11 12 13 14 15 Alanine (A) 3~8 0.5~3 0~0.001 4~10 0.01~0.5 1~4 Serine (S) 0~0.01 25~35 1~5 5~15 0~0.001 30~40 Glycine (G) 2~5 1~4 0.1~1 0.1~1 0~0.001 0~0.001 Phenylalanine (F) 0~0.001 0.01~0.1 0.5~2 5~15 0~0.001 0.5~3 Proline (P) 0~0.001 0.1~0.5 0.01~0.1 1~6 0~0.001 0.01~0.1 Valine (V) 0~0.001 0.3~1 0~0.001 0.5~3 95~99.99 0~0.01 Tyrosine (Y) 0~0.001 1~3 2~6 25~35 0~0.001 10~20 Methionine (M) 0~0.001 0~0.001 0~0.001 0~0.001 0.01~0.5 0~0.001 Threonine (T) 0~0.001 4~10 0.5~3 10~20 0~0.001 0.5~3 Lysine (K) 0.05~0.5 2~6 2~5 0~0.001 0~0.001 0.1~2 Isoleucine (I) 0~0.01 2~6 0.1~3 1~5 0~0.001 0~0.001 Tryptophan (W) 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 Aspartic acid (D) 0.01~0.1 4~10 0.5~3 2~6 0~0.001 0.5~3 Histidine (H) 0~0.001 0.5~3 3~7 3~7 0~0.001 2~6 Asparagine (N) 0.01~0.1 30~40 70~80 2~6 0~0.001 30~40 Arginine (R) 0~0.001 1~5 0.3~2 0.1~1 0.01~0.1 0.01~0.05 Glutamic acid (E) 85~95 0.5~1.5 0.5~3 0~0.01 0~0.001 0.01~0.05 Cysteine (C) 0.01~0.1 0~0.001 0~0.001 0.01~0.1 0.01~0.1 0.01~0.05 Leucine (L) 0~0.001 0.5~3 0~0.001 1~4 0.01~0.1 0.1~1 Glutamine (Q) 0~0.001 0~0.001 0.3~2 0~0.01 0~0.001 0.5~2

    TABLE-US-00021 TABLE 21 Amino acid distribution ratio for each position of amino acid (%)-Vλ1-51_CDR2 Type of AA 49 50 51 52 53 54 55 56 Alanine (A) 0~0.001 4~10 0~0.001 0.1~1 0~0.001 0~0.001 0~0.001 0~0.001 Serine (S) 1~5 5~15 2~6 4~12 0.5~3 0~0.001 0~0.001 95~100 Glycine (G) 0~0.001 5~15 0.1~1 0.5~2 0~0.001 0~0.001 0~0.001 0~0.001 Phenylalanine (F) 5~15 0.1~1.5 0.1~2 0.5~2 0~0.001 0~0.001 0~0.001 0~0.001 Proline (P) 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 95~100 0~0.001 Valine (V) 0~0.001 0.1~1.5 0.5~4 0.1~2 0.1~1 0~0.001 0~0.001 0~0.001 Tyrosine (Y) 70~80 1~4 0.5~3 1~5 0.5~3 0~0.001 0~0.001 0~0.001 Methionine (M) 0~0.001 0.5~2 0~0.001 0~0.001 0.5~3 0~0.001 0~0.001 0~0.001 Threonine (T) 0~0.001 1~5 2~7 5~12 0~0.001 0~0.001 0~0.001 0~0.001 Lysine (K) 0~0.001 1~5 0.1~2 1~4 15~25 0~0.001 0~0.001 0~0.001 Isoleucine (I) 0~0.001 0.5~3 0.5~2 2~5 1~3 0~0.001 0~0.001 0~0.001 Tryptophan (W) 0~0.001 0.1~2 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 Aspartic acid (D) 0.1~2 20~30 10~20 10~20 0.5~4 0~0.001 0~0.001 0~0.001 Histidine (H) 2~7 0.5~2 0.5~2 1~5 1~7 0~0.001 0~0.001 0~0.001 Asparagine (N) 0.5~2 10~15 60~70 45~55 15~25 0~0.001 0~0.001 0~0.001 Arginine (R) 0.1~2 1~5 0.1~1 0.5~2 1~4 95~100 0~0.001 0~0.001 Glutamic acid (E) 0~0.001 5~15 0~0.001 0.5~2 2~8 0~0.001 0~0.001 0~0.001 Cysteine (C) 0.05~0.5 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 Leucine (L) 0.5~2 0.5~3 0~0.001 0~0.001 3~9 0~0.001 0~0.001 0~0.001 Glutamine (Q) 0.5~2 0.1~2 0~0.001 0~0.001 25~35 0~0.001 0~0.001 0~0.001

    TABLE-US-00022 TABLE 22 Amino acid distribution ratio for each position of amino acid (%)-Vλ1-51_CDR3 Type of AA 4 5 6 7 8 9 10 11 12 13 14 Alanine (A) 40~50 25~35 0.1~1 0~0.001 2~5 0.5~3 0.01~0.1 0.5~3 25~35 1~7 1~4 Serine (S) 3~7 25~35 0~0.001 0~0.001 25~35 58~75 5~15 25~35 2~4 1~7 0.01~0.1 Glycine (G) 10~20 0.1~1 0.01~0.1 0.1~0.5 2~8 1~5 0.1~1 1~4 15~25 3~10 0.01~0.1 Phenylalanine (F) 0~0.001 0.01~0.1 0.5~3 0~0.001 0.01~0.1 0.05~0.5 0~0.01 0.01~0.1 0.5~3 0.5~3 0.5~3 Proline (P) 0.01~0.1 0.01~0.1 0~0.001 0~0.001 0.01~0.1 0.5~2 0.5~2 0.05~0.5 0.5~3 2~7 0.01~0.1 Valine (V) 0.5~3 10~20 0~0.01 0.01~0.05 0.5~2 0.5~2 0.5~2 0.1~1 2~6 15~25 55~65 Tyrosine (Y) 0.01~0.1 0.01~0.1 10~20 0~0.01 0.5~2 0.5~2 0.01~0.05 0.5~3 0.5~3 20~30 0~0.01 Methionine (M) 0~0.001 0~0.001 0.01~0.1 0.01~0.05 0~0.01 0~0.001 0.01~0.05 0~0.001 0~0.01 0.5~3 2~6 Threonine (T) 0.5~3 20~30 0.01~0.1 0~0.001 3~8 3~7 1~4 3~9 1~4 0.01~0.1 0~0.01 Lysine (K) 0~0.01 0~0.001 0~0.001 0~0.001 0.5~3 0.5~2 0~0.001 2~6 0~0.01 0~0.01 0~0.001 Isoleucine (I) 0~0.001 0.5~3 0~0.01 0.01~0.05 1~4 1~4 0.5~3 0.5~3 1~4 0.01~0.1 5~10 Tryptophan (W) 0~0.001 0.01~0.1 75~85 0~0.001 0.01~0.1 0~0.001 0.01~0.05 0~0.001 0.01~0.1 15~25 0.01~0.1 Aspartic acid (D) 0~0.01 0~0.001 0~0.001 95~99.999 25~35 1~4 0.5~2 10~20 1~5 0~0.01 0.01~0.1 Histidine (H) 0.5~3 0.01~0.1 0.5~3 0~0.001 0.5~3 0.01~0.5 0~0.01 1~4 10~20 1~4 0~0.001 Asparagine (N) 0~0.001 0.01~0.1 0~0.001 0.01~0.1 8~18 5~15 1~4 25~35 0.5~3 0~0.01 0~0.001 Arginine (R) 0.01~0.1 0~0.001 0.1~1 0.01~0.1 0.5~3 1~4 0.1~1 1~4 0.5~3 1~4 0.01~0.1 Glutamic acid (E) 0.5~3 0.01~0.1 0~0.001 0.01~0.1 0.5~3 0~0.01 0~0.1 0.5~3 0.5~3 0.5~3 0~0.001 Cysteine (C) 0~0.001 0~0.01 0.0~0.1 0~0.001 0.01~0.1 0.01~0.05 0.01~0.05 0~0.01 0.01~0.1 0.01~0.1 0.01~0.1 Leucine (L) 0.5~3 1~4 0.01~0.1 0~0.001 0.01~0.1 0.5~3 75~85 0.01~0.1 2~7 5~15 20~30 Glutamine (Q) 25~35 0~0.001 0~0.001 0~0.001 0~0.001 0~0.001 0.01~0.1 0~0.01 1~4 0.5~3 0~0.001

    [0138] In the present invention, the amino acid ratio for each position in the heavy-chain complementarity-determining region 1 (CDRH1) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1) includes the range of Table 23,

    [0139] the amino acid ratio for each position in the heavy-chain complementarity-determining region 2 (CDRH2) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1) includes the range of Table 24,

    [0140] the amino acid ratio for each position in the heavy-chain complementarity-determining region 1 (CDRH1) in the heavy-chain variable region having the sequence of VH3-23 (SEQ ID NO: 6) includes the range of Table 23,

    [0141] the amino acid ratio for each position in the heavy-chain complementarity-determining region 2 (CDRH2) in the heavy-chain variable region having the sequence of VH3-23 (SEQ ID NO: 6) includes the range of Table 24,

    [0142] the amino acid ratio for each position in the heavy-chain complementarity-determining region 1 (CDRH1) in the heavy-chain variable region having the sequence of VH1-69 (SEQ ID NO: 11) includes the range of Table 25,

    [0143] the amino acid ratio for each position in the heavy-chain complementarity-determining region 2 (CDRH2) in the heavy-chain variable region having the sequence of VH1-69 (SEQ ID NO: 11) includes the range of Table 26,

    [0144] when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 9 amino acids, the amino acid ratio for each position in CDRH3 includes the range of Table 27,

    [0145] when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 10 amino acids, the amino acid ratio for each position in the CDRH3 includes the range of Table 28,

    [0146] when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 11 amino acids, the amino acid ratio for each position in CDRH3 includes the range of Table 29,

    [0147] when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 12 amino acids, the amino acid ratio for each position in CDRH3 includes the range of Table 30,

    [0148] when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 13 amino acids, the amino acid ratio for each position in CDRH3 includes the range of Table 31,

    [0149] when the heavy-chain complementarity-determining region 3 (CDRH3) in the heavy-chain variable region having the sequence of VH3-15 (SEQ ID NO: 1), VH3-23 (SEQ ID NO: 6) or VH1-69 (SEQ ID NO: 11) has 14 amino acids, the amino acid ratio for each position in CDRH3 includes the range of Table 32,

    [0150] the amino acid ratio for each position in the light-chain complementarity-determining region 1 (CDRL1) in the light-chain variable region having the sequence of Vκ1-39 (SEQ ID NO: 16) includes the range of Table 33,

    [0151] the amino acid ratio for each position in the light-chain complementarity-determining region 2 (CDRL2) in the light-chain variable region having the sequence of Vκ1-39 (SEQ ID NO: 16) includes the range of Table 34,

    [0152] the amino acid ratio for each position in the light-chain complementarity-determining region 3 (CDRL3) in the light-chain variable region having the sequence of Vκ1-39 (SEQ ID NO: 16) includes the range of Table 35,

    [0153] the amino acid ratio for each position in the light-chain complementarity-determining region 1 (CDRL1) in the light-chain variable region having the sequence of Vκ3-20 (SEQ ID NO: 21) includes the range of Table 36,

    [0154] the amino acid ratio for each position in the light-chain complementarity-determining region 2 (CDRL2) in the light-chain variable region having the sequence of Vκ3-20 (SEQ ID NO: 21) includes the range of Table 37,

    [0155] the amino acid ratio for each position in the light-chain complementarity-determining region 3 (CDRL3) in the light-chain variable region having the sequence of Vκ3-20 (SEQ ID NO: 21) includes the range of Table 38,

    [0156] the amino acid ratio for each position in the light-chain complementarity-determining region 1 (CDRL1) in the light-chain variable region having the sequence of Vκ3-20-2 (SEQ ID NO: 26) includes the range of Table 39,

    [0157] the amino acid ratio for each position in the light-chain complementarity-determining region 2 (CDRL2) in the light-chain variable region having the sequence of Vκ3-20-2 (SEQ ID NO: 26) includes the range of Table 37,

    [0158] the amino acid ratio for each position in the light-chain complementarity-determining region 3 (CDRL3) in the light-chain variable region having the sequence of Vκ3-20-2 (SEQ ID NO: 26) includes the range of Table 38,

    [0159] the amino acid ratio for each position in the light-chain complementarity-determining region 1 (CDRL1) in the light-chain variable region having the sequence of Vλ1-51 (SEQ ID NO: 31) includes the range of Table 40,

    [0160] the amino acid ratio for each position in the light-chain complementarity-determining region 2 (CDRL2) in the light-chain variable region having the sequence of Vλ1-51 (SEQ ID NO: 31) includes the range of Table 41, and

    [0161] the amino acid ratio for each position in the light-chain complementarity-determining region 3 (CDRL3) in the light-chain variable region having the sequence of Vλ1-51 (SEQ ID NO: 31) includes the range of Table 42, but is not limited thereto.

    TABLE-US-00023 TABLE 23 Amino acid distribution ratio for each position of amino acid (%)-VH3_CDR1 Type of AA 27 28 29 30 31 32 33 34 35 Alanine (A) 0.000 4.393 9.435 2.896 2.236 3.180 26.480 0.075 3.307 Serine (S) 23.700 0.261 0.037 0.000 0.038 0.075 0.484 0.000 0.037 Glycine (G) 0.000 1.303 0.000 3.528 14.286 0.736 5.996 0.075 1.338 Phenylalanine (F) 0.000 0.037 0.000 0.557 1.516 0.000 1.825 0.000 9.773 Proline (P) 64.116 1.303 85.215 0.186 0.872 4.901 1.601 0.788 0.000 Valine (V) 0.037 0.521 0.371 2.154 12.391 0.000 18.399 0.150 3.270 Tyrosine (Y) 0.037 0.000 0.000 1.560 2.236 10.587 1.229 0.000 40.654 Methionine (M) 0.000 8.191 0.409 2.414 0.909 0.673 0.834 8.483 1.003 Threonine (T) 0.000 2.978 0.000 1.448 3.600 10.251 0.037 0.000 0.000 Lysine (K) 2.080 0.074 3.975 2.599 0.682 5.686 1.937 20.371 0.111 Isoleucine (I) 0.000 0.968 0.000 0.000 0.000 0.000 0.000 0.000 0.000 Tryptophan (W) 0.000 0.223 0.000 13.554 27.624 6.510 1.750 0.000 17.837 Aspartic acid (D) 0.000 1.154 0.000 10.472 0.114 0.449 1.750 0.000 0.297 Histidine (H) 0.000 9.456 0.000 1.077 0.796 0.150 0.112 0.000 2.081 Asparagine (N) 9.361 0.894 0.037 3.453 2.842 0.486 3.687 0.150 0.260 Arginine (R) 0.520 12.249 0.334 34.831 20.500 5.163 5.251 0.225 15.942 Glutamic acid (E) 0.000 52.085 0.037 18.975 7.579 0.748 2.756 0.000 2.787 Cysteine (C) 0.037 0.037 0.111 0.297 0.455 0.187 1.415 68.806 0.223 Leucine (L) 0.000 0.074 0.000 0.000 0.076 0.000 13.073 0.000 0.000 Glutamine (Q) 0.111 3.797 0.037 0.000 1.250 50.168 11.322 0.375 1.078 Total 100 100 100 100 100 100 100 100 100

    TABLE-US-00024 TABLE 24 Amino acid distribution ratio for each position of amino acid (%)-VH3_CDR2 Type of AA 49 50 51 52 52a 53 54 55 56 57 55 59 60 Alanine (A) 41.634 9.651 0.000 1.428 4.476 32.427 0.002 4.974 3.137 1.835 2.003 0.000 99.762 Serine (S) 55.912 13.983 0.043 60.030 19.436 5.980 24.556 36.293 13.598 0.856 0.049 0.002 0.009 Glycine (G) 2.124 14.784 0.000 2.458 14.177 0.050 75.113 14.864 1.908 0.009 3.721 0.000 0.000 Phenylalanine (F) 0.000 6.037 0.009 0.079 2.710 0.043 0.002 0.791 0.800 0.006 6.355 0.002 0.000 Proline (P) 0.079 0.019 0.000 0.482 2.128 0.030 0.000 0.035 0.396 0.247 0.009 0.000 0.002 Valine (V) 0.061 20.375 0.043 0.005 1.035 0.069 0.093 1.966 1.041 1.570 0.417 0.000 0.084 Tyrosine (Y) 0.002 18.324 0.008 1.584 15.556 0.017 0.000 0.818 6.252 0.006 59.547 99.822 0.000 Methionine (M) 0.000 0.003 0.003 0.003 0.006 2.824 0.002 0.002 0.003 1.914 0.003 0.065 0.000 Threonine (T) 0.036 5.408 0.154 4.371 2.997 0.003 0.000 7.825 12.503 22.393 0.054 0.000 0.060 Lysine (K) 0.000 0.547 0.000 17.126 2.079 0.511 0.003 0.713 4.737 33.349 1.349 0.000 0.000 Isoleucine (I) 0.000 2.104 99.710 0.498 1.352 0.005 0.016 1.581 3.246 27.034 0.564 0.006 0.000 Tryptophan (W) 0.005 0.000 0.000 5.060 9.196 53.571 0.050 0.011 0.002 0.000 0.776 0.000 0.000 Aspartic acid (D) 0.002 0.017 0.002 0.000 0.017 1.612 0.058 12.043 6.328 0.003 5.561 0.003 0.000 Histidine (H) 0.020 2.432 0.006 0.976 4.554 0.058 0.000 1.175 2.146 0.016 7.310 0.039 0.000 Asparagine (N) 0.000 0.003 0.013 0.016 7.134 0.685 0.016 10.811 29.935 0.077 7.647 0.006 0.000 Arginine (R) 0.010 1.029 0.000 2.111 0.815 1.079 0.025 1.718 1.490 1.316 0.349 0.000 0.060 Glutamic acid (E) 0.016 0.008 0.000 0.014 2.517 0.005 0.003 2.021 8.581 5.049 1.063 0.000 0.011 Cysteine (C) 0.000 0.013 0.000 0.019 0.058 0.025 0.058 0.022 0.017 0.005 0.074 0.039 0.013 Leucine (L) 0.089 5.258 0.009 1.988 1.857 0.002 0.002 2.325 2.050 1.985 1.891 0.016 0.000 Glutamine (Q) 0.010 0.005 0.000 0.752 7.898 1.000 0.002 0.005 1.231 1.330 1.256 0.000 0.000 Tota 100 100 100 100 100 100 100 100 100 100 100 100 100

    TABLE-US-00025 TABLE 25 Amino acid distribution ratio for each position of amino acid (%)-VH1-69_CDR1 Type of AA 27 28 29 30 31 32 33 34 35 Alanine (A) 0.002 4.451 0.000 3.665 2.686 3.451 33.086 0.120 4.249 Serine (S) 1.112 15.468 0.166 44.036 23.734 5.599 5.809 0.072 16.838 Glycine (G) 4.262 0.552 0.000 2.330 2.559 0.000 11.034 1.129 3.540 Phenylalanine (F) 45.556 0.024 99.589 0.041 0.026 5.060 1.699 0.034 0.010 Proline (P) 0.000 1.773 0.005 0.865 0.026 0.026 1.651 0.007 0.082 Valine (V) 0.723 0.024 0.019 0.298 0.276 0.171 1.293 84.196 0.293 Tyrosine (Y) 37.952 0.038 0.010 0.017 0.776 61.578 12.383 0.067 1.261 Methionine (M) 0.000 1.254 0.000 0.005 0.002 0.005 0.005 0.000 0.000 Threonine (T) 0.024 62.052 0.026 20.088 8.858 0.634 3.009 0.017 2.949 Lysine (K) 0.012 3.103 0.002 1.801 3.493 1.012 0.000 0.007 0.017 Isoleucine (I) 1.516 8.488 0.014 3.423 1.329 0.014 1.005 6.439 0.833 Tryptophan (W) 0.000 0.000 0.000 0.000 0.000 0.007 14.620 0.005 0.000 Aspartic acid (D) 3.080 1.489 0.000 5.520 17.771 1.266 7.624 0.026 1.724 Histidine (H) 1.355 0.062 0.000 0.024 1.369 11.752 1.394 0.007 43.549 Asparagine (N) 1.619 0.223 0.002 14.765 32.818 7.343 1.817 0.024 22.451 Arginine (R) 0.007 0.942 0.000 2.359 1.951 0.286 0.459 0.187 0.329 Glutamic acid (E) 0.000 0.017 0.000 0.600 2.237 0.002 2.971 0.062 0.002 Cysteine (C) 0.053 0.000 0.007 0.002 0.005 0.077 0.041 0.007 0.017 Leucine (L) 2.727 0.038 0.142 0.108 0.065 1.701 0.058 7.590 0.014 Glutamine (Q) 0.000 0.000 0.017 0.053 0.017 0.014 0.043 0.002 1.842 Total 100 100 100 100 100 100 100 100 100

    TABLE-US-00026 TABLE 26 Amino acid distribution ratio for each position of amino acid (%)-VH1-69_CDR2 Type of AA 49 50 51 52 52a 53 54 55 56 57 58 Alanine (A) 39.885 6.884 0.000 0.342 10.682 1.634 3.358 4.481 4.605 7.531 1.915 Serine (S) 31.804 9.134 0.091 61.370 14.430 32.315 20.509 29.453 10.842 1.393 4.114 Glycine (G) 28.366 11.142 0.000 1.114 7.420 5.101 33.106 37.373 3.287 0.007 3.404 Phenylalanine (F) 0.007 3.703 0.002 0.399 2.116 0.889 4.021 0.043 0.711 0.002 3.334 Proline (P) 0.007 0.009 0.000 0.025 21.362 0.016 0.014 0.005 0.250 1.886 0.025 Valine (V) 0.054 8.767 0.005 1.182 1.363 1.370 1.500 1.339 1.980 1.575 0.610 Tyrosine (Y) 0.002 12.256 0.032 1.492 10.791 5.237 0.511 1.114 5.528 0.016 32.149 Methionine (M) 0.000 1.134 0.002 0.000 0.005 1.488 0.009 0.005 0.641 1.697 0.002 Threonine (T) 0.011 2.003 0.009 3.075 3.301 1.931 2.987 4.971 10.142 33.362 1.423 Lysine (K) 0.000 1.128 0.000 10.188 1.277 2.743 1.162 1.879 6.905 26.094 10.454 Isoleucine (I) 0.000 6.437 99.791 8.462 1.429 5.089 1.257 1.212 3.946 17.676 2.299 Tryptophan (W) 0.000 16.778 0.000 3.098 4.501 0.002 0.027 0.039 0.005 0.002 0.000 Aspartic acid (D) 0.002 1.479 0.014 2.939 3.394 34.621 5.876 9.642 9.578 0.005 4.786 Histidine (H) 0.005 1.187 0.027 1.277 4.067 2.099 0.002 1.657 2.398 0.048 6.209 Asparagine (N) 0.000 9.545 0.009 0.014 3.609 0.018 17.021 7.293 27.837 0.835 22.172 Arginine (R) 0.000 1.611 0.002 1.669 0.594 0.899 0.842 1.584 1.546 1.334 1.393 Glutamic acid (E) 0.007 0.000 0.000 0.009 2.266 2.028 1.658 1.798 7.505 3.075 2.038 Cysteine (C) 0.034 0.039 0.000 0.007 0.032 0.020 0.016 0.014 0.018 0.005 0.045 Leucine (L) 0.014 6.763 0.016 2.250 1.874 2.496 6.097 0.089 1.332 1.777 1.813 Glutamine (Q) 0.002 0.002 0.000 1.089 5.487 0.002 0.009 0.009 0.946 1.681 1.802 Total 100 100 100 100 100 100 100 100 100 100 100

    TABLE-US-00027 TABLE 27 Amino acid distribution ratio for each position of amino acid (%)-VH_CDR3_9AA Type of AA 96 97 98 99 100 100a 100b 101 102 Alanine (A) 4.724 5.125 5.077 12.434 7.550 13.005 1.545 1.390 1.038 Serine (S) 2.848 8.858 12.053 15.040 16.424 14.097 7.095 1.214 3.068 Glycine (G) 12.605 10.095 9.404 8.679 12.958 3.059 3.620 1.854 0.221 Phenylalanine (F) 0.353 1.789 1.347 2.959 1.589 3.378 49.327 0.132 3.157 Proline (P) 1.545 9.499 3.885 1.723 0.309 4.372 0.949 0.353 0.971 Valine (V) 5.430 6.472 15.210 4.505 3.951 5.630 7.018 3.421 7.351 Tyrosine (Y) 1.192 5.743 7.285 19.545 19.779 19.607 8.232 1.810 67.064 Methionine (M) 0.022 2.275 2.185 0.420 0.618 0.243 2.825 1.015 1.214 Threonine (T) 9.603 4.352 7.130 6.338 9.647 5.365 3.200 1.986 1.589 Lysine (K) 1.060 1.568 2.135 3.821 1.104 0.949 0.088 0.453 0.000 Isoleucine (I) 1.523 3.269 1.398 2.341 2.075 5.056 8.144 3.951 3.642 Tryptophan (W) 0.751 6.119 2.362 1.458 1.810 1.501 0.265 0.000 0.044 Aspartic acid (D) 28.631 5.036 6.137 6.913 7.241 7.640 1.214 74.443 3.620 Histidine (H) 2.031 1.811 1.965 1.789 1.258 2.981 0.728 0.331 3.091 Asparagine (N) 1.060 3.225 4.283 4.064 5.651 1.744 1.148 2.516 1.788 Arginine (R) 2.561 7.356 11.258 3.202 2.561 2.782 0.640 0.221 0.199 Glutamic acid (E) 10.662 2.783 2.053 3.180 2.649 1.015 1.810 3.487 0.265 Cysteine (C) 0.000 0.022 0.022 0.044 0.044 0.022 0.000 0.000 0.022 Leucine (L) 2.848 10.139 2.693 0.817 1.236 1.921 2.008 0.331 1.148 Glutamine (Q) 10.552 4.462 1.567 0.729 1.545 0.640 0.154 1.081 0.508 Total 100 100 100 100 100 100 100 100 100

    TABLE-US-00028 TABLE 28 Amino acid distribution ratio for each position of amino acid (%)-VH_CDR3_10AA Type of AA 96 97 98 99 100 100a 100b 100c 101 102 Alanine (A) 9.715 6.624 7.644 7.850 9.334 7.187 9.502 2.627 1.840 1.435 Serine (S) 5.155 11.104 13.885 15.490 14.590 9.507 8.179 3.820 1.000 4.613 Glycine (G) 10.408 11.233 12.804 14.168 12.639 14.212 13.357 2.305 2.872 0.081 Phenylalanine (F) 0.258 2.256 1.322 3.127 2.257 2.191 1.984 31.700 0.694 4.468 Proline (P) 0.967 3.803 3.096 2.273 2.031 1.482 4.339 2.869 0.323 5.532 Valine (V) 4.382 4.335 4.499 4.610 5.531 1.450 2.662 2.804 0.742 8.468 Tyrosine (Y) 2.175 5.205 8.660 10.364 10.688 16.951 21.068 5.270 0.888 51.048 Methionine (M) 0.709 1.370 2.000 1.386 0.451 1.676 0.048 13.924 0.032 0.016 Threonine (T) 2.465 4.819 6.531 5.271 6.110 4.431 3.452 1.257 0.888 0.161 Lysine (K) 1.949 3.981 2.629 1.660 1.757 1.499 1.484 0.032 0.016 0.000 Isoleucine (I) 2.691 3.674 2.629 2.273 2.289 1.112 2.194 5.222 0.549 3.016 Tryptophan (W) 1.337 1.998 2.177 2.805 5.078 5.543 5.435 0.612 0.032 0.529 Aspartic acid (D) 30.352 4.932 7.160 7.560 6.545 7.654 5.485 2.095 78.377 3.758 Histidine (H) 3.448 4.351 2.596 1.564 2.579 2.510 3.452 0.064 1.339 5.855 Asparagine (N) 1.788 3.175 2.887 4.803 4.740 8.701 3.065 1.450 1.711 3.048 Arginine (R) 2.175 4.319 2.435 2.031 1.548 1.869 1.678 0.774 0.500 0.032 Glutamic acid (E) 11.471 2.965 3.983 2.901 2.418 2.788 2.791 1.547 2.469 0.016 Cysteine (C) 0.000 0.032 0.016 0.016 0.016 0.032 0.016 0.000 0.016 0.081 Leucine (L) 6.251 17.035 10.321 7.028 8.963 6.445 7.663 21.595 3.453 7.742 Glutamine (Q) 1.804 2.788 2.725 2.821 2.434 2.559 2.146 0.032 2.259 0.000 Total 100 100 100 100 100 100 100 100 100 100

    TABLE-US-00029 TABLE 29 Amino acid distribution ratio for each position of amino acid (%)-VH_CDR3_11AA Type of AA 96 97 98 99 100 100a 100b 100c 100d 101 102 Alanine (A) 8.655 6.823 7.485 8.032 9.073 10.181 7.214 7.576 2.139 1.930 0.593 Serine (S) 3.818 10.407 13.451 14.863 13.762 12.954 11.448 8.652 3.518 0.855 5.265 Glycine (G) 12.638 10.365 13.479 15.553 11.900 12.609 9.683 9.701 2.359 1.875 1.158 Phenylalanine (F) 0.551 2.343 1.229 2.774 1.944 2.442 2.455 2.028 31.443 0.193 3.046 Proline (P) 1.502 3.735 3.356 1.987 1.572 3.173 2.634 3.808 2.483 0.717 3.584 Valine (V) 4.093 4.259 4.447 5.079 3.820 3.352 3.366 1.808 3.035 0.938 7.181 Tyrosine (Y) 1.475 5.224 8.383 9.591 10.576 11.546 13.683 21.540 3.739 0.979 50.172 Methionine (M) 1.378 1.571 1.878 1.559 0.579 0.041 0.028 1.283 9.437 0.097 0.041 Threonine (T) 1.888 4.108 5.400 5.037 6.371 5.049 6.262 4.126 1.007 0.510 1.213 Lysine (K) 1.709 4.714 2.444 2.139 2.261 1.904 1.876 2.042 0.028 0.014 0.000 Isoleucine (I) 2.040 3.749 2.555 2.332 2.537 3.269 2.317 2.194 4.939 0.317 3.432 Tryptophan (W) 1.185 1.943 2.403 2.332 4.316 4.732 5.228 5.271 1.200 0.014 0.000 Aspartic acid (D) 31.284 5.665 7.554 7.452 7.970 7.104 5.559 5.244 2.097 77.940 2.743 Histidine (H) 2.178 4.535 2.762 1.449 2.634 1.945 3.007 2.981 1.297 2.302 7.746 Asparagine (N) 2.343 3.487 3.273 5.341 4.606 4.428 6.772 5.933 2.414 2.606 4.411 Arginine (R) 1.916 3.515 2.168 2.139 1.848 1.614 2.441 2.318 0.924 0.703 0.069 Glutamic acid (E) 13.175 3.198 4.212 2.595 2.579 2.814 2.993 2.745 1.256 3.433 0.028 Cysteine (C) 0.028 0.028 0.000 0.000 0.014 0.028 0.069 0.041 0.000 0.028 0.055 Leucine (L) 5.623 17.629 10.938 6.859 8.591 9.063 10.221 9.093 25.814 2.537 8.243 Glutamine (Q) 2.522 2.702 2.583 2.884 3.047 1.752 2.745 1.614 0.869 2.013 1.020 Total 100 100 100 100 100 100 100 100 100 100 100

    TABLE-US-00030 TABLE 30 Amino acid distribution ratio for each position of amino acid (%)-VH_CDR3_12AA Type of AA 96 97 98 99 100 100a 100b 100c 100d 100e 101 102 Alanine (A) 7.256 6.895 7.305 8.271 7.741 10.325 7.001 7.457 11.272 2.008 1.487 0.418 Serine (S) 3.794 9.824 12.906 15.026 13.475 12.765 11.995 9.460 5.159 2.470 0.953 4.155 Glycine (G) 13.849 11.194 13.180 16.152 12.940 12.693 10.104 9.200 12.168 1.719 1.978 0.014 Phenylalanine (F) 0.404 2.222 1.169 2.569 2.036 2.224 2.180 2.542 2.384 36.805 0.173 2.785 Proline (P) 1.269 3.664 3.118 2.165 2.065 3.061 2.945 3.587 4.653 1.502 0.419 5.915 Valine (V) 3.462 4.559 4.490 4.345 3.423 3.394 3.637 1.950 2.225 2.094 0.260 9.652 Tyrosine (Y) 2.294 5.770 8.286 9.094 10.861 11.711 13.900 20.971 24.090 2.788 0.563 49.950 Methionine (M) 0.505 1.615 2.165 1.703 0.520 0.029 0.014 1.502 0.029 13.838 0.058 0.029 Threonine (T) 1.096 4.284 5.702 4.561 6.153 5.040 5.413 3.928 3.468 0.881 0.635 1.241 Lysine (K) 1.717 4.140 2.599 1.790 1.853 1.545 1.833 2.109 1.488 0.000 0.029 0.000 Isoleucine (I) 0.938 3.938 2.685 2.107 2.383 2.917 2.136 2.470 3.295 5.041 0.419 4.949 Tryptophan (W) 1.010 1.890 2.396 3.176 4.939 5.155 5.124 4.968 5.419 1.560 0.000 0.014 Aspartic acid (D) 38.358 4.962 7.464 7.116 7.438 8.260 6.308 4.752 3.801 1.040 82.717 1.587 Histidine (H) 2.813 4.256 2.988 1.443 2.672 1.993 2.887 3.394 3.540 1.127 1.444 7.171 Asparagine (N) 2.092 3.563 3.854 4.590 4.535 4.202 6.062 6.384 3.382 1.560 2.657 3.116 Arginine (R) 1.616 3.313 2.353 2.439 1.704 1.762 2.223 2.586 0.708 0.433 0.404 0.822 Glutamic acid (E) 11.411 2.813 3.811 3.103 3.134 2.700 2.497 2.556 2.457 0.650 2.281 0.058 Cysteine (C) 0.000 0.043 0.014 0.043 0.029 0.014 0.058 0.043 0.072 0.014 0.014 0.043 Leucine (L) 4.371 18.191 11.159 7.289 9.344 3.433 10.941 8.579 9.090 24.469 1.487 8.051 Glutamine (Q) 1.746 2.856 2.353 3.017 2.744 1.776 2.742 1.473 1.301 0.000 2.021 0.029 Total 100 100 100 100 100 100 100 100 100 100 100 100

    TABLE-US-00031 TABLE 31 Amino acid distribution ratio for each position of amino acid (%)-VH_CDR3_13AA Type of AA 96 97 98 99 100 100a 100b 100c 100d 100e 100f 101 102 Alanine (A) 7.017 6.899 6.507 8.555 8.633 9.729 7.328 7.297 4.436 12.777 2.199 0.604 0.504 Serine (S) 3.408 10.257 13.215 15.227 14.137 13.107 11.765 9.415 9.141 5.414 1.762 0.856 3.509 Glycine (G) 10.912 10.995 13.635 15.251 12.689 12.821 8.571 9.600 7.747 13.668 1.225 1.259 0.000 Phenylalanine (F) 0.755 2.182 1.261 2.522 1.767 2.168 2.000 2.740 2.151 2.707 40.164 0.823 2.535 Proline (P) 0.873 4.163 3.127 2.235 2.407 3.175 2.168 4.085 2.403 5.145 1.477 0.369 6.748 Valine (V) 4.566 3.727 4.119 4.639 3.063 3.378 3.495 1.479 1.916 1.597 2.064 0.537 13.564 Tyrosine (Y) 1.880 5.859 8.356 9.059 10.266 11.443 14.773 20.579 24.298 28.514 3.122 0.269 44.234 Methionine (M) 0.621 1.813 2.236 1.378 0.421 0.017 0.017 1.362 0.034 0.067 18.966 0.057 1.276 Threonine (T) 1.276 4.549 5.767 4.706 5.614 5.142 5.445 4.556 3.210 2.202 0.705 0.034 0.201 Lysine (K) 1.528 4.851 2.506 2.017 1.986 1.680 1.855 1.849 1.496 0.017 0.000 0.000 0.000 Isoleucine (I) 1.108 4.700 2.959 2.336 2.609 2.554 1.933 2.288 3.075 0.773 4.095 0.235 7.017 Tryptophan (W) 0.890 1.947 2.219 3.008 4.275 4.873 5.176 4.741 5.562 7.280 0.369 0.000 0.017 Aspartic acid (D) 41.951 4.684 7.599 7.378 7.136 7.747 6.471 4.909 7.915 3.379 1.208 88.650 1.578 Histidine (H) 3.608 4.432 3.043 1.597 2.827 1.832 3.210 3.043 3.025 3.766 1.074 0.890 7.856 Asparagine (N) 1.494 2.887 3.161 4.739 5.015 5.579 5.655 6.321 7.814 3.245 1.343 0.621 2.417 Arginine (R) 1.142 3.676 2.757 2.319 1.531 1.664 2.739 2.488 1.882 0.958 0.017 0.319 0.050 Glutamic acid (E) 10.660 3.257 4.085 2.807 2.827 3.109 2.941 2.942 3.949 1.554 0.638 1.511 0.017 Cysteine (C) 0.017 0.000 0.017 0.050 0.034 0.034 0.017 0.084 0.034 0.050 0.050 0.000 0.050 Leucine (L) 4.264 16.502 10.508 7.328 9.357 8.066 10.303 8.742 10.906 5.783 19.520 1.293 8.276 Glutamine (Q) 2.031 2.619 2.724 2.739 2.407 1.882 3.126 1.379 1.008 1.093 0.000 1.552 0.050 Total 100 100 100 100 100 100 100 100 100 100 100 100 100

    TABLE-US-00032 TABLE 32 Amino acid distribution ratio for each position of amino acid (%)-VH_CDR3_14AA Type of AA 96 97 98 99 100 100a 100b Alanine (A) 6.961 0.545 8.241 8.018 8.149 9.300 7.210 Serine (S) 4.459 4.306 11.953 14.300 14.695 12.536 11.829 Glycine (G) 11.300 0.102 13.554 15.869 12.070 13.543 9.034 Phenylalanine (F) 1.157 3.081 1.498 3.235 3.080 2.282 2.846 Proline (P) 0.919 5.702 2.503 2.656 1.841 2.930 2.352 Valine (V) 4.901 13.838 4.512 4.494 3.358 3.832 3.579 Tyrosine (Y) 0.562 45.043 7.679 9.517 10.979 10.952 13.891 Methionine (M) 0.425 1.311 2.111 1.532 0.682 0.034 0.000 Threonine (T) 1.568 0.102 5.449 4.562 6.001 4.991 5.966 Lysine (K) 0.756 0.000 2.622 2.043 1.892 1.823 1.909 Isoleucine (I) 1.021 7.047 2.895 2.979 2.421 2.896 2.182 Tryptophan (W) 0.596 0.102 2.367 2.911 5.131 5.178 5.710 Aspartic acid (D) 41.899 1.226 7.815 7.559 7.450 7.546 6.847 Histidine (H) 2.791 7.183 3.048 1.413 2.711 1.652 3.170 Asparagine (N) 2.195 1.991 3.371 4.886 5.165 5.348 6.664 Arginine (R) 1.517 0.000 2.316 1.858 1.483 1.431 2.318 Glutamic acid (E) 9.973 0.051 4.393 2.962 2.745 2.793 2.454 Cysteine (C) 0.051 0.119 0.017 0.000 0.051 0.017 0.034 Leucine (L) 5.123 7.200 11.034 6.622 8.490 9.027 9.187 Glutamine (Q) 1.617 0.051 2.622 2.383 2.608 1.788 3.017 Total 100 100 100 100 100 100 100 Type of AA 100c 100d 100e 100f 100g 101 102 Alanime (A) 7.104 4.873 2.521 10.729 1.957 1.022 1.089 Serine (S) 9.864 10.342 8.465 3.917 2.127 0.306 4.612 Glycine (G) 10.392 8.230 9.164 17.405 0.715 1.720 0.000 Phenylalanine (F) 2.061 2.488 2.044 2.112 36.164 0.562 1.378 Proline (P) 4.055 2.130 1.891 5.501 1.838 0.647 6.995 Valine (V) 2.300 1.976 1.652 2.044 1.889 0.306 18.210 Tyrosine (Y) 21.278 25.234 29.331 27.129 2.059 0.034 40.061 Methionine (M) 1.601 0.000 0.758 0.834 25.766 0.017 0.000 Threonine (T) 3.748 3.578 2.265 1.958 0.425 0.664 0.564 Lysine (K) 2.198 1.448 1.533 0.000 0.000 0.000 0.000 Isoleucine (I) 2.010 3.033 1.559 1.226 3.880 0.375 4.629 Tryptophan (W) 4.106 3.357 4.684 8.328 0.238 0.000 0.017 Aspartic acid (D) 5.196 6.441 7.852 1.737 0.596 85.816 1.361 Histidine (H) 2.564 2.726 4.258 3.832 1.055 1.532 7.369 Asparagine (N) 5.792 6.935 11.991 2.980 0.425 1.430 2.332 Arginine (R) 2.487 2.249 1.685 0.954 0.034 0.443 0.034 Glutamic acid (E) 2.368 3.544 2.510 1.141 0.442 2.094 0.000 Cysteine (C) 0.034 0.000 0.051 0.068 0.017 0.500 0.068 Leucine (L) 8.944 10.411 4.122 7.408 20.371 0.765 11.181 Glutamine (Q) 1.499 1.005 1.243 0.698 0.000 2.265 0.000 Total 100 100 100 100 100 100 100

    TABLE-US-00033 TABLE 33 Amino acid distribution ratio for each position of amino acid (%)-V.sub.K1-39_CDR1 Type of AA 24 25 26 27 28 29 30 31 32 33 34 Alanine (A) 0.000 99.639 0 0.000 4.354 0.061 4.726 1.184 1.885 0.004 43.094 Serine (S) 92.887 0.023 99.713 0.015 35.274 0.023 34.875 15.917 3.113 0.011 2.575 Glycine (G) 6.836 0.034 0.065 0.000 10.414 0.000 6.918 1.648 1.482 0.008 3.019 Phenylalanine (F) 0.000 0.000 0.000 0.000 1.058 0.000 0.644 0.678 6.548 0.000 0.004 Proline (P) 0.000 0.004 0.000 0.000 0.336 0.000 0.027 1.062 0.035 0.084 0.008 Valine (V) 0.008 0.130 0.080 0.000 1.433 83.913 0.498 0.176 0.012 0.019 1.264 Tyrosine (Y) 0.000 0.000 0.000 0.000 1.863 0.042 2.591 1.552 38.539 0.019 0.019 Methionine (M) 0.015 0.000 0.000 0.000 0.027 0.000 0.000 0.418 0.000 0.000 0.000 Threonine(T) 0.000 0.027 0.000 0.008 8.051 0.004 5.535 11.755 0.050 0.004 0.513 Lysine (K) 0.004 0.000 0.000 0.004 0.782 0.004 3.231 8.987 0.012 0.004 0.031 Isoleucine (I) 0.034 0.000 0.046 0.000 1.353 13.621 2.173 2.802 0.000 5.346 0.648 Tryptophan (W) 0.000 0.000 0.000 0.000 0.008 0.000 0.000 0.000 17.149 0.000 0.000 Aspartic acid (D) 0.008 0.000 0.000 0.031 31.874 0.004 6.581 6.404 5.757 0.004 0.962 Histidine(H) 0.000 0.000 0.000 0.169 1.633 0.000 1.169 2.422 7.507 0.000 2.058 Asparagine (N) 0.027 0.000 0.054 0.004 0.034 0.000 22.430 39.974 4.425 0.000 45.661 Arginine (R) 0.161 0.054 0.031 94.193 0.874 0.015 4.128 2.591 1.029 0.000 0.019 Glutamic acid (E) 0.004 0.031 0.011 0.069 0.019 0.004 1.679 0.851 1.259 0.000 0.027 Cysteine (C) 0.011 0.008 0.000 0.000 0.034 0.012 0.008 0.004 0.088 0.000 0.000 Leucine (L) 0.000 0.000 0.000 0.534 0.050 2.294 2.783 0.567 4.550 94.496 0.000 Glutamine (Q) 0.004 0.000 0.000 4.973 0.019 0.004 0.004 0.008 1.547 0.000 0.000 Total 100 100 100 100 100 100 100 100 1.00 100 100

    TABLE-US-00034 TABLE 34 Amino acid distribution ratio for each position of amino acid (%)-V.sub.K1-39_CDR2 Type of AA 50 51 52 53 54 55 56 Alanine (A) 25.000 79.331 0.000 3.515 0.000 2.715 3.452 Serine (S) 7.092 3.197 0.056 27.528 0.000 0.017 62.585 Glycine (G) 4.588 1.138 0.000 0.675 0.000 1.857 4.228 Phenylalanine (F) 0.432 0.007 0.007 1.782 0.090 0.555 0.992 Proline (P) 0.223 0.741 0.000 0.007 0.111 0.307 1.388 Valine (V) 1.608 4.067 0.000 1.061 0.010 0.478 1.291 Tyrosine (Y) 1.483 0.003 0.000 2.172 0.014 1.117 0.466 Methionine (M) 1.076 0.000 0.000 0.000 0.003 0.010 0.010 Threonine (T) 4.529 7.891 5.066 20.283 0.007 0.003 10.678 Lysine (K) 20.408 0.007 0.059 3.738 0.000 3.996 0.449 Isoleucine (I) 1.480 1.573 0.010 6.898 0.080 0.003 2.432 Tryptophan (W) 2.078 0.000 0.000 0.000 0.000 0.000 0.007 Aspartic acid (D) 16.909 0.014 0.035 3.174 0.000 2.778 5.404 Histidine (H) 0.473 0.000 0.000 0.526 10.006 6.903 0.003 Asparagine (N) 0.010 0.000 94.763 26.512 0.010 1.323 1.962 Arginine (R) 1.166 0.003 0.000 1.403 0.010 0.859 1.569 Glutamic acid (E) 8.832 2.007 0.000 0.028 0.000 38.742 0.010 Cysteine (C) 0.045 0.014 0.000 0.007 0.000 0.003 0.038 Leucine (L) 1.379 0.000 0.003 0.682 89.657 2.042 3.034 Glutamine (Q) 1.187 0.007 0.000 0.010 0.000 36.292 0.000 Total 100 100 100 100 100 100 100

    TABLE-US-00035 TABLE 35 Amino acid distribution ratio for each position of amino acid (%)-V.sub.K1-39_CDR3 Type of AA 89 90 91 92 93 94 95 96 Alanine (A) 0.000 0.018 3.949 1.051 3.162 10.532 0.032 0.637 Serine (S) 0.011 0.011 15.171 5.712 44.687 7.396 0.156 1.413 Glycine (G) 0.035 0.004 1.193 0.848 3.883 0.604 0.000 1.057 Phenylalanine (F) 0.000 0.000 3.285 4.004 0.873 9.307 0.000 6.181 Proline (P) 0.018 0.021 0.053 0.021 0.050 2.088 99.613 4.466 Valine (V) 0.000 0.000 0.895 0.380 0.642 2.834 0.000 1.783 Tyrosine (Y) 0.000 0.004 53.280 34.031 1.044 27.512 0.000 12.675 Methionine (M) 0.000 0.004 0.000 0.004 0.000 2.084 0.000 0.018 Threonine (T) 0.000 0.000 4.123 1.452 11.365 14.935 0.050 0.032 Lysine (K) 0.000 0.025 0.032 3.159 1.555 0.000 0.000 0.815 Isoleucine (I) 0.007 0.000 0.032 1.132 3.102 4.357 0.000 1.886 Tryptophan (W) 0.089 0.000 0.000 0.000 0.000 0.028 0.000 13.828 Aspartic acid (D) 0.000 0.227 2.891 10.312 5.814 1.336 0.000 0.473 Histidine (H) 0.000 9.127 7.916 5.768 1.352 2.056 0.000 3.260 Asparagine (N) 0.000 0.000 1.868 27.866 17.576 3.611 0.000 0.669 Arginine (R) 92.086 0.028 0.032 0.497 1.746 0.213 0.046 5.509 Glutamic acid (E) 0.000 2.324 0.007 1.590 1.214 0.000 0.000 0.445 Cysteine (C) 0.000 0.000 0.028 0.032 0.014 0.039 0.000 0.036 Leucine (L) 7.715 0.014 5.238 1.679 1.906 11.065 0.064 41.235 Glutamine (Q) 0.039 88.193 0.007 0.461 0.014 0.004 0.039 3.583 Total 100 100 100 100 100 100 100 100

    TABLE-US-00036 TABLE 36 Amino acid distribution ratio for each position of amino acid (%)-V.sub.K3-20_CDR1 Type of AA 3 4 5 6 7 8 9 10 11 12 13 14 Alanine (A) 0.000 99.708 0.000 0.000 1.078 1.308 6.955 1.941 2.488 0.005 0.000 99.698 Serine (S) 93.009 0.029 99.617 0.158 72.631 0.058 41.161 54.144 22.774 9.041 0.120 0.053 Glycine (G) 6.780 0.019 0.144 0.000 0.690 0.005 4.501 4.443 1.376 0.010 86.918 0.005 Phenylalanine (F) 0.000 0.000 0.000 0.000 1.136 2.008 0.753 0.091 0.374 10.907 0.005 0.000 Proline (P) 0.000 0.000 0.000 0.053 0.484 0.029 1.299 0.072 0.714 0.067 0.000 0.010 Valine (V) 0.014 0.077 0.048 0.005 0.101 53.659 0.618 0.556 0.508 0.000 5.683 0.062 Tyrosine (Y) 0.010 0.000 0.024 0.000 1.193 0.029 2.392 1.270 0.652 58.367 0.000 0.000 Methionine (M) 0.010 0.000 0.000 0.000 0.000 0.958 0.000 0.000 0.005 0.014 0.010 0.000 Threonine (T) 0.000 0.058 0.005 0.010 10.623 0.024 9.951 5.364 7.877 0.062 0.000 0.048 Lysine (K) 0.024 0.000 0.000 5.483 0.010 0.000 1.237 0.748 4.186 1.622 0.000 0.000 Isoleucine (I) 0.005 0.000 0.014 0.000 3.076 27.007 3.456 1.874 2.253 0.000 0.005 0.000 Tryptophan (W) 0.000 0.000 0.000 0.000 0.000 0.010 0.014 0.000 0.038 0.715 0.000 0.000 Aspartic acid (D) 0.000 0.000 0.000 0.000 1.207 0.005 6.404 2.483 4.656 2.591 7.068 0.000 Histidine (H) 0.000 0.000 0.000 4.677 0.609 0.000 0.925 0.585 0.729 5.886 0.005 0.000 Asparagine (N) 0.072 0.000 0.024 0.225 5.999 0.005 15.186 23.765 46.104 6.104 0.014 0.000 Arginine (R) 0.034 0.043 0.048 0.115 1.016 0.024 2.933 1.505 3.069 0.581 0.101 0.034 Glutamic acid (E) 0.024 0.005 0.062 0.010 0.010 0.000 0.034 0.000 0.014 0.000 0.005 0.014 Cysteine (C) 0.014 0.062 0.014 0.000 0.024 0.072 0.000 0.010 0.005 0.077 0.058 0.005 Leucine (L) 0.000 0.000 0.000 0.019 0.115 14.797 2.167 1.021 2.167 1.531 0.010 0.024 Glutamine (Q) 0.005 0.000 0.000 89.235 0.000 0.005 0.010 0.029 0.010 1.420 0.000 0.048 Total 100 100 100 100 100 100 100 100 100 100 100 100

    TABLE-US-00037 TABLE 37 Amino acid distribution ratio for each position of animo acid (%)-V.sub.K3-20_CDR2 Type of AA 3 4 5 6 7 8 9 10 11 Alanine (A) 0.000 11.374 73.679 1.717 1.848 0.000 97.386 64.191 0.016 Serine (S) 6.170 5.015 4.630 84.208 23.978 0.037 0.090 8.731 0.008 Glycine (G) 0.004 30.792 1.741 0.004 0.824 0.016 0.004 0.000 5.896 Phenylalanine (F) 7.860 0.033 0.012 5.491 0.824 0.000 0.008 0.008 0.000 Proline (P) 0.012 0.029 0.688 0.594 0.012 0.033 0.008 11.079 0.000 Valine (V) 0.000 0.733 4.331 0.701 0.270 0.049 2.385 0.029 0.008 Tyrosine (Y) 70.382 0.643 0.016 2.225 1.733 0.000 0.000 0.000 0.025 Methionine (M) 0.000 0.000 0.000 0.000 0.672 0.000 0.000 0.000 0.000 Threonine (T) 0.057 1.282 10.600 2.499 16.191 0.004 0.045 15.881 0.008 Lysine (K) 0.008 0.004 0.000 0.000 7.799 0.000 0.000 0.000 0.000 Isoleucine (I) 1.140 0.008 2.540 0.815 5.053 0.000 0.000 0.004 0.000 Tryptophan (W) 0.382 0.008 0.000 0.000 0.000 0.000 0.000 0.000 0.000 Aspartic acid (D) 1.809 40.588 0.078 0.000 2.270 0.000 0.016 0.029 93.964 Histidine (H) 8.077 1.246 0.025 0.020 1.947 0.049 0.000 0.000 0.004 Asparagine (N) 1.284 2.961 0.033 0.020 33.469 0.000 0.000 0.000 0.041 Arginine (R) 0.016 1.082 0.008 0.004 2.106 99.672 0.004 0.000 0.000 Glutamic acid (E) 0.000 3.802 0.906 0.004 0.004 0.000 0.000 0.000 0.029 Cysteine (C) 0.045 0.020 0.016 0.012 0.004 0.094 0.025 0.012 0.000 Leucine (L) 2.223 0.766 0.676 1.684 0.996 0.045 0.029 0.037 0.000 Glutamine (Q) 0.529 0.012 0.020 0.000 0.000 0.000 0.000 0.000 0.000 Total 100 100 100 100 100 100 100 100 100

    TABLE-US-00038 TABLE 38 Amnio acid distribution ratio for each position of amino acid (%)-V.sub.K3-20 & 20-2_CDR3 Type of AA 4 5 6 7 8 9 10 11 Alanine (A) 0.000 0.014 6.618 4.632 1.944 5.472 0.018 0.383 Serine (S) 0.009 0.018 6.672 12.502 27.846 36.329 0.112 1.000 Glycine (G) 0.009 0.000 2.402 17.116 3.334 0.698 0.000 1.225 Phenylalanine (F) 0.000 0.000 3.082 1.727 0.787 1.890 0.000 5.562 Proline (P) 0.000 0.000 0.045 0.049 0.063 2.349 99.555 4.918 Valine (V) 0.000 0.000 0.369 1.691 0.738 0.675 0.000 1.464 Tyrosine (Y) 0.000 0.005 63.796 14.148 1.587 3.614 0.000 10.955 Methionine (M) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.005 Threonine (T) 0.000 0.000 1.062 4.380 7.410 9.266 0.022 0.023 Lysine (K) 0.000 0.009 0.022 1.596 2.448 0.000 0.000 0.671 Isoleucine (I) 0.000 0.000 0.018 2.069 2.146 1.841 0.000 1.653 Tryptophan (W) 0.094 0.000 0.324 0.009 0.000 27.702 0.000 14.456 Aspartic acid (D) 0.000 0.000 1.242 7.159 5.577 0.018 0.000 0.491 Histidine (H) 0.000 10.512 4.639 2.527 5.278 0.009 0.000 3.356 Asparagine (N) 0.000 0.000 0.922 15.722 26.604 1.472 0.000 0.572 Arginine (R) 95.531 0.054 6.866 0.724 1.494 0.329 0.049 6.026 Glutamic acid (E) 0.000 0.005 0.009 2.019 1.201 0.000 0.000 0.387 Cysteine (C) 0.000 0.000 0.162 0.018 0.013 0.009 0.000 0.018 Leucine (L) 4.303 0.009 1.692 11.908 2.101 8.330 0.121 43.405 Glutamine (Q) 0.054 89.376 0.058 0.004 8.229 0.000 0.121 3.382 Total 100 100 100 100 100 100 100 100

    TABLE-US-00039 TABLE 39 Amino acid distribution ratio for each position of amino acid (%)-V.sub.K3-20-2_CDR1 Type of AA 3 4 5 6 7 8 9 10 11 12 Alanine (A) 0.000 99.676 0.000 0.000 1.581 1.774 3.895 1.735 0.440 0.032 Serine (S) 93.219 0.054 99.676 0.092 57.056 0.189 37.097 31.048 6.989 0.065 Glycine (G) 6.557 0.015 0.029 0.005 2.934 0.008 10.790 2.455 0.263 86.653 Phenylalanine (F) 0.000 0.000 0.000 0.000 0.060 1.158 0.585 0.791 4.513 0.002 Proline (P) 0.000 0.006 0.000 0.014 0.637 0.002 0.034 0.362 0.023 0.000 Valine (V) 0.031 0.074 0.063 0.005 0.083 47.528 0.891 0.805 0.000 5.508 Tyrosine (V) 0.000 0.000 0.000 0.002 0.952 0.025 1.838 2.175 26.251 0.006 Methionine (M) 0.012 0.000 0.000 0.000 0.000 0.008 0.002 0.002 0.008 0.005 Threonine (T) 0.003 0.049 0.003 0.008 5.785 0.028 5.782 14.453 0.790 0.005 Lysine (K) 0.002 0.000 0.006 0.009 0.017 0.000 1.709 3.489 4.066 0.000 Isoleucine (I) 0.029 0.000 0.054 0.003 1.492 36.829 2.438 4.900 0.011 0.003 Tryptophan (W) 0.000 0.002 0.000 0.000 0.000 0.008 0.002 0.002 1.093 0.000 Aspartic acid (D) 0.003 0.000 0.000 0.060 2.965 0.009 7.017 3.132 4.356 7.393 Histidine (H) 0.000 0.000 0.000 0.174 0.005 0.025 1.660 1.121 5.642 0.000 Asparagine (N) 0.074 0.000 0.045 0.005 15.265 0.032 19.057 29.809 40.213 0.005 Arginine (R) 0.037 0.051 0.058 93.620 1.012 0.026 3.649 3.589 0.510 0.048 Glutamic acid (E) 0.028 0.022 0.058 0.028 0.002 0.002 1.115 0.006 1.024 0.011 Cysteine (C) 0.002 0.052 0.008 0.002 0.015 0.078 0.025 0.014 0.037 0.054 Leucine (L) 0.000 0.000 0.000 0.961 0.132 12.267 2.390 0.088 2.425 0.212 Glutamine (Q) 0.005 0.000 0.000 5.014 0.008 0.003 0.023 0.025 1.347 0.000 Total 100 100 100 100 100 100 100 100 100 100

    TABLE-US-00040 TABLE 40 Amino acid distribution ratio for each position of amino acid (%)-Vλ1-51_CDR1 Type of AA 3 4 5 6 7 8 9 10 11 12 13 14 15 Alanine (A) 0.007 0.092 1.341 1.946 0.013 0.000 0.131 4.889 1.558 0.000 7.376 0.092 2.657 Serine (S) 99.632 0.053 78.287 52.255 99.527 0.053 0.020 0.007 31.705 3.276 10.026 0.000 36.262 Glycine (G) 0.000 99.744 7.540 3.557 0.000 0.000 0.026 3.327 2.360 0.599 0.625 0.000 0.000 Phenylalanine (F) 0.072 0.000 0.059 0.723 0.138 0.000 0.026 0.000 0.026 0.967 10.512 0.000 1.920 Proline (P) 0.177 0.000 0.158 0.079 0.072 0.000 0.000 0.000 0.335 0.025 3.662 0.000 0.053 Valine (V) 0.000 0.020 0.013 0.020 0.000 0.000 89.711 0.000 0.513 0.000 1.492 99.658 0.007 Tyrosine (V) 0.020 0.000 0.033 0.730 0.020 0.007 0.020 0.000 2.005 3.802 31.990 0.000 14.244 Methionine (M) 0.000 0.000 0.000 0.000 0.000 0.138 0.000 0.000 0.000 0.000 0.000 0.099 0.000 Threonine (T) 0.020 0.000 5.923 11.946 0.007 0.020 0.000 0.000 7.139 1.072 14.042 0.000 1.420 Lysine (K) 0.000 0.000 0.007 1.874 0.000 0.072 0.000 0.112 4.372 3.144 0.000 0.000 0.638 Isoleucine (I) 0.000 0.000 1.282 1.729 0.007 0.026 9.756 0.007 4.049 0.724 2.735 0.000 0.000 Tryptophan (W) 0.000 0.013 0.000 0.007 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 Aspartic acid (D) 0.000 0.033 1.992 2.275 0.000 0.007 0.000 0.033 6.501 1.908 4.786 0.000 1.250 Histidine (H) 0.000 0.000 0.007 1.578 0.000 0.000 0.000 0.000 1.446 5.499 5.312 0.000 4.044 Asparagine (N) 0.000 0.000 1.972 19.093 0.000 99.571 0.000 0.013 32.369 76.301 4.615 0.000 35.953 Arginine (R) 0.000 0.013 1.269 2.091 0.000 0.000 0.000 0.092 3.543 0.605 0.552 0.046 0.013 Glutamic acid (E) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 91.507 0.861 1.355 0.007 0.000 0.013 Cysteine (C) 0.026 0.033 0.007 0.007 0.020 0.007 0.138 0.013 0.000 0.000 0.053 0.059 0.039 Leucine (L) 0.046 0.000 0.112 0.092 0.197 0.000 0.171 0.000 1.216 0.000 2.209 0.046 0.526 Glutamine (Q) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.724 0.007 0.000 0.960 Total 100 100 100 100 100 100 100 100 100 100 100 100 100

    TABLE-US-00041 TABLE 41 Amino acid distribution ratio for each position of amino acid (%)-Vλ1-51_CDR2 Type of AA 49 50 51 52 53 54 55 56 Alanine (A) 0 7.6 0 0.2 0 0 0 0 Serine (S) 3.6 12.6 4.4 8.3 1.4 0 0 100 Glycine (G) 0 10.2 0.4 0.9 0 0 0 0 Phenylalanine (F) 9.3 0.6 0.6 0.8 0 0 0 0 Proline (P) 0 0 0 0 0 0 100 0 Valine (V) 0 0.6 2 0.5 0.4 0 0 0 Tyrosine (V) 77.6 2.6 1.4 3.6 1.3 0 0 0 Methionine (M) 0 1 0 0 1.1 0 0 0 Threonine (T) 0 3.2 5.6 8.5 0 0 0 0 Lysine (K) 0 3.6 0.8 2.1 20.2 0 0 0 Isoleucine (I) 0 1.2 1.2 3.5 1.9 0 0 0 Tryptophan (W) 0 0.5 0 0 0 0 0 0 Aspartic acid (D) 0.7 26.8 14.3 16.4 2 0 0 0 Histidine (H) 5.4 0.9 1.4 3.5 4.5 0 0 0 Asparagine (N) 0.9 13.7 67.5 49.9 22.9 0 0 0 Arginine (R) 0.4 3.3 0.4 1 2.3 100 0 0 Glutamic acid (E) 0 9.3 0 0.8 5.6 0 0 0 Cysteine (C) 0.1 0 0 0 0 0 0 0 Leucine (L) 0.8 1.6 0 0 5.9 0 0 0 Glutamine (Q) 1.2 0.7 0 0 30.5 0 0 0 Total 100 100 100 100 100 100 100 100

    TABLE-US-00042 TABLE 42 Amino acid distribution ratio for each position of amino acid (%)-Vλ1-51_CDR3 Type of AA 4 5 6 7 8 9 10 11 12 13 14 Alanine (A) 43.398 30.048 0.515 0.000 3.506 1.570 0.048 1.262 25.973 4.082 2.530 Serine (S) 5.725 28.002 0.000 0.000 29.684 68.271 9.047 30.570 4.785 4.329 0.014 Glycine (G) 13.804 0.645 0.021 0.206 5.221 3.943 0.631 1.968 22.224 7.800 0.048 Phenylalanine (F) 0.000 0.055 1.785 0.000 0.062 0.095 0.007 0.048 1.104 1.749 0.843 Proline (P) 0.045 0.048 0.000 0.000 0.034 0.823 0.572 0.082 0.523 5.427 0.014 Valine (V) 1.400 13.175 0.007 0.014 0.741 0.720 1.235 0.446 4.431 21.350 57.634 Tyrosine (V) 0.021 0.027 17.221 0.007 1.358 1.152 0.034 1.323 1.145 16.280 0.007 Methionine (M) 0.000 0.000 0.014 0.021 0.007 0.000 0.014 0.000 0.007 1.599 4.039 Threonine (T) 0.796 24.587 0.021 0.000 5.734 4.848 2.138 6.370 2.483 0.027 0.007 Lysine (K) 0.007 0.000 0.000 0.000 1.694 0.672 0.000 4.210 0.007 0.007 0.000 Isoleucine (I) 0.000 1.234 0.007 0.021 2.627 2.489 1.104 1.125 2.071 0.059 8.736 Tryptophan (W) 0.000 0.014 78.605 0.000 0.027 0.000 0.027 0.000 0.021 20.115 0.027 Aspartic acid (D) 0.007 0.000 0.000 99.509 33.992 2.352 0.919 14.544 3.251 0.007 0.014 Histidine (H) 1.208 0.014 1.256 0.000 1.262 0.014 0.007 2.592 16.160 2.422 0.000 Asparagine (N) 0.000 0.041 0.000 0.069 12.129 9.333 2.778 31.914 1.454 0.007 0.000 Arginine (R) 0.055 0.000 0.419 0.027 1.056 2.619 0.247 2.167 1.063 2.628 0.027 Glutamic acid (E) 1.256 0.021 0.000 0.027 0.844 0.007 0.007 1.323 1.482 1.688 0.000 Cysteine (C) 0.000 0.007 0.048 0.000 0.034 0.021 0.021 0.007 0.041 0.034 0.021 Leucine (L) 1.311 2.085 0.082 0.000 0.027 1.070 80.988 0.041 5.823 9.378 25.989 Glutamine (Q) 30.464 0.000 0.000 0.000 0.000 0.000 0.027 0.007 2.648 1.002 0.000 Total 100 100 100 100 100 100 100 100 100 100 100

    [0162] In the present invention, the fragment of antibody may have one or more forms selected from the group consisting of Fab, F(ab′).sub.2, Fab′, Fv and scFv, but is not limited thereto.

    [0163] The antibody or a fragment thereof according to the present invention may have one or more characteristics selected from the group consisting of: i) redundancy (percentage of repetitive sequences) of 10% or less; ii) p-value of CDR composition >0.05; iii) thermal stability of 70° C. or higher; and iv) diversity (library size) of 10.sup.7 or more.

    [0164] In another aspect, the present invention is directed to nucleic acids encoding a set of antibodies or fragments thereof.

    [0165] In another aspect, the present invention is directed to a method of identifying an antibody or fragment thereof specific for an antigen including (a) contacting an antigen with the set of antibodies, and (b) selecting one or more antibodies or antibody fragments that bind to the antigen.

    [0166] In the present invention, the set of antibodies may be expressed on the surface of the phage included in a transformant introduced with the nucleic acid encoding the set of antibodies, but is not limited thereto.

    [0167] In the present invention, the identification method may include culturing the transformant and phage of the library, binding the antibody expressed on the phage surface to an antigen, and screening and selecting a transformant expressing a desired antibody. The screening and selection may be performed using various techniques known in the art.

    [0168] For example, an antibody that binds to a specific antigen may be produced by isolation from the library using a panning method. The panning includes binding phages to a target antigen, removing unbound phages, recovering bound phages, infecting host cells with the phages to amplify the number of phages, and repeating this process 2 to 4 times.

    EXAMPLE

    [0169] Hereinafter, the present invention will be described in more detail with reference to examples. However, it will be obvious to those skilled in the art that these examples are provided only for illustration of the present invention and should not be construed as limiting the scope of the present invention.

    Example 1) Acquisition of Asian and Caucasian Human Variable-Region cDNAs

    [0170] In order to analyze the amino acid combination of Asian and Caucasian human antibody variable-region CDRs, Asian human messenger RNA was first obtained by differentiating B-cells from PBMCs through blood donation (before IRB implementation) by a researcher in the laboratory. Caucasian messenger RNA used herein was human spleen total RNA (CAT No. 636525, Lot No. 1107171A) produced by Clontech Laboratories Inc. The obtained Asian and Caucasian messenger RNAs were converted to cDNAs using an ImProm-II Reverse Transcription System (Promega, CAT No. A3802). In order to secure the human variable-region genes from the obtained cDNA, Asian and Caucasian cDNAs were used as templates, a forward primer (Table 43: SEQ ID NO: 71) and a reverse primer (Table 43: SEQ ID NO: 72) were added to a VH1 type, a forward primer (Table 43: SEQ ID NO: 73) and a reverse primer (Table 43: SEQ ID NO: 72) were added to a VH3 type, a forward primer (Table 43: SEQ ID NO: 74) and a reverse primer (Table 43: SEQ ID NO: 75) were added to a Vk1 type, a forward primer (Table 43: SEQ ID NO: 76) and a reverse primer (Table 43: SEQ ID NO: 75) were added to a Vk3 type, and a forward primer (Table 43: SEQ ID NO: 77) and a reverse primer (Table 43: SEQ ID NO: 78 were added to a Vλ1 type, and then PCR was performed for each mixture of cDNA and primers using Platinum mix polymerase (Invitrogen, CAT No. 11306). PCR conditions were as follows: exposure at 94° C. for 3 minutes, followed by 25 repetitions of a cycle including exposure at 94° C. for 1 minute, exposure at 55° C. for 1 minute, and exposure at 72° C. for 2 minutes, and then reaction at 72° C. for 10 minutes. The amplified genes were identified as DNA bands having the expected sizes in 1% agarose gel and were each isolated using a gel extraction kit (QIAquick Gel Extraction Kit, QIAGEN, CAT. No. 28706).

    TABLE-US-00043 TABLE 43 SEQ ID Name Sequence NO VH1 Fo CARGTGCAGCTKGTGCAGTCTGG 71 JH TGAGGAGACGGTGACCAGGGTGCC 72 Re_cDNA VH3 Fo GARGTGCAGCTGGTGGAGTCTGG 73 Vk1 Fo GACATCCAGATGACCCAGTCTCC 74 Jk ACGTTTGATTTCCACCTTGGTCCC 75 Re_cDNA Vk3 Fo GAAATWGTGWTGACRCAGTCTCC 76 Vλ Fo CAGTCTGTGYTGACKCAGCCGCC 77 Jλ ACCTAGGACGGTCAGCTTGGTCCC 78 Re_cDNA

    Example 2) Construction of Asian and Caucasian Human Antibody Variable-Region Libraries for High-Throughput Sequencing

    [0171] In order to perform high-throughput sequencing of Asian and Caucasian cDNAs obtained in Example 1, PCR was performed to connect barcodes to identify respective types. First, regarding Asian cDNA, a forward primer (Table 44: SEQ ID NO: 79) and a reverse primer (Table 44: SEQ ID NO: 89) were added to Asian VH1 cDNA as a template, a forward primer (Table 44: SEQ ID NO: 80) and a reverse primer (Table 44: SEQ ID NO: 89) were added to a VH3 type, a forward primer (Table 44: SEQ ID NO: 81) and a reverse primer (Table 44: SEQ ID NO: 90) were added to a Vk1 type, a forward primer (Table 44: SEQ ID NO: 81) and a reverse primer (Table 44: SEQ ID NO: 90) were added to a Vk3 type, a forward primer (Table 44: SEQ ID NO: 83) and a reverse primer (Table 44: SEQ ID NO: 91) were added to a Vλ1 type, and then PCR was performed for each mixture of cDNA and primers using a prime star mix (Takara, CAT No. R040B). PCR conditions were as follows: exposure at 94° C. for 2 minutes, followed by 10 repetitions of a cycle including exposure at 94° C. for 15 minutes, exposure at 55° C. for 15 minutes, and exposure at 72° C. for 30 minutes, and reaction at 72° C. for 5 minutes. The amplified genes were identified as DNA bands of the expected sizes in 1% agarose gel, and were individually isolated using a gel extraction kit (QIAquick Gel Extraction Kit, QIAGEN, CAT. No. 28706). Regarding Caucasian cDNA, a forward primer (Table 44: SEQ ID NO: 84) and a reverse primer (Table 44: SEQ ID NO: 89) were added to Caucasian VH1 cDNA as a template, a forward primer (Table 44: SEQ ID NO: 85) and a reverse primer (Table 44: SEQ ID NO: 89) were added to a VH3 type, a forward primer (Table 44: SEQ ID NO: 86) and a reverse primer (Table 44: SEQ ID NO: 90) were added to a Vk1 type, a forward primer (Table 44: SEQ ID NO: 87) and a reverse primer (Table 44: SEQ ID NO: 90) were added to a Vk3 type, and a forward primer (Table 44: SEQ ID NO: 88) and a reverse primer (Table 44: SEQ ID NO: 91) were added to a Vλ1 type, and then PCR was performed for each mixture of cDNA and primers using a prime star mix (Takara, CAT No. R040B). The PCR conditions were as follows: exposure at 94° C. for 2 minutes, followed by 10 repetitions of a cycle including exposure at 94° C. for 15 minutes, exposure at 55° C. for 15 minutes, and exposure at 72° C. for 30 minutes, and then reaction at 72° C. for 5 minutes. The amplified genes were identified as DNA bands of the expected sizes in 1% agarose gel and were each isolated using a gel extraction kit (QIAquick Gel Extraction Kit, QIAGEN, CAT. No. 28706).

    [0172] The obtained Asian and Caucasian genes were sequenced in the numbers shown in Table 45 using a 454 sequencing (GS FLX Titanium, Roche) method by Macrogen (Guro-gu, Seoul, Korea). The composition ratio of the CDR amino acids of the sequences for CDR1, CDR2 and CDR3 based on the amino acids shown in Table 46 was analyzed.

    TABLE-US-00044 TABLE 44 Name Sequence SEQ ID NO VH1 Fo CCATCTCATCCCTGCGTGTCTCCGACTCAGACGAGTGCGTC 79 Asian ARGTGCAGCTKGTGCAGTCTGG VH3 Fo CCATCTCATCCCTGCGTGTCTCCGACTCAGACGAGTGCGTC 80 Asian ARGTGCAGCTKGTGCAGTCTGG Vkl Fo CCATCTCATCCCTGCGTGTCTCCGACTCAGACGCTCGACAG 81 Asian ARGTGCAGCTGGTGGAGTCTGG Vk3 Fo CCATCTCATCCCTGCGTGTCTCCGACTCAGAGACGCACTCG 82 Asian ACATCCAGATGACCCAGTCTCC Vλ1 Fo CCATCTCATCCCTGCGTGTCTCCGACTCAGAGCACTGTAGG 83 Asian AAATWGTGWTGACRCAGTCTCC VH1 Fo CCATCTCATCCCTGCGTGTCTCCGACTCAGATCAGACACGC 84 Caucasian AGTCTGTGYTGACKCAGCCGCC VH3 Fo CCATCTCATCCCTGCGTGTCTCCGACTCAGATATCGCGAGC 85 Caucasian ARGTGCAGCTKGTGCAGTCTGG Vk1 Fo CCATCTCATCCCTGCGTGTCTCCGACTCAGCGTGTCTCTAG 86 Caucasian ARGTGCAGCTGGTGGAGTCTGG Vk3 Fo CCATCTCATCCCTGCGTGTCTCCGACTCAGCTCGCGTGTCG 87 Caucasian ACATCCAGATGACCCAGTCTCC Vλ1 Fo CCATCTCATCCCTGCGTGTCTCCGACTCAGTAGTATCAGCG 88 Caucasian AAATWGTGWTGACRCAGTCTCC JH Re CCTATCCCCTGTGTGCCTTGGCAGTCTCAGTGAGGAGACGG 89 TGACCAGGGTGCC Jk Re CCTATCCCCTGTGTGCCTTGGCAGTCTCAGACGTTTGATTT 90 CCACCTTGGTCCC Jλ Re CCTATCCCCTGTGTGCCTTGGCAGTCTCAGACCTAGGACGG 91 TGACCTTGGTCCC

    Example 3) High-Throughput Sequencing Data Analysis and Primer Design Based Thereon

    [0173] More than 10000 human variable-region sequences were obtained for each race and type through high-throughput sequencing (Table 45). In order to detect the amino acid combinations of the CDR regions among the obtained human variable-region sequences, for the CDR1 of VH1 type, the region between serine-cysteine (Kabat numbers 22, 23) and tryptophan-valine (Kabat numbers 36, 37) was analyzed, for the CDR2 of VH1 type, the region between glutamic acid-tryptophan (Kabat numbers 47, 48) and arginine-random-threonine (Kabat numbers 67, 68, 69) was analyzed and for the CDR3 of VH1 type, the region between tyrosine-tyrosine-cysteine (Kabat numbers 90, 91, 92) and glycine-threonine-leucine (Kabat numbers 103, 104, 105) was analyzed. For the CDR1 of VH3 type, the region between serine-cysteine (Kabat numbers 22, 23) and tryptophan-valine (Kabat numbers 36, 37) was analyzed, for the CDR2 of VH3 type, the region between glutamic acid-tryptophan (Kabat numbers 47, 48) and lysine-glycine-arginine (Kabat numbers 67, 68, 69) was analyzed, and for the CDR3 of VH3 type, the region between tyrosine-tyrosine-cysteine (Kabat numbers 90, 91, 92) and glycine-threonine-leucine (Kabat numbers 103, 104, 105) was analyzed. For the CDR1 of Vk1 type, the region between isoleucine-random-cysteine (Kabat numbers 21, 22, 23) and tryptophan-tyrosine (Kabat numbers 35, 36) was analyzed, for the CDR2 of Vk1 type, the region between isoleucine-tyrosine (Kabat numbers 48, 49) and glycine-valine (Kabat numbers 57, 58) was analyzed, and for the CDR3 of Vk1 type, the region between tyrosine-tyrosine-cysteine (Kabat numbers 86, 87, 88) and glycine-threonine-lysine (Kabat number 101, 102, 103) was analyzed. For the CDR1 of Vk3, the region between serine-cysteine (Kabat numbers 22,23) and tryptophan-tyrosine (Kabat numbers 35,36) was analyzed, for the CDR2 of Vk3, the region between leucine-isoleucine (Kabat numbers 47,48) and isoleucine-proline (Kabat numbers 58,59) was analyzed, and for the CDR3 of Vk3, the region between tyrosine-tyrosine-cysteine (Kabat numbers 86,87,88) and glycine-threonine-lysine (Kabat numbers 101, 102, 103) was analyzed. For the CDR1 of Vλ1, the region between serine-cysteine (Kabat numbers 22, 23) and tryptophan-tyrosine (Kabat numbers 35, 36) was analyzed, for the CDR2 of Vλ1, the region leucine-isoleucine (Kabat numbers 47, 48) and serine-glycine (Kabat number 56, 57) was analyzed, and for the CDR3 of Vλ1, the region between tyrosine-tyrosine-cysteine (Kabat numbers 86, 87, 88) and glycine-threonine-lysine (Kabat numbers 101, 102, 103) was analyzed (Table 46). VH1 and VH3 types have various lengths of CDR3, so the amino acid combinations were identified after analyzing each of 9 to 14 amino acids, which are the lengths that enable most efficient selection of antibodies when producing synthetic libraries based on conventional literature.

    [0174] The result of analysis showed that no significant difference was found between Asian and Caucasian CDR amino acid combinations, i.e., that they are quite similar. CDR1 and CDR2 of VH have various amino acid combinations, but contain amino acids conserved at a higher rate than CDR3. The reason for this is that these are V-gene regions that have no V-D-J joining, so the possibility of introducing mutations is lower than in the case of CDR3, and there are amino acids that should be conserved due to the presence of residue numbers that affect structural stability. No significant difference was found between the CDR3 of VH1 and the CDR3 of VH3, and it was found that they had similar amino acid combinations. This is because the V-gene ends of VH1 and VH3 are commonly conserved as tyrosine-tyrosine-cysteine-alanine-arginine/lysine, and identical genes are applied to D and J genes during V-D-J joining.

    [0175] According to the analysis result, the average of the combinations of Asian and Caucasian CDR amino acids was calculated and reflected in the primer codon design. In addition, as CDR3s of VH1 and VH3 are similar, primers constituting CDR3 were shared. In addition, there is a risk of reduction in antibody titer due to N-glycosylation, because the ratio of amino acids NXS/T of Kabat No. 52-52a-53 of CDR2 of VH1 and CDR2 of VH3 of Kabat No. 52a-53-54 is about 5%. For this reason, the possibility of N-glycosylation was eliminated by lowering the ratio of asparagine at 52 of VH1 and 52a of VH3 to 0%.

    TABLE-US-00045 TABLE 45 Number of Sequence Name Analysis VH1 Asian 33,572 VH3 Asian 27,587 Vk1 Asian 44,113 Vk3 Asian 23,762 Vλ1 Asian 16,980 VH1 Caucasian 22,455 VH3 Caucasian 22,508 Vk1 Caucasian 28,467 Vk3 Caucasian 15,260 Vλ1 Caucasian 19,381

    TABLE-US-00046 TABLE 46 1 2 3 VH1 Asian SC-WV EW-RXT YYC-GTL VH3 Asian SC-WV EW-KGR YYC-GTL Vk1 Asian IXC-WY IY-GV YYC-GTK Vk3 Asian SC-WY LI-IP YYC-GTK Vλ1 Asian SC-WY LI-SG YYC-GTK VH1 Caucasian SC-WV EW-RXT YYC-GTL VH3 Caucasian SC-WV EW-KGR YYC-GTL Vk1 Caucasian IXC-WY IY-GV YYC-GTK Vk3 Caucasian SC-WY LI-IP YYC-GTK Vλ1 Caucasian SC-WY LI-SG YYC-GTK

    Example 4) Construction of Fab Library

    4-1) Construction of Light-Chain Variable-Region Library

    [0176] 1) VL Frame sequence synthesis: sequences of frames 1 to 3 of human VLκ1-39, VLκ3-20, and VLλ1-51 (Table 47) were synthesized by Bioneer (http://www.bioneer.com.kr) upon request, and thus acquired.

    TABLE-US-00047 TABLE 47 Fragment 1 Fragment 2 Fragment 3 VLκ DIQMTQSPSSLSASVGD WYQQKPGKAPK GVPSRFSGSGSGTDFTLTISSLQP 1- RVTITCRASQ (SEQ LLIY (SEQ EDFATYYCQQ (SEQ ID NO: 39 ID NO: 17) ID NO: 18) 19) VLκ EIVLTQSPGTLSLSPGE WYQQKPGQAPR IPDRFSGSGSGTDFTLTISRLEPE 3- RATLSCRASQ (SEQ LLI (SEQ ID DFAVYYCQQ (SEQ ID NO: 20 ID NO: 22) NO: 23) 24) VLλ QSVLTQPPSVSAAPGQK WYQQLPGTAPK RPSGIPDRFSGSKSGTSATLGITG 1- VTISCSG (SEQ ID LLI (SEQ ID LQTGDEADYYC (SEQ ID NO: 51 NO: 32) NO: 33) 34) CLκ TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESV TEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 133) CLλ QPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETT KPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC (SEQ ID NO: 134)

    [0177] 2) Primary PCR amplification (Fragment PCR): VL CDR1 to CDR3 fragments (Fragments 1 to 3) were amplified by PCR using each frame sequence as a template (5 ng/reaction). The primer sequences used in PCR are shown in Table 48. In the above sequence, the number X means 3 bases, and in the sequence listing file, this is indicated as “NNN”. The reaction was conducted using an AccuPower Pfu PCR PreMix (Bioneer, K-2025) for 30 cycles (at 95° C. for 30 seconds, at 50 to 58° C. for 30 seconds, at 72° C. for 1 minute). Each PCR product was subjected to electrophoresis and then purified using a QIAquick Gel Extraction Kit (QIAGEN, CAT. NO. 28706).

    TABLE-US-00048 TABLE 48 SEQ ID Name Direction Sequence NO VLκ1- Forward GAATTCAGGAGGAATTTAAAATGAAAAAGACAGCTATCG 92 39_F1 Reverse GGCMCCCTGGTTTCTGCTGATACCAX5TAN5X4X3X2 93 TAN4X1N3N2GACTCGCACN1GCAGGTGATTGTAACGCG ATCTCCTAC VLκ1- Forward TGGTATCAGCAGAAACCAGGGAAAGCC 94 39_F2 Reverse GCCACTAAAACGGCTCGGAACGCCX21X20AN10GX19A 95 N9TX18X17ATAAATCAGGAGCTTCGGTGCTTTCCC VLK1- Forward GGCGTTCCGAGCCGTTTTAGTGGC 96 39_F3 Reverse TTTAATTTCCACTTTGGTACCCTGCCCGAATGTX31CGG 97 X30X29X28X27N14TN15N14N13GACAGTAATAGGTA GCAAAATCCTCAGGCTGCAG VLκ3- Forward GAATTCAGGAGGAATTTAAAATGAAAAAGACAGCTATCG 92 20_F1 Reverse TGCCTGACCAGGCTTTTGTTGGTACCATGCAN8CX11X1 98 0X9X8X7X6N7TN6ACTCGCACN1GCAGCTAAGGGTAGC ACGTTCACCTGG VLκ3- Forward GCATGGTACCAACAAAAGCCTGGTCAGGCA 99 20_F2 Reverse GGAGCCAGAGAAACGGTCCGGAATAN1CAGN12AN11CA 100 CGX26X25X24X23X22GATCAGCAGACGTGGTGCCTGA CC VLκ3- Forward ATTCCGGACCGTTTCTCTGGCTCC 101 20_F3 Reverse TTTAATTTCCACTTTGGTACCCTGCCCGAATGTX31CGG 102 X35X34X33X32N16TGN7N16GACAGTAATAAACAGCA AAATCCTCAGGTTCTAAACG VLκ3- Forward GAATTCAGGAGGAATTTAAAATGAAAAAGACAGCTATCG 92 20- Reverse TGCCTGACCAGGCTTTTGTTGGTACCATGCAN8CX16X1 103 2_F1 5X14X13X12N3N2GACTCGCACN1GCAGCTAAGGGTAG CACGTTCACCTGG VLλ1- Forward GAATTCAGGAGGAATTTAAAATGAAAAAGACAGCTATCG 92 51_F1 Reverse TGCTGTACCTGGAAGCTGTTGATACCAX41CACX40X39 104 X38TN18CAAN17ATTAGAX37X36GCCAGAGCACGAGA TGGTCACCTTTTG VLλ1- Forward TGGTATCAACAGCTTCCAGGTACAGCA 105 51_F2 Reverse ACGATCCGGAATACCGGAAGGACGX46X45X44X43X42 106 AATCAATAACTICGGTGCTGTACCTGG VLλ1- Forward CGTCCTTCCGGTATTCCGGATCGT 107 51_F3 Reverse CGTAAGITTGGIGCCACCACCGAAX56X55X54X53X52 108 X51X5OATCX49X48X47GCAGTAGTAATCGGCTTCGTC GCC CLκ Forward GGGCAGGGTACCAAAGTGGAAATTAAACGCACGGTGGCT 109 GCCCCTTCTGTGTTC Reverse AATTATCTAGAACTAGCACTCACCCCTGTTGAA 110 CLλ Forward GGTGGTGGCACCAAACTTACGGTCCTAGGCCAGCCCAAG 111 GCCAACCCCACTGTC Reverse TTATCTAGAACTAACATTCTGTAGGGGCCACTGTCTTCT 112 C

    [0178] N1 to N8 of SEQ ID NO: 93 (Vk1-39-F1), SEQ ID NO: (Vk3-20-F1) and SEQ ID NO: 103 (Vk3-20-2-F1) were designed to have the base ratio shown in Table 49 below, and PCR was performed.

    TABLE-US-00049 TABLE 49 N1 N2 N3 N4 N5 N6 N7 N8 A 0 1 5 0 0 0 5 6 T 10 95 0 85 0 0 95 88 G 0 0 0 3 92 95 0 0 C 90 4 95 12 8 5 0 6

    [0179] X1 to X16 of SEQ ID NO: 93 (Vk1-39-F1), SEQ ID NO: 98 (Vk3-20-F1) and SEQ ID NO: 103 (Vk3-20-2-F1) were designed to have the codon ratio shown in Table 50 below, and PCR was performed.

    TABLE-US-00050 TABLE 50 AA X1 X2 X3 X4 X5 X6 X7 X8 X9 X10 X11 X12 X13 X14 X15 X16 AAC (anti-Val) V 1.5 1 1 0 2.5 0 68 1 0.5 0.5 0 0 63 1 1 0 ACC (anti-Gly) G 20 12 4 1 5 3 0 7 9 4.5 0 5 0 16.5 5 1 AGA (anti-Ser) S 32 37.5 20.5 8.5 4 64.5 0 43 54.5 26 8 70.5 0 39 34 8 ATC (anti-Asp) D 22.5 5.5 5.5 5 1 1 0 5.5 2.5 5.5 2 2.5 0 5.5 3 4.5 ATG (anti-His) H 1 1 2 4.5 2.5 0.5 0 1 0.5 0.5 5 0 0 1 1 4.5 CAG (anti-Leu) L 0 1 0.5 2 0 0 9 0.5 0.5 0.5 1 0 6 1 0 1.5 CAT (anti-Met) M 0 0 0.5 0 0 0 0.5 0 0 0 0 0 0 0 0 0 CCA (anti-Trp) W 0 0 0 22.5 0 0 0 0 0 0 1 0 0 0 0 1 CGG (anti-Pro) P 1 0 1 0 0 1 0 2.5 0 1 0 0.5 0 0 0.5 0 CTG (anti-Gln) Q 0 0 0 0.5 0 0 0 0 0 0 1.5 0 0 0 0 1.5 GAA (anti-Phe) F 1 1 1 8.5 0 1 2.5 1 0 1 13.5 0 1 0.5 1 7 GAT (anti-Ile) I 1 2 4 0 1 3 19.5 3 2 2 0 1 29 1.5 4.5 0 GCA (anti-Cys) C 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 GCG (anti-Arg) R 3 10.5 7.5 2.5 0 5 0 8.5 5.5 7.5 1 2.5 0 8.5 8.5 1 GGT (anti-Thr) T 11 7 16.5 0 1.5 14.5 0 11.5 6.5 12 0 7.5 0 6 18 1 GTA (anti-Tyr) V 1.5 2 2 39 0 1 0 2 1.5 1 62 1 0 2 2.5 33.5 GTT (anti-Asn) N 0 13 26.5 3 38 4.5 0 8.5 14.5 33 4 9 0 12 16.5 31 TGC (anti-Ala) A 4 3.5 1 2 44.5 1 0.5 4 2 2.5 0 0.5 1 3.5 2 0.5 TTC (anti-Glu) E 0 1 1 1 0 0 0 0 0 0 0 0 0 0.5 0 0.5 TTT (anti-Lys) K 0.5 2 5.5 0 0 0 0 1 0.5 2.5 1 0 0 1.5 2.5 3.5 total 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100

    [0180] N of SEQ ID NO: 95 (Vk1-39-F2) was designed to have the base ratio shown in Table 51 below, and PCR was performed.

    TABLE-US-00051 TABLE 51 N9 N10 A 0 91 T 0 0 G 6 0 C 94 9

    [0181] X of SEQ ID NO: 95 (Vk1-39-F2) was designed to have the codon ratio shown in Table 52 below, and PCR was performed.

    TABLE-US-00052 TABLE 52 AA X17 X18 X19 X20 X21 AAC (anti-Val) V 2 7 2 1 1 ACC (anti-Gly) G 12.5 2.5 2 2.5 7 AGA (anti-Ser) S 6.5 4.5 23.5 0 50.5 ATC (anti-Asp) D 14.5 0 2 3.5 3 ATG (anti-His) H 1 0 1.5 6.5 0 CAG (anti-Leu) L 2 0 0.5 1.5 0.5 CAT (anti-Met) M 1 0 0 0 0 CCA (anti-Trp) W 6 0 0 0 0 CGG (anti-Pro) P 0.5 0.5 0 1.5 3.5 CTG (anti-Gln) Q 2.5 0 0 38.5 0 GAA (anti-Phe) F 0.5 0 1.5 0.5 1 GAT (anti-Ile) I 0.5 1.5 6.5 0 2.5 GCA (anti-Cys) C 0 0 0 0 0 GCG (anti-Arg) R 5 0 5 3 5.5 GGT (anti-Thr) T 5 12.5 28.5 0 15.5 GTA (anti-Tyr) V 0.5 0 2 1 0.5 GTT (anti-Asn) N 0 0 19 1 6 TGC (anti-Ala) A 20 70 3 3 3 TTC (anti-Glu) E 5.5 1.5 0 33.5 0 TTT (anti-Lys) K 14.5 0 3 3 0.5 total 100 100 100 100 100

    [0182] N of SEQ ID NO: 100 (Vk3-20-F2) was designed to have the base ratio shown in Table 53 below, and PCR was performed.

    TABLE-US-00053 TABLE 53 N11 N12 N1 A 5 8 0 T 0 72 10 G 95 8 0 C 0 12 90

    [0183] X of SEQ ID NO: 100 (Vk3-20-F2) was designed to have the codon ratio shown in Table 54 below, and PCR was performed.

    TABLE-US-00054 TABLE 54 AA X22 X23 X24 X25 X26 AAC (anti-Val) V 0 1 7 1 0.5 ACC (anti-Gly) G 0 45 3.5 0 1.5 AGA (anti-Ser) S 6.5 4.5 5 80 24.5 ATC (anti-Asp) D 1 29.5 0 0 2 ATG (anti-His) H 8 1.5 0 0 1.5 CAG (anti-Leu) L 1 0.5 0.5 1 0.5 CAT (anti-Met) M 0 0 0 0 0.5 CCA (anti-Trp) W 0.5 0 0 0 0 CGG (anti-Pro) P 0 0 1.5 1 0 CTG (anti-Gln) Q 1 0 0 0 0 GAA (anti-Phe) F 11 0 0 7 1 GAT (anti-Ile) I 0.5 0 2.5 1 5.5 GCA (anti-Cys) C 0 0 0 0 0 GCG (anti-Arg) R 0 2.5 0 0 7.5 GGT (anti-Thr) T 0 1.5 15 4 23.5 GTA (anti-Tyr) V 69.5 0.5 0 2.5 2 GTT (anti-Asn) N 1 1.5 0 0 21.5 TGC (anti-Ala) A 0 9.5 64.5 2.5 2.5 TTC (anti-Glu) E 0 2.5 0.5 0 0 TTT (anti-Lys) K 0 0 0 0 5.5 total 100 100 100 100 100

    [0184] N of SEQ ID NO: 97 (VLκ1-39_F3) and SEQ ID NO: 102 (VLκ3-20_F3) was designed to have the base ratio shown in Table 55 below, and PCR was performed.

    TABLE-US-00055 TABLE 55 N13 N14 N15 N7 N16 A 10 0 0 5 0 T 90 95 5 95 90 G 0 5 95 0 10 C 0 0 0 0 0

    [0185] X of SEQ ID NO: 97 (VLκ1-39_F3) and SEQ ID NO: 102 (VLκ3-20_F3) was designed to have the codon ratio shown in Table 56 below, and PCR was performed.

    TABLE-US-00056 TABLE 56 AA X27 X28 X29 X30 X31 X32 X23 X34 X35 AAC (anti-Val) V 1 0.5 1 4 3 0.5 2.5 1 1 ACC (anti-Gly) G 2 1 6.5 1 2 4 25.5 5.5 1 AGA (anti-Ser) S 17 6 45 7 1 5.5 12 31.5 34 ATC (anti-Asp) D 2.5 10.5 5 1 0.5 0.5 6.5 6.5 0 ATG (anti-His) H 6 5.5 1 1.5 2.5 3 2.5 4 0 CAG (anti-Leu) L 3.5 1 1 7 23 1 6.5 1 5 CAT (anti-Met) M 0 0 0 1 0 0 0 0 0 CCA (anti-Trp) W 0 0 0 0 17 0 0 0 28 CGG (anti-Pro) P 0 0 0 3.5 7.5 0 0 0 3.5 CTG (anti-Gln) Q 0 0.5 0 0 3 0 0 6.5 0 GAA (anti-Phe) F 4.5 5 1 11.5 8 3.5 2 1 2.5 GAT (anti-Ile) I 0 1 3 4 2 0 2 2 2 GCA (anti-Cys) C 0 0 0 0 0 0 0 0 0 GCG (anti-Arg) R 0 1 4.5 0.5 13.5 14 1.5 4 1 GGT (anti-Thr) T 5 1.5 14.5 19 0 1 5 11 12.5 GTA (anti-Tyr) V 54 39 1 28.5 14.5 62 15 2 4 GTT (anti-Asn) N 1 21.5 12 2.5 0.5 0.5 11.5 19 1 TGC (anti-Ala) A 3.5 1 2.5 8 0.5 4.5 4 2 4.5 TTC (anti-Glu) E 0 1.5 1 0 0.5 0 2 1 0 TTT (anti-Lys) K 0 3.5 1 0 1 0 1.5 2 0 total 100 100 100 100 100 100 100 100 100

    [0186] N of SEQ ID NO: 104 (VLλ1-51_F1) was designed to have the base ratio shown in Table 57 below, and PCR was performed.

    TABLE-US-00057 TABLE 57 N17 N18 A 0 0 T 90 5 G 0 5 C 10 90

    [0187] X of SEQ ID NO: 104 (VLλ1-51_F1) was designed to have the codon ratio shown in Table 58 below, and PCR was performed.

    TABLE-US-00058 TABLE 58 AA X36 X37 X38 X39 X40 X41 AAC (anti-Val) V 0 0 1.5 0 1.5 0 ACC (anti-Gly) G 10.5 5 4.5 1 1 0 AGA (anti-Ser) S 74 54 33 4.5 10 39.5 ATC (anti-Asp) D 2 2.5 5 2.5 3.5 1 ATG (anti-His) H 0 1 1 6.5 3.5 4.5 CAG (anti-Leu) L 0 0 1 0 1 0.5 CAT (anti-Met) M 0 0 0 0 0 0 CCA (anti-Trp) W 0 0 0 0 0 0 CGG (anti-Pro) P 0 0 0.5 0 5 0 CTG (anti-Gln) Q 0 0 0 0.5 0 1 GAA (anti-Phe) F 0 1 0 0.5 11 2.5 GAT (anti-Ile) I 1 1.5 4 1 2 0 GCA (anti-Cys) C 0 0 0 0 0 0 GCG (anti-Arg) R 3 7.5 10 1 0.5 0 GGT (anti-Thr) T 6.5 13 8.5 1.5 16 2 GTA (anti-Tyr) V 0 1 2 6 36.5 16.5 GTT (anti-Asn) N 2 11 22.5 71 2.5 29.5 TGC (anti-Ala) A 1 2 1 0 6 2.5 TTC (anti-Glu) E 0 0 0.5 1 0 0 TTT (anti-Lys) K 0 0.5 5 3 0 0.5 total 100 100 100 100 100 100

    [0188] X of SEQ ID NO: 106 (VLλ1-51_F2) was designed to have the codon ratio shown in Table 59 below, and PCR was performed.

    TABLE-US-00059 TABLE 59 AA X42 X43 X44 X45 X46 AAC (anti-Val) V 0 1.5 5.5 1 1 ACC (anti-Gly) G 0 16.5 1 2 0 AGA (anti-Ser) S 6.5 14 8 13 2 ATC (anti-Asp) D 0.5 22 18 18.5 2.5 ATG (anti-His) H 6 1 2 3.5 4 CAG (anti-Leu) L 0.5 1 0 0 4.5 CAT (anti-Met) M 0 0.5 0 0 1 CCA (anti-Trp) W 0 0.5 0 0 0 CGG (anti-Pro) P 0 0 0 0 0 CTG (anti-Gln) Q 1 1 0 0 29.5 GAA (anti-Phe) F 13.5 1 0.5 1 0 GAT (anti-Ile) I 0 1 1.5 4 2 GCA (anti-Cys) C 0 0 0 0 0 GCG (anti-Arg) R 0.5 9 1 2.5 7 GGT (anti-Thr) T 0 4 8.5 11.5 0 GTA (anti-Tyr) V 71 3 2 4.5 2 GTT (anti-Asn) N 0.5 8 51 34.5 21 TGC (anti-Ala) A 0 6.5 0 0.5 0 TTC (anti-Glu) E 0 7 0 1 7.5 TTT (anti-Lys) K 0 2.5 1 2.5 16 total 100 100 100 100 100

    [0189] X of SEQ ID NO: 108 (VLλ1-51_F3) was designed to have the codon ratio shown in Table 60 below, and PCR was performed.

    TABLE-US-00060 TABLE 60 AA X47 X48 X49 X50 X51 X52 X53 X54 X55 X56 AAC (anti-Val) V 2 18 0 1.5 1 2.5 0.5 7.5 27 79.5 ACC (anti-Gly) G 22 1 0 9.5 7 2 4 34.5 10 0 AGA (anti-Ser) S 6 27 0 34 66 12 37 5 3.5 0 ATC (anti-Asp) D 0 0 0 27 2 1 14 2.5 0 0 ATG (anti-His) H 1 0 1 1 0 0 2 10.5 1 0 CAG (anti-Leu) L 1 1 0 0 0.5 73 0 3 4 10 CAT (anti-Met) M 0 0 0 0 0 0 0 0 1 2 CCA (anti-Trp) W 0 0 76 0 0 0 0 0 22.5 0 CGG (anti-Pro) P 0 0 0 0 0.5 1 0 1 7 0 CTG (anti-Gln) Q 32.5 0 0 0 0 0 0 2 1 0 GAA (anti-Phe) F 0 0 2.5 0 0 0 0 1.5 1.5 0.5 GAT (anti-Ile) I 0 1 0 2.5 2 1 1 2 0 6 GCA (anti-Cys) C 0 0 0 0 0 0 0 0 0 0 GCG (anti-Arg) R 0 0 1 3.5 6.5 1 6.5 1.5 4 0 GGT (anti-Thr) T 1 29 0 8 6.5 3.5 8 3 0 0 GTA (anti-Tyr) V 0 0 19 1 0.5 0 1.5 1 13.5 0 GTT (anti-Asn) N 0 0 0 7.5 6 3 21 1 0 0 TGC (anti-Ala) A 33 23 0.5 3 1 0 1 23 3 2 TTC (anti-Glu) E 1.5 0 0 0.5 0 0 1 1 1 0 TTT (anti-Lys) K 0 0 D 1 0.5 0 2.5 0 0 0 total 100 100 100 100 100 100 100 100 100 100

    [0190] 3) Second PCR amplification (1.sup.st overlapping PCR): the primary PCR products (Fragments 1 to 3) were added as templates (20 ng for each fragment/reaction) and the reaction was conducted for 16 cycles (95° C. for 30 sec, 55° C. for 30 sec, at 72° C. for 1 min). The primer sequences used for PCR are shown in Table 61. Respective PCR products (variable light chains) were subjected to electrophoresis and then purified using a QIAquick Gel Extraction Kit (QIAGEN, CAT. NO. 28706).

    TABLE-US-00061 TABLE 61 SEQ ID Name Direction Sequence NO VLκ1- Forward GAATTCAGGAGGAATTTAAAATGAAAAA 92 39 GACAGCTATCG Reverse ACTAGTGCGTTTAATTTCCACTTTGGTA 113 CCCTGCCC VLκ3- Forward GAATTCAGGAGGAATTTAAAATGAAAAA 92 20 GACAGCTATCG Reverse ACTAGTGCGTTTAATTTCCACTTTGGTA 113 CCCTGCCC VLκ3- Forward GAATTCAGGAGGAATTTAAAATGAAAAA 92 20-2 GACAGCTATCG Reverse ACTAGTGCGTTTAATTTCCACTTTGGTA 113 CCCTGCCC VLλ1- Forward GAATTCAGGAGGAATTTAAAATGAAAAA 92 51 GACAGCTATCG Reverse ACTAGTACCCAGGACCGTAAGTTTGGTG 114 CC

    [0191] 4) Third PCR amplification (2.sup.nd overlapping PCR): the purified 1.sup.st overlapping PCR products were weighed and used as templates (10 ng per each product/reaction) along with CLκ (fragment PCR product) for VLκ1-39, VLκ3-20 and VLκ3-20-2, and along with CLλ (fragment PCR product) for VLλ1-51, and the reaction was conducted for 15 cycles (at 95° C. for 1 min, at 55° C. for 1 min, at 72° C. for 1 min). The primer sequences used in PCR are shown in Table 62. The respective PCR products were subjected to electrophoresis and then purified using a QIAquick Gel Extraction Kit (QIAGEN, CAT. NO. 28706).

    TABLE-US-00062 TABLE 62 SEQ ID Name Direction Sequence NO VLκ1- Forward GAATTCAGGAGGAATTTAAAATGAAAAAGACAGCTATCG 92 39_CLκ Reverse AATTATCTAGAACTAGCACTCACCCCTGTTGAA 109 VLκ3- Forward GAATTCAGGAGGAATTTAAAATGAAAAAGACAGCTATCG 92 20_CLκ Reverse AATTATCTAGAACTAGCACTCACCCCTGTTGAA 109 VLκ3- Forward GAATTCAGGAGGAATTTAAAATGAAAAAGACAGCTATCG 92 20-2_CLκ Reverse AATTATCTAGAACTAGCACTCACCCCTGTTGAA 109 VLλ1- Forward GAATTCAGGAGGAATTTAAAATGAAAAAGACAGCTATCG 92 51_CLλ Reverse TTATCTAGAACTAACATTCTGTAGGGGCCACTGTCTTCTC 111

    [0192] 5) VL library transformation

    [0193] 5-a) Ligation: EcoRI (NEB, CAT. NO. R0101L) was added to the overlapping PCR products of the variable light-chain (VL) and constant light-chain (CL) regions, reaction was conducted at 37° C. overnight (0/N), and then the result was purified using a QIAquick PCR Purification Kit (QIAGEN, CAT. NO. 28106). XbaI (NEB. CAT. NO. R0145L) was added thereto, followed by reaction at 37° C. overnight (0/N) and purification using a QIAquick PCR Purification Kit (QIAGEN, CAT. NO. 28106). T4 DNA Ligase (NEB, CAT. NO. M0203S) was added to 20 μg of insert DNA fragments cut with EcoRI and XbaI and 40 μg of linearized pComb3XTT vector (EcoRI, XbaI cut), followed by reacting at 25° C. overnight (O/N).

    [0194] 5-b) Transformation: the ligated reaction product was purified using a QIAquick PCR Purification Kit (QIAGEN, CAT. NO. 28106). For each light-chain subtype, 1 mL of MC1061F′ (SS320) Competent Cells (Lucigen, CAT. NO. 60512-1) was divided into 10 cuvettes (100 μl/cuvette) and electroporated. SB liquid media was added to adjust the total volume to 500 mL, the result was incubated with shaking at 37° C. and 200 rpm for 1 hour, and 100 μL of culture sup. was spread on an LB agar lop plate+carbenicillin (NaraeBiotech, CAT. NO. LN004CA) through serial dilution, and then incubated at 37° C. overnight to determine the pComb3XTT-Synthetic VL library size. 500 μL of carbenicillin (100 mg/mL) was added to 500 mL of the culture, which was then incubated at 37° C. (200 rpm) overnight.

    4-2) Construction of Heavy-Chain Variable-Region Library

    [0195] 1) VH Frame sequence synthesis: sequences (Table 63) of frames 1 to 3 of human VH1-69, VH3-15 and VH3-23 were synthesized by Bioneer (http://www.bioneer.co.kr) upon request, and thus acquired.

    TABLE-US-00063 TABLE 63 Fragment 1 Fragment 2 Fragment 3 VH1- QVQLVQSGAEVKKPG WVRQAPGQGLEW YAQKFQGRVTITA 69 SSVKVSCKAS (SEQ M (SEQ ID DESTSTAYMELSS ID NO: 12) NO: 13) LRSEDTAVYYCAR (SEQ ID NO: 14) VH3- EVQLVESGGGLVKPG WVRQAPGKGLEW YAAPVKGRFTISR 15 GSLRLSCAASG V (SEQ ID DDSKNTLYLQMNS (SEQ ID NO: 2) NO: 3) LKTEDTAVYYCAR  (SEQ ID NO: 4) VH3- EVQLVESGGGLVQPG WVRQAPGKGLEW YADSVKGRFTISR 23 GSLRLSCAASG V (SEQ ID DNSKNTLYLQMNS (SEQ ID NO: 7) NO: 8) LRAEDTAVYYCAR (SEQ ID NO: 9)

    [0196] 2) Primary PCR amplification (Fragment PCR): VL CDR1 to CDR3 fragments (Fragments 1 to 3) were amplified by PCR using each frame sequence as a template (5 ng/reaction). The primer sequences used for PCR are shown in Table 64. The reaction was conducted using an AccuPower Pfu PCR PreMix (Bioneer, K-2025) for 30 cycles (at 95° C. for 30 sec, at 50 to 55° C. for 30 sec, at 72° C. for 1 min). Each PCR product was subjected to electrophoresis and then purified using a QIAquick Gel Extraction Kit (QIAGEN, CAT. NO. 28706).

    TABLE-US-00064 TABLE 64 SEQ ID Name Direction Sequence NO VH1-69_F1 Forward TTCTAGATAATTAATTAGGAGGAATTTAAAATG 115 AAATACCTATTGCCT Reverse CTGTCCTGGTGCTTGACGAACCCAX62N22AN2 116 0X61X60X59X58GAAX57X63ACCAGACGCTT TACAACTGACTTTAACTGAACT VH1-69_F2 Forward TGGGTTCGTCAAGCACCAGGACAG 117 Reverse CGTAACACGACCTTGGAATTTCTGTGCATAX73 118 X72X71X70X69X68X67X66GATX65X64CAT CCATTCTAAGCCTTGTCCAGG VH1- Forward TATGCACAGAAATTCCAAGGTCGTGTTACGATT 119 69_F3_CDR9 Reverse CACCAGGGTCCCCTGGCCCCAX98X97X96X95 120 X94X93X92X91X90GCGGGCGCAGTAATACAC TGCGGTATCTTC VH1- Forward TATGCACAGAAATTCCAAGGTCGTGTTACGATT 119 69_F3_CDR10 Reverse AACGGTAACCAGTGTACCTTGACCCCAX108X1 121 07X106X105X104X103X102X101X100X99 ACGTGCACAGTAATACACTGCGGTATCTTC VH1- Forward TATGCACAGAAATTCCAAGGTCGTGTTACGATT 119 69_F3_CDR11 Reverse AACGGTAACCAGTGTACCTTGACCCCAX115X1 122 14X113X112X111X110X103X102X101X10 0X109ACGTGCACAGTAATACACTGCGGTATCT TC VH1- Forward TATGCACAGAAATTCCAAGGTCGTGTTACGATT 119 69_F3_CDR12 Reverse AACGGTAACCAGTGTACCTTGACCCCAX120X1 123 19X118X116X112X111X110X103X102X10 1X100X116ACGTGCACAGTAATACACTGCGGT ATCTTC VH1- Forward TATGCACAGAAATTCCAAGGTCGTGTTACGATT 119 69_F3_CDR13 Reverse AACGGTAACCAGTGTACCTTGACCCCAX126X1 124 25X124X123X122X112X111X110X103X10 2X101X100X121ACGTGCACAGTAATACACTG CGGTATCTTC VH1- Forward TATGCACAGAAATTCCAAGGTCGTGTTACGATT 119 69_F3_CDR14 Reverse AACGGTAACCAGTGTACCTTGACCCCAX132X1 125 31X130X129X128X122X112X111X110X10 3X102X101X100X127ACGTGCACAGTAATAC ACTGCGGTATCTTC VH3-15_F1 Forward TTCTAGATAATTAATTAGGAGGAATTTAAAATG 115 AAATACCTATTGCCT Reverse TTTACCTGGTGCCTGACGAACCCAX62N21AN2 126 0X61X60X59X58GAAX57AN19AACCAGATGC TGCACAGCTTAAACGAAG VH3-15F2 Forward TGGGTTCGTCAGGCACCAGGTAAA 127 Reverse ACGACCTTTGACCGGTGCTGCGTAX81AN28N1 128 7AGN27X80ACN26X79X78X77X76TN25TX7 5X75AN24N23CACCCATTCAAGACCTTTACCT GG VH3- Forward TACGCAGCACCGGTCAAAGGTCGT 129 15_F3_CDR9 Reverse CACCAGGGTCCCCTGGCCCCAX98X97X96X95 120 X94X93X92X91X90GCGGGCGCAGTAATACAC TGCGGTATCTTC VH3- Forward TACGCAGCACCGGTCAAAGGTCGT 129 15_F3_CDR10 Reverse AACGGTAACCAGTGTACCTTGACCCCAX108X1 121 07X106X105X104X103X102X101X100X99 ACGTGCACAGTAATACACTGCGGTATCTTC VH3- Forward TACGCAGCACCGGTCAAAGGTCGT 129 15_F3_CDR11 Reverse AACGGTAACCAGTGTACCTTGACCCCAX115X1 122 14X113X112X111X110X103X102X101X10 0X109ACGTGCACAGTAATACACTGCGGTATCT TC VH3- Forward TACGCAGCACCGGTCAAAGGTCGT 129 15_F3_CDR12 Reverse AACGGTAACCAGTGTACCTTGACCCCAX120X1 123 19X118X116X112X111X110X103X102X10 1X100X116ACGTGCACAGTAATACACTGCGGT ATCTTC VH3- Forward TACGCAGCACCGGTCAAAGGTCGT 129 15_F3_CDR13 Reverse AACGGTAACCAGTGTACCTTGACCCCAX126X1 124 25X124X123X122X112X111X110X103X10 2X101X100X121ACGTGCACAGTAATACACTG CGGTATCTTC VH3- Forward TACGCAGCACCGGTCAAAGGTCGT 129 15_F3_CDR14 Reverse AACGGTAACCAGTGTACCTTGACCCCAX132X1 125 31X130X129X128X122X112X111X110X10 3X102X101X100X127ACGTGCACAGTAATAC ACTGCGGTATCTTC VH3-23_F1 Forward TTCTAGATAATTAATTAGGAGGAATTTAAAATG 115 AAATACCTATTGCCT Reverse TTTACCTGGTGCCTGACGAACCCAX62N21AN2 126 0X61X60X59X58GAAX57AN19AACCAGATGC TGCACAGCTTAAACGAAG VH3-23_F2 Forward TGGGTTCGTCAGGCACCAGGTAAA 127 Reverse GGTAAAACGACCCTTAACGCTATCCGCATAX89 130 X88X87X86ACN30X85X84X83GATX82TCN2 9CACCCATTCAAGACCTTTACCTGG VH3- Forward TATGCGGATAGCGTTAAGGGTCGTTTTACC 129 23_F3_CDR9 Reverse CACCAGGGTCCCCTGGCCCCAX98X97X96X95 120 X94X93X92X91X90GCGGGCGCAGTAATACAC TGCGGTATCTTC VH3- Forward TATGCGGATAGCGTTAAGGGTCGTTTTACC 129 23_F3_CDR10 Reverse AACGGTAACCAGTGTACCTTGACCCCAX108X1 121 07X106X105X104X103X102X101X100X99 ACGTGCACAGTAATACACTGCGGTATCTTC VH3- Forward TATGCGGATAGCGTTAAGGGTCGTTTTACC 129 23_F3_CDR11 Reverse AACGGTAACCAGTGTACCTTGACCCCAX115X1 122 14X113X112X111X110X103X102X101X10 0X109ACGTGCACAGTAATACACTGCGGTATCT TC VH3- Forward TATGCGGATAGCGTTAAGGGTCGTTTTACC 129 23_F3_CDR12 Reverse AACGGTAACCAGTGTACCTTGACCCCAX120X1 123 19X118X116X112X111X110X103X102X10 1X100X116ACGTGCACAGTAATACACTGCGGT ATCTTC VH3- Forward TATGCGGATAGCGTTAAGGGTCGTTTTACC 129 23_F3_CDR13 Reverse AACGGTAACCAGTGTACCTTGACCCCAX126X1 124 25X124X123X122X112X111X110X103X10 2X101X100X121ACGTGCACAGTAATACACTG CGGTATCTTC VH3- Forward TATGCGGATAGCGTTAAGGGTCGTTTTACC 129 23_F3_CDR14 Reverse AACGGTAACCAGTGTACCTTGACCCCAX132X1 125 31X130X129X128X122X112X111X110X10 3X102X101X100X127ACGTGCACAGTAATAC ACTGCGGTATCTTC

    [0197] N of SEQ ID NO: 116 (VH1-69_F1) and SEQ ID NO: 126 (VH3-15_F) was designed to have the base ratio shown in Table 65 below, and PCR was performed.

    TABLE-US-00065 TABLE 65 N19 N20 N21 N22 A 70 0 30 40 T 30 90 0 0 G 0 5 0 0 C 0 5 70 60

    [0198] X of SEQ ID NO: 116 (VH1-69_F1) and SEQ ID NO: 126 (VH3-15_F) was designed to have the codon ratio shown in Table 66 below, and PCR was performed.

    TABLE-US-00066 TABLE 66 AA X57 X58 X59 X60 X61 X62 X63 AAC (anti-Val) V 0 0.5 0.5 0.5 2 0.5 1 ACC (anti-Gly) G 1 4.5 5.5 0 19.5 7.5 7.5 AGA (anti-Ser) S 17 45.5 30.5 6 6 22 1 ATC (anti-Asp) D 1 4 14 1 5 1.5 2 ATG (anti-His) H 0 0 1 8 1 32.5 1 CAG (anti-Leu) L 0 0 0 1 0 0 2 CAT (anti-Met) M 1 0 0 0 0 0 0 CCA (anti-Trp) W 0 0 0 0 20.5 0 0 CGG (anti-Pro) P 2 1 0 0 1.5 0 0 CTG (anti-Gln) Q 0 0 0 0 0 2 0 GAA (anti-Phe) F 0 0 0 7.5 2 0 50.5 GAT (anti-Ile) I 7 3 1.5 0 0.5 1 1 GCA (anti-Cys) C 0 0 0 0 0 0 0 GCG (anti-Arg) R 2 5 4.5 0.5 0.5 0.5 0 GGT (anti-Thr) T 65 24.5 14 0.5 3.5 8 0 GTA (anti-Tyr) V 0 0 1 66.5 12.5 2 33 GTT (anti-Asn) N 0 8 21.5 5 1 18 1 TGC (anti-Ala) A 3 2.5 2.5 3 22.5 4.5 0 TTC (anti-Glu) E 0 0.5 1.5 0 2 0 0 TTT (anti-Lys) K 1 1 2 0.5 0 0 0 total 100 100 100 100 100 100 100

    [0199] X of SEQ ID NO: 118 (VH1-69_F2) was designed to have the codon ratio shown in Table 67 below, and PCR was performed.

    TABLE-US-00067 TABLE 67 AA X64 X65 X66 X67 X68 X69 X70 X71 X72 X73 AAC (anti-Val) V 0 12 1.5 2 2 1.5 1.5 3 2.5 1 ACC (anti-Gly) G 41.5 16 2 10.5 8.5 46.5 45.5 5.5 0 6 AGA (anti-Ser) S 32 8 62.5 13.5 36 20 25 13 1.5 4.5 ATC (anti-Asp) D 0 1 2.5 2 27 4 6.5 8.5 0 4.5 ATG (anti-His) H 0 1 1 2 1.5 0 1 2 0 5 CAG (anti-Leu) L 0 4 1 1 1.5 3.5 0 1 1 1 CAT (anti-Met) M 0 1 0 0 1.5 0 0 0.5 1.5 0 CCA (anti-Trp) W 0 20.5 4.5 6 0 0 0 0 0 0 CGG (anti-Pro) P 0 0 0 28 0 0 0 0.5 2.5 0 CTG (anti-Gln) Q 0 0 0.5 3.5 0 0 0 1 1.5 1 GAA (anti-Phe) F 0 4.5 0.5 2.5 1 5 0 1 0 5 GAT (anti-Ile) I 0 5.5 8.5 1 5 1 1 4.5 17 2 GCA (anti-Cys) C 0 0 0 0 0 0 0 0 0 0 GCG (anti-Arg) R 0 3.5 3.5 1.5 2 1 3 3.5 3 2.5 GGT (anti-Thr) T 0 2.5 4.5 4 3.5 3.5 6 15 44 3.5 GTA (anti-Tyr) V 0 10.5 1.5 11 6 0.5 1 6.5 0 36 GTT (anti-Asn) N 0 5 0 2 0 10 4.5 19.5 0.5 17 TGC (anti-Ala) A 26.5 4.5 0.5 7.5 1.5 2 3 4 6 1.5 TTC (anti-Glu) E 0 0 0 1.5 1.5 1 1 6.5 2.5 1.5 TTT (anti-Lys) K 0 0.5 5.5 0.5 1.5 0.5 1 4.5 16.5 8 total 100 100 100 100 100 100 100 100 100 100

    [0200] N of SEQ ID NO: 128 (VH3-15_F2) was designed to have the base ratio shown in Table 68 below, and PCR was performed.

    TABLE-US-00068 TABLE 68 N23 N24 N25 N26 N27 N17 N28 A  0  0  0  0  0  0 10 T  5  0 44 20 82 90  0 G  0 10  0  0  0  0 90 C 95 90 56 80 18 10  0

    [0201] X of SEQ ID NO: 128 (VH3-15_F2) was designed to have the codon ratio shown in Table 69 below, and PCR was performed.

    TABLE-US-00069 TABLE 69 AA X74 X75 X76 X77 X78 X79 X80 X81 AAC (anti-Val) V 0.5 6.5 0 0.5 7.5 0 1 2 ACC (anti-Gly) G 1.5 0 8.5 1 7.5 2.5 55 1 AGA (anti-Ser) S 1 6 69.5 3.5 8 4.5 1 0.5 ATC (anti-Asp) D 0 0 3.5 1.5 2 34 1.5 40 ATG (anti-His) H 3.5 0 0.5 0 0 3.5 2 1.5 CAG (anti-Leu) L 4.5 1 0 0 1 0 0 0 CAT (anti-Met) M 0 2 0 0 0 0 0 0 CCA (anti-Trp) W 0 0 0.5 0 0 0 0.5 0 CGG (anti-Pro) P 0 0 0.5 0 5 0 0 0 CTG (anti-Gln) Q 0.5 0 0 2 0 0.5 0 3 GAA (anti-Phe) F 21 1.5 0 0 0.5 1.5 1 0 GAT (anti-Ile) I 0 78.5 1 1 3 0 0 0.5 GCA (anti-Cys) C 0 0 0 0 0 0 0 0 GCG (anti-Arg) R 65 0 6 8 2 1 1.5 0 GGT (anti-Thr) T 0.5 4 7.5 2 26.5 1.5 0.5 2 GTA (anti-Tyr) V 1 0 0 0 0 22 21.5 2.5 GTT (anti-Asn) N 0 0 0 5 2 18 0 1.5 TGC (anti-Ala) A 1 0.5 1 0 34 5 3.5 7 TTC (anti-Glu) E 0 0 0 4 0.5 4.5 11 38 TTT (anti-Lys) K 0 0 1.5 71.5 0.5 1.5 0 0.5

    [0202] N of SEQ ID NO: 130 (VH3-23_F2) was designed to have the base ratio shown in Table 70 below, and PCR was performed.

    TABLE-US-00070 TABLE 70 N29 N30 A 58 0 T 0 21 G 0 0 C 42 79

    [0203] X of SEQ ID NO: 130 (VH3-23_F2) was designed to have the codon ratio shown in Table 71 below, and PCR was performed.

    TABLE-US-00071 TABLE 71 AA X82 X83 X84 X85 X86 X87 X88 X89 AAC (anti-Val) V 18.5 0 1 0 2.5 2 2.5 1 ACC (anti-Gly) G 16 3.5 19.5 9.5 22 4 0 5.5 AGA (anti-Ser) S 15 63.5 19 39 36.5 16.5 1 0 ATC (anti-Asp) D 0 0 0 41 8.5 6 0 4.5 ATG (anti-His) H 2 0.5 3 1 1 2 0 5.5 CAG (anti-Leu) L 5.5 1 1 0 1 1 1 1 CAT (anti-Met) M 0 0 0 0 0 0 2 0 CCA (anti-Trp) W 0 8 10.5 0 0 0 0 0.5 CGG (anti-Pro) P 0 0.5 3 0 0 1 0.5 0 CTG (anti-Gln) Q 0 0.5 6 0 0 1 2 1 GAA (anti-Phe) F 6.5 0 3.5 0 0.5 1 0 8 GAT (anti-Ile) I 2.5 0.5 1 0.5 1.5 3.5 27.5 0.5 GCA (anti-Cys) C 0 0 0 0 0 0 0 0 GCG (anti-Arg) R 1.5 5 2 2.5 4 4 3 1 GGT (anti-Thr) T 5.5 5.5 3 4.5 9 16.5 30 0 GTA (anti-Tyr) V 17.5 1.5 17 0 1 7 0 61.5 GTT (anti-Asn) N 0 0 4 0 6.5 19.5 0 5.5 TGC (anti-Ala) A 9 1 3.5 1 4 3 2 2 TTC (anti-Glu) E 0 0 2 1 1 8 4.5 1 TTT (anti-Lys) K 0.5 9 1 0 1 4 24 1.5 total 100 100 100 100 100 100 100 100

    [0204] X of SEQ ID NO: 120 (VH1-69_F3_CDR9, VH3-_F3_CDR9, VH3-23_F3_CDR9) was designed to have the codon ratio shown in Table 72 below, and PCR was performed.

    TABLE-US-00072 TABLE 72 AA X90 X91 X92 X93 X94 X95 X96 X97 X98 AAC (anti-Val) V 5.0 6.0 10.5 3.0 2.0 3.5 5.0 4.0 7.5 ACC (anti-Gly) G 16.0 14.0 15.0 16.0 21.0 15.5 10.5 4.5 1.0 AGA (anti-Ser) S 5.0 10.0 13.0 17.0 19.0 14.0 8.5 2.0 6.0 ATC (anti-Asp) D 26.0 5.0 5.0 4.5 5.0 6.5 1.0 69.5 3.5 ATG (anti-His) H 2.0 1.0 2.0 3.0 1.5 2.5 1.0 0.5 4.5 CAG (anti-Leu) L 4.5 9.5 4.0 3.0 2.5 4.0 13.0 1.0 3.5 CAT (anti-Met) M 0.0 1.0 1.0 0.5 0.5 0.5 5.5 1.0 2.5 CCA (anti-Trp) W 2.5 7.0 3.5 5.0 6.5 4.5 1.5 0.0 0.0 CGG (anti-Pro) P 1.5 7.0 4.0 3.5 1.0 7.5 3.0 1.0 5.5 CTG (anti-Gln) Q 7.0 2.5 1.0 1.5 1.5 1.0 0.5 1.0 1.0 GAA (anti-Phe) F 0.5 2.0 1.0 2.0 1.0 3.0 33.5 0.0 3.5 GAT (anti-Ile) I 1.5 3.0 1.5 1.5 1.5 2.5 4.5 3.0 3.0 GCA (anti-Cys) C 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 GCG (anti-Arg) R 4.0 8.5 13.5 4.5 3.5 2.5 0.5 0.5 0.5 GGT (anti-Thr) T 8.5 5.0 6.0 5.0 8.0 3.5 3.0 2.0 2.0 GTA (anti-Tyr) V 1.5 4.5 5.0 10.0 11.0 11.5 4.5 1.5 52.0 GTT (anti-Asn) N 1.0 4.0 4.0 4.0 5.5 2.0 1.0 1.5 2.0 TGC (anti-Ala) A 5.0 5.5 6.5 13.0 7.0 13.0 2.0 2.5 1.5 TTC (anti-Glu) E 7.5 2.5 2.0 1.5 1.0 1.5 1.5 3.5 0.5 TTT (anti-Lys) K 1.0 2.0 1.5 1.5 1.0 1.0 0.0 1.0 0.0

    [0205] X of SEQ ID NO: 121 (VH1-69_F3_CDR10, VH3-15_F3_CDR10, VH3-23_F3_CDR10), SEQ ID NO: 122 (VH1-69_F3_CDR11, VH3-15_F3_CDR11, VH3-23_F3_CDR11), SEQ ID NO: 123 (VH1-69_F3_CDR12, VH3-15_F3_CDR12, VH3-23_F3_CDR12), SEQ ID NO: 124 (VH1-69_F3_CDR13, VH3-15_F3_CDR13, VH3-23_F3_CDR13) and SEQ ID NO: 125 (VH1-69_F3_CDR14, VH3-15_F3_CDR14, VH3-23_F3_CDR14) was designed to have the codon ratio shown in Table 73 below, and PCR was performed.

    TABLE-US-00073 TABLE 73 AA X99 X100 X101 X102 X103 X104 X105 X106 X107 X108 X109 X110 X111 X112 X113 X114 X115 AAC (anti-Val) V 6.5 6 6.5 6.5 5.5 2 3.5 4 1 12.5 6.5 5 5 3 4 1.5 11.5 ACC (anti-Gly) G 15.5 16 18.5 21.5 17.5 20 19.5 3.5 5 0 18 19 14 15 4 4.5 1 AGA (anti-Ser) S 6 10.5 13.5 15.5 15 10 8 4 15 5 5 14 13 10 3.5 1 6.5 ATC (anti-Asp) D 24 4 5.5 5.5 5.5 6.5 4 1.5 77 3 24.5 6 5 4 1 78 2 ATG (anti-His) H 3.5 3.5 2 1 2 2 2.5 0 1 4.5 2.5 1 2 2 1 1.5 5.5 CAG (anti-Leu) L 4.5 9 5.5 3.5 4.5 3 3.5 11 2 3.5 4 4 5 4 12.5 1 4 CAT (anti-Met) M 0.5 1.5 1.5 1 0.5 1 0 11.5 0 0 1 0 0 1 9 0 0 CCA (anti-Trp) W 1 2 2.5 3 5 7 6 1 0 0.5 1 5 6 5 1 0 0 CGG (anti-Pro) P 2.5 6 4 3 2.5 2 5 3.5 1 7 2.5 4 3 5 3.5 1 5 CTG (anti-Gln) Q 2 2.5 2 2 2 2 1.5 0 1.5 0 2.5 1 2 1 0.5 2 0.5 GAA (anti-Phe) F 0.5 3 2 3.5 2.5 2.5 2.5 42 1 6 1 3 3 3 43 0 4 GAT (anti-Ile) I 2 4 2.5 2 2.5 1 2 5 0.5 2.5 2 3 2 2 5.5 0 3 GCA (anti-Cys) C 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 GCG (anti-Arg) R 5.5 8.5 6 4.5 3.5 3.5 3.5 1.5 1 0 5 3 5 5 1 1 0 GGT (anti-Thr) T 3 5.5 6.5 5.5 7.5 4 4 1.5 1 0 2.5 6 7 5 1.5 0.5 1 GTA (anti-Tyr) V 3 5 9 9.5 11 19 20.5 5.5 1 52.5 2 12 15 22 4 1 53 GTT (anti-Asn) N 1.5 2 2 3 3 5 2 1 1.5 2 1.5 3 4 4 1.5 2 2.5 TGC (anti-Ala) A 8 6 6 6.5 7 6 8.5 2.5 1.5 1 7.5 8 6 6 2 1.5 0.5 TTC (anti-Glu) E 9 2.5 3 2 2 2.5 2.5 1 2.5 0 10 2 2 2 1.5 3.5 0 TTT (anti-Lys) K 1.5 2.5 1.5 1 1 1 1 0 0 0 1 1 1 1 0 0 0 AA X116 X117 X118 X119 X120 X121 X122 X123 X124 X125 X126 X127 X128 X129 X130 X131 X132 AAC (anti-Val) V 6 3 3 0.5 14.5 7 3 2 2.5 1 20 7 2.5 2.5 2 0.5 26 ACC (anti-Gly) G 19.5 19 2.5 3.5 0 15.5 12 20.5 2.5 2.5 0 16 14 2.5 1.5 3 0 AGA (anti-Ser) S 5 6 2.5 1.5 5 4.5 11 4.5 2 1 4.5 45 8.5 4 2 0.5 5.5 ATC (anti-Asp) D 29.5 2.5 1 83 1 32 6 2.5 1 87 1 33.5 6.5 1.5 0.5 86 1 ATG (anti-His) H 2.5 2.5 1 1 5 3.5 2 2.5 0.5 0.5 5 2.5 3 2.5 0.5 1.5 4.5 CAG (anti-Leu) L 3 4 12 1 4.5 3.5 5 2.5 10 0.5 4 4 2 3.5 10 0.5 5 CAT (anti-Met) M 0.5 0 12 0 0 0.5 0 0 15.5 0 0.5 0.5 0.5 0.5 22.5 0 0 CCA (anti-Trp) W 1 6.5 1 0 0 1 4 8.5 0.5 0 0 0.5 5.5 8.5 0 0 0 CGG (anti-Pro) P 2.5 6 2 0.5 7.5 2 3 7 2 0.5 9 3 2.5 6.5 2.5 0.5 9.5 CTG (anti-Gln) Q 1.5 1 0 2 0 2 1 1 0 2 0 2 1 0.5 0 2 0 GAA (anti-Phe) F 1 3 50 0 4 1 3 3 52.5 0.5 4 1 3 2.5 50 0.5 2 GAT (anti-Ile) I 0.5 1 5 0 4.5 1 2 1 4 0 6 0.5 1.5 1 3.5 0 4.5 GCA (anti-Cys) C 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 GCG (anti-Arg) R 5 2 0.5 0.5 1 4 4 2 0 0.5 0 4.5 3.5 2 0 0.5 0 GGT (anti-Thr) T 2 3.5 1 1 0.5 2.5 4 2.5 0.5 0 0 2 3 2 0.5 0.5 0.5 GTA (anti-Tyr) V 2 26.5 3.5 1 50 2 27 28 3.5 0.5 44.5 1 30.5 25.5 2 0 39.5 GTT (anti-Asn) N 1.5 2 1 1 2 1 5 2 1 0.5 1 1.5 7 2 0.5 1 1 TGC (anti-Ala) A 7.5 8.5 1.5 1.5 0.5 7 4 9.5 1.5 1 0.5 7 2.5 9 1.5 1 1 TTC (anti-Glu) E 8.5 2 0.5 2 0 9 3 1 0.5 2 0 8 2 1 0.5 2 0 TTT (anti-Lys) K 1 1 0 0 0 1 1 0 0 0 0 1 1 0 0 0 0

    [0206] 3) Second PCR amplification (1.sup.st overlapping PCR): the primary PCR products (Fragments 1 to 3) were added as templates (40 ng for each fragment/reaction) and the reaction was conducted for 16 cycles (at 95° C. for 30 sec, to 55° C. for 30 sec, at 72° C. for 1 min). The primer sequences used in PCR are shown in Table 74. Respective PCR products (variable heavy chains) were subjected to electrophoresis and then purified using a QIAquick Gel Extraction Kit (QIAGEN, CAT. NO. 28706).

    TABLE-US-00074 TABLE 74 SEQ ID Name Direction Sequence NO VH1-69 Forward GCTCTAGATAATTAATTAGGAGGAAT 131 TTAAAATGAAATACCTATTGCCT Reverse GGGCCCTTGGTGGAGGCCGAGCTAAC 132 GGTAACCAGTGTACCTTGACCCCA VH3-15 Forward GCTCTAGATAATTAATTAGGAGGAAT 131 TTAAAATGAAATACCTATTGCCT Reverse GGGCCCTTGGTGGAGGCCGAGCTAAC 132 GGTAACCAGTGTACCTTGACCCCA VH3-23 Forward GCTCTAGATAATTAATTAGGAGGAAT 131 TTAAAATGAAATACCTATTGCCT Reverse GGGCCCTTGGTGGAGGCCGAGCTAAC 132 GGTAACCAGTGTACCTTGACCCCA

    [0207] 4) Fab library transformation

    [0208] 4-a) Ligation: XbaI (NEB. CAT. NO. R0145L) was added to PCR products of a variable heavy chain (VH), reaction was conducted at 37° C. for 6 hours, and then the result was purified using a QIAquick PCR Purification Kit (QIAGEN, CAT. NO. 28106). ApaI (NEB. CAT. NO. R0114L) was added thereto, followed by reaction at 25° C. for 6 hours and purification using a QIAquick PCR Purification Kit (QIAGEN, CAT. NO. 28106). T4 DNA ligase (NEB, CAT. NO. M0203S) was added to 10 μg of insert DNA fragments cut with XbaI and apaI and 40 μg of linearized pComb3XTT vector (EcoRI, XbaI cut) and reaction was conducted at 25° C. overnight (0/N). At this time, as a proportion of the length of CDR3 with respect to the total amount of DNA, the percentage of CDR3_9AA (amino acid) lengths was adjusted to 12%, the percentage of CDR3_10AA lengths was adjusted to 14%, the percentage of CDR3_11AA lengths was adjusted to 17%, the percentage of CDR3_12AA lengths was adjusted to 22%, the percentage of CDR3_13AA lengths was adjusted to 19%, and the percentage of CDR3_14AA lengths was adjusted to 16%.

    [0209] 4-b) Transformation: the ligated reaction product was purified using a QIAquick PCR Purification Kit (QIAGEN, CAT. NO. 28106). For each heavy-chain subtype, 1 mL of XL1-Blue Electroporation-Competent Cells (Stratagene, CAT. NO. 200228) was divided into 10 cuvettes (100 μl/cuvette) and electroporated. SB liquid media was added to adjust the total volume to 500 mL, and the result was incubated with shaking at 37° C. and 200 rpm for 1 hour. 100 μL of culture sup. was spread on an LB agar lop plate+carbenicillin (NaraeBiotech, CAT. NO. LN004CA) through serial dilution and then incubated at 37° C. overnight to determine the pComb3XTT-Synthetic VL library size. 500 μL of carbenicillin (100 mg/mL) was added to 500 mL of the culture, which was then incubated at 37° C. (200 rpm) overnight.

    Example 5) Detection of Fab Library Performance

    5-1) Determination of Library Size

    [0210] For a Fab library, a total of 12 libraries, each having a size of 10.sup.10 or more, was constructed using 3 VH types and 4 VL types to obtain a Fab library with a total size of 1.52×10.sup.11. For a scFv library, a total of 8 libraries, each having a size of 10.sup.11 or more, was constructed using 2 VH types and 4 VL types, to obtain a scFv library with a total size of 1.27×10.sup.12.

    TABLE-US-00075 TABLE 75 VL VH Vκ1-39 Vκ3-20 Vκ3-20-2 Vλ1-51 Total Fab VH3-15 1.2 × 10.sup.10 1.4 × 10.sup.10 8.0 × 10.sup.9  1.4 × 10.sup.10 1.54 × 10.sup.11 VH3-23 1.9 × 10.sup.10 9.0 × 10.sup.9  1.2 × 10.sup.10 1.4 × 10.sup.10 VH1-69 1.5 × 10.sup.10 1.8 × 10.sup.10 4.0 × 10.sup.9  1.5 × 10.sup.10 scFv VH3-15 2.8 × 10.sup.10 5.0 × 10.sup.10 3.3 × 10.sup.10 1.3 × 10.sup.11 1.27 × 10.sup.12 VH3-23 2.9 × 10.sup.11 3.4 × 10.sup.11 2.1 × 10.sup.12 7.2 × 10.sup.12 Unit: CPU (Colony Farming Unit)

    5-2) Detection of Library CDR Amino Acid Distribution

    [0211] Reproducibility was analyzed by comparing the human germline CDR sequences obtained using HT-Sequencing with the CDR sequences of the actually constructed library.

    [0212] The result showed that amino acid diversity designed, as shown in FIG. 2 was obtained.

    [0213] In order to quantitatively analyze the same, an analysis was conducted using a paired T-test.

    [0214] The result showed that the significance levels of all library introduction sites were 5% or less, which indicates that the mutation sequence of the actual library is the same as the sequence designed based on the human germline CDR.

    TABLE-US-00076 TABLE 76 Paired T-test Equality of Difference in P-value variances mean Site Levene test Paired T-test 95 0.956 0.999 96 0.516 0.999 97 0.663 0.992 98 0.949 0.963 99 0.821 0.963 100  0.936 0.983 100a 0.948 0.989 100b 0.886 0.984 100c 0.869 0.973 100d 0.98 0.994 101  0.994 0.972 102  0.993 1 * Significance Level (α): 5%

    5-3) Detection of Redundancy (Repetitive) Sequence Distribution

    [0215] The ratio of repetitive sequences was obtained by analyzing about 10000 of each library sequence using HT-sequencing.

    [0216] The result showed that VH3-15 and VH3-23 types have a repetitive sequence ratio of 10% or less, VH1-69 has a repetitive sequence ratio of 13 to 21%, and the overall average repetitive sequence ratio is 10.5% (Table 77). As can be seen from FIG. 3, since most of the repetitive sequences were repeated twice, the effect of lowering the library quality was insignificant.

    TABLE-US-00077 TABLE 77 Type % VH3-15/Vk1-39 8.6 VH3-15/Vk3-20 9.1 VH3-15/Vk3-20-2 6.4 VH3-15/Vλ1-51 6.6 VH3-23/Vk1-39 8.3 VH3-23/Vk3-20 6.8 VH3-23/Vk3-20-2 7.7 VH3-23/Vλ1-51 7.5 VH1-69/Vk1-39 18 VH1-69/Vk3-20 13 VH1-69/Vk3-20-2 13.7 VH1-69/Vλ1-51 21 Total 10.5

    5-4) CDR Length Analysis

    [0217] The distribution of human germline VH CDR3 sequences for each length was detected through HT-sequencing, was reproduced in the library, and compared and analyzed through HT-sequencing.

    [0218] As can be seen from FIG. 4, the distribution of the human germline sequence for each length and the CDR length of the library were similar.

    [0219] Although specific configurations of the present invention have been described in detail, those skilled in the art will appreciate that this description is provided to set forth preferred embodiments for illustrative purposes and should not be construed as limiting the scope of the present invention. Therefore, the substantial scope of the present invention is defined by the accompanying claims and equivalents thereto.

    INDUSTRIAL APPLICABILITY

    [0220] Advantageously, the antibody library according to the present invention has high thermodynamic stability and enables high soluble expression, as well as reversible folding.

    [0221] Moreover, the antibody library according to the present invention contains various CDRs that are rationally controlled to have high specificity and high affinity for all antigens, and thus have a high level of diversity, and thus can be usefully used to select appropriate candidate antibodies for a desired antigen.

    [0222] In addition, the antibody library according to the present invention is based on human antibody sequences and thus can be used to screen antibodies with minimal immunogenicity when administered to the human body, and to develop antibodies that can be effectively used for the treatment or diagnosis of diseases.

    [0223] [Sequence List Free Text]

    [0224] An electronic file was attached.