HIGH CONTRAST PHOTOCONVERTIBLE FLUORESCENT PROTEINS AND METHODS OF USE
20220259271 · 2022-08-18
Inventors
Cpc classification
International classification
Abstract
Disclosed herein, are photoconvertible fluorescent proteins or analogs thereof, and in particular, green-to-red photoconvertible fluorescent proteins or analogs thereof of the EosFP family; and compositions comprising the same and methods for analyzing a physiologically active substance in a cell wherein the fluorescent proteins are expressed in the cell.
Claims
1. A photoconvertible fluorescent protein comprising one or more mutations or substitutions of the mEos4b protein coding sequence (SEQ ID NO: 1).
2. A photoconvertible fluorescent protein, wherein the photoconvertible fluorescent protein or analog thereof comprises the coding region of the mEos4b protein, wherein the coding region comprises at least one or more mutations or substitutions.
3. The photoconvertible fluorescent protein of claims 1-2, wherein the one or more mutations or substitutions is at residue 41 or 70 of the mEos4b protein coding sequence.
4. The photoconvertible fluorescent protein of any of claims 1-3, wherein the one or more mutations or substitutions is at residues 41 and 70 of the mEos4b protein coding sequence.
5. The photoconvertible fluorescent protein of any of claims 1-2, wherein the one or more mutations or substitutions is at residue 41, 70 or 197 of the mEos4b protein coding sequence.
6. The photoconvertible fluorescent protein of any of claims 1-2, wherein the one or more mutations or substitutions is at residues 41, 70 and 197 of the mEos4b protein coding sequence.
7. The photoconvertible fluorescent protein of any of claims 3-6, wherein the mutation or substitution at residue 41 is a substitution of a methionine residue.
8. The photoconvertible fluorescent protein of any of claims 3-6, wherein the mutation or substitution at amino acid residue 41 is a methionine to an isoleucine residue mutation or substitution (Met41Ile).
9. The photoconvertible fluorescent protein of claims 3-6, wherein the mutation or substitution at residue 70 is a substitution of a valine residue.
10. The photoconvertible fluorescent protein of claim 3-6 or 7, wherein the mutation or substitution at residue 70 is a valine to a threonine residue mutation or substitution (Val70Thr).
11. The photoconvertible fluorescent protein of claim 3, wherein the mutation or substitution at residue 41 is a methionine to an isoleucine residue mutation or substitution (Met41Ile) and the mutation or substitution at residue 70 is a valine to a threonine residue mutation or substitution (Val70Thr).
12. The photoconvertible fluorescent protein in any of the preceding claims, wherein the mutation or substitution at residue 197 is a substitution of an isoleucine residue.
13. The photoconvertible fluorescent protein in any of the preceding claims, wherein the mutation or substitution at residue 197 is an isoleucine to a methionine residue mutation or substitution (Ile197Met).
14. The photoconvertible fluorescent protein of claim 5, wherein the mutation or substitution at residue 41 is a methionine to an isoleucine residue mutation or substitution (Met41Ile); and the mutation or substitution at residue 70 is a valine to a threonine residue mutation or substitution (Val70Thr); and the mutation or substitution at residue 197 is an isoleucine to a methionine residue mutation or substitution (Ile197Met).
15. A photoconvertible fluorescent protein, wherein the photoconvertible fluorescent protein comprises the coding region of the mEos4b protein, wherein the coding region comprises a mutation or substitution at mutation or substitution at residues 41 and 70, wherein the mutation or substitution at residue 41 is a methionine to an isoleucine residue mutation or substitution (Met41Ile); and the mutation or substitution at residue 70 is a valine to a threonine residue mutation or substitution (Val70Thr).
16. A photoconvertible fluorescent protein, wherein the photoconvertible fluorescent protein comprises the coding region of the mEos4b protein, wherein the coding region comprises a mutation or substitution at mutation or substitution at residues 41, 70 and 197, wherein the mutation or substitution at residue 41 is a methionine to an isoleucine residue mutation or substitution (Met41Ile); and the mutation or substitution at residue 70 is a valine to a threonine residue mutation or substitution (Val70Thr); and the mutation or substitution at residue 197 is an isoleucine to a methionine residue mutation or substitution (Ile197Met).
17. The photoconvertible fluorescent protein of any of the preceding claims, wherein the protein has an excitation maximum at 571 mm.
18. The photoconvertible fluorescent protein of any of the preceding claims, wherein the protein has an emission maximum at 585 nm.
19. The photoconvertible fluorescent protein of any of the preceding claims, wherein the protein has an absorbance of UV/violet light around 385 nm.
20. The photoconvertible fluorescent protein of any of the preceding claims wherein no mutations or substitutions are located at surface residues of mEos4b that confer monomeric character.
21. The photoconvertible fluorescent protein of any of the preceding claims wherein the excitation and emission spectra of the photoconvertible fluorescent protein or analog are blue-shifted relative to mEos4b.
22. The photoconvertible fluorescent protein of any of the preceding claims, wherein the protein is in a circularly-permutated form.
23. The photoconvertible fluorescent protein of claim 22, wherein the photoconvertible fluorescent protein or analog is divided at residue 74 and 75, such that the N- and C-termini of the photoconvertible fluorescent protein or analog are relocated.
24. The photoconvertible fluorescent protein of claim 23, wherein the asparagine of residue 75 is at the N-termini and the aspartate residue of residue 74 is at the C-termini.
25. The photoconvertible fluorescent protein of claim 22, wherein the circularly-permutated form is a photocleavable tag.
26. A method for analyzing a physiologically active substance in a cell, wherein the photoconvertible fluorescent protein or analog thereof of any of the preceding claims is expressed in the cell.
27. A method of performing live cell imaging, wherein the photoconvertible fluorescent protein or analog thereof of any of the preceding claims is expressed in the cell.
28. The method of claim 26, wherein the physiologically active substance is a protein, a vector or a transformant.
29. The method of claim 26 or 27, comprising analyzing localization or dynamic situation of a protein in the cell.
30. A molecule probe comprising the photoconvertible fluorescent protein or analog of any of the preceding claims.
31. A monomer, dimer or tetramer of the photoconvertible fluorescent protein or analog of any of the preceding claims.
32. A monomer of photoconvertible fluorescent protein of any of any of the preceding claims.
33. A composition comprising the photoconvertible fluorescent protein of any of the preceding claims.
34. A method of identifying and localizing an individual fluorescent molecule, wherein the fluorescent molecule is one or more of the photoconvertible fluorescent protein of any of the preceding claims.
35. The method of claim 34, wherein the method comprises photo-activated localization microscopy or stochastic optical reconstruction microscopy.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0008]
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
DETAILED DESCRIPTION
[0067] The present disclosure can be understood more readily by reference to the following detailed description of the invention, the figures and the examples included herein.
[0068] Before the present methods and compositions are disclosed and described, it is to be understood that they are not limited to specific synthetic methods unless otherwise specified, or to particular reagents unless otherwise specified, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular aspects only and is not intended to be limiting. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, example methods and materials are now described.
[0069] Moreover, it is to be understood that unless otherwise expressly stated, it is in no way intended that any method set forth herein be construed as requiring that its steps be performed in a specific order. Accordingly, where a method claim does not actually recite an order to be followed by its steps or it is not otherwise specifically stated in the claims or descriptions that the steps are to be limited to a specific order, it is in no way intended that an order be inferred, in any respect. This holds for any possible non-express basis for interpretation, including matters of logic with respect to arrangement of steps or operational flow, plain meaning derived from grammatical organization or punctuation, and the number or type of aspects described in the specification.
[0070] All publications mentioned herein are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited. The publications discussed herein are provided solely for their disclosure prior to the filing date of the present application. Nothing herein is to be construed as an admission that the present invention is not entitled to antedate such publication by virtue of prior invention. Further, the dates of publication provided herein can be different from the actual publication dates, which can require independent confirmation.
Definitions
[0071] As used in the specification and the appended claims, the singular forms “a,” “an” and “the” include plural referents unless the context clearly dictates otherwise.
[0072] The word “or” as used herein means any one member of a particular list and also includes any combination of members of that list.
[0073] Ranges can be expressed herein as from “about” or “approximately” one particular value, and/or to “about” or “approximately” another particular value. When such a range is expressed, a further aspect includes from the one particular value and/or to the other particular value. Similarly, when values are expressed as approximations, by use of the antecedent “about,” or “approximately,” it will be understood that the particular value forms a further aspect. It will be further understood that the endpoints of each of the ranges are significant both in relation to the other endpoint and independently of the other endpoint. It is also understood that there are a number of values disclosed herein and that each value is also herein disclosed as “about” that particular value in addition to the value itself. For example, if the value “10” is disclosed, then “about 10” is also disclosed. It is also understood that each unit between two particular units is also disclosed. For example, if 10 and 15 are disclosed, then 11, 12, 13, and 14 are also disclosed.
[0074] As used herein, the terms “optional” or “optionally” mean that the subsequently described event or circumstance may or may not occur and that the description includes instances where said event or circumstance occurs and instances where it does not.
[0075] As used herein, the term “sample” is meant a tissue or organ from a subject; a cell (either within a subject, taken directly from a subject, or a cell maintained in culture or from a cultured cell line); a cell lysate (or lysate fraction) or cell extract; or a solution containing one or more molecules derived from a cell or cellular material (e.g., a polypeptide or nucleic acid), which is assayed as described herein. A sample may also be any body fluid or excretion (for example, but not limited to, blood, urine, stool, saliva, tears, bile) that contains cells or cell components.
[0076] As used herein, the term “comprising” can include the aspects “consisting of” and “consisting essentially of”
[0077] As used herein the terms “amino acid” and “amino acid identity” refers to one of the 20 naturally occurring amino acids or any non-natural analogues that may be in any of the antibodies, variants, or fragments disclosed. Thus “amino acid” as used herein means both naturally occurring and synthetic amino acids. For example, homophenylalanine, citrulline and noreleucine are considered amino acids for the purposes of the invention. “Amino acid” also includes amino acid residues such as proline and hydroxyproline. The side chain may be in either the (R) or the (S) configuration. In some aspects, the amino acids are in the D or L-configuration. If non-naturally occurring side chains are used, non-amino acid substituents may be used, for example to prevent or retard in vivo degradation.
[0078] “Inhibit,” “inhibiting” and “inhibition” mean to diminish or decrease an activity, level, response, condition, disease, or other biological parameter. This can include, but is not limited to, the complete ablation of the activity, response, condition, or disease. This may also include, for example, a 10% inhibition or reduction in the activity, response, condition, or disease as compared to the native or control level. Thus, in some aspects, the inhibition or reduction can be a 10, 20, 30, 40, 50, 60, 70, 80, 90, 100%, or any amount of reduction in between as compared to native or control levels. In some aspects, the inhibition or reduction is 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, or 90-100% as compared to native or control levels. In some aspects, the inhibition or reduction is 0-25, 25-50, 50-75, or 75-100% as compared to native or control levels.
[0079] The term “fragment” can refer to a portion (e.g., at least 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, etc. amino acids) of a peptide that is substantially identical to a reference peptide and retains the biological activity of the reference. In some aspects, the fragment or portion retains at least 50%, 75%, 80%, 85%, 90%, 95% or 99% of the biological activity of the reference peptide described herein. Further, a fragment of a referenced peptide can be a continuous or contiguous portion of the referenced polypeptide (e.g., a fragment of a peptide that is ten amino acids long can be any 2-9 contiguous residues within that peptide).
[0080] A “variant” can mean a difference in some way from the reference sequence other than just a simple deletion of an N- and/or C-terminal amino acid residue or residues. A “variant” can include a substitution. Where the variant includes a substitution of an amino acid residue, the substitution can be considered conservative or non-conservative. Conservative substitutions are those within the following groups: Ser, Thr, and Cys; Leu, ILe, and Val; Glu and Asp; Lys and Arg; Phe, Tyr, and Trp; and Gln, Asn, Glu, Asp, and His. Variants can include at least one substitution and/or at least one addition, there may also be at least one deletion. Variants can also include one or more non-naturally occurring residues. For example, they may include selenocysteine (e.g., seleno-L-cysteine) at any position, including in the place of cysteine. Many other “unnatural” amino acid substitutes are known in the art and are available from commercial sources. Examples of non-naturally occurring amino acids include D-amino acids, amino acid residues having an acetylaminomethyl group attached to a sulfur atom of a cysteine, a pegylated amino acid, and omega amino acids of the formula NH2(CH2)nCOOH wherein n is 2-6 neutral, nonpolar amino acids, such as sarcosine, t-butyl alanine, t-butyl glycine, N-methyl isoleucine, and norleucine. Phenylglycine may substitute for Trp, Tyr, or Phe; citrulline and methionine sulfoxide are neutral nonpolar, cystic acid is acidic, and ornithine is basic. Proline may be substituted with hydroxyproline and retain the conformation conferring properties of proline.
[0081] As used herein, a “photoconvertible fluorescent protein or variant thereof” refers to a fluorescent protein that controllably transitions between spectrally distinct fluorescent states. In some aspects, this transition can be irreversible, and its efficiency can be dependent on certain conditions, for example, protonation of the chromophore and irradiation with ultraviolet wavelengths.
[0082] Other objects, features and advantages of the present invention will become apparent from the following detailed description. It should be understood, however, that the detailed description and the specific examples, while indicating specific embodiments of the invention, are given by way of illustration only, since various changes and modifications within the spirit and scope of the invention will become apparent to those skilled in the art from this detailed description.
[0083] As disclosed herein, mEos4b was engineered to produce variants with improved photoconversion contrast for optical highlighting and reduced single molecule photoblinking propensity. Compound substitutions lining the Kaede-like chromophore resulted in a markedly faster single molecule photoconversion rates and synergistic effects not observed in other photoconvertible fluorescent protein variants bearing individual substitutions. Initial applications in protein counting tests demonstrated positive identification of dimeric protein complexes in the plasma membrane using relatively a simple spatiotemporal merging method. Overall the results described herein provide insights into mechanisms of photoconversion in Kaede family photoconvertible fluorescent proteins.
[0084] More specifically, disclosed herein are photoconvertible fluorescent proteins referred to as “Janus” and “Ignis”. Both photoconvertible fluorescent proteins are green-to-red photoconvertible fluorescent proteins (PC-FPs) of the EosFP family, generated through site directed mutagenesis of the mEos4b protein coding sequence at amino acid positions 41 and 70 (Janus) and positions 41, 70 and 197 (Ignis) relative to the start codon ATG. Methionine at position 41 has been mutated to isoleucine (Met41Ile) and valine at position 70 has been mutated to threonine (Val70Thr) in both photoconvertible fluorescent proteins. The Ignis photoconvertible fluorescent protein contains the additional mutation, isoleucine at position 197 to methionine (Ile197Met). The genotype of Janus is therefore mEos4b-Met41Ile-Val70Thr, and Ignis is mEos4b-Met41Ile-Val70ThrIle197Met. Ignis is Janus with an additional Ile197Met mutation.
[0085] Janus Fluorescent Protein. Janus was derived from the pure monomer, mEos4b, without modification of surface residues that confer monomeric character. It can behave as a monomer with indistinguishable performance to documented monomeric PC-FPs, mEos3.2 and mEos4b, in challenging fusion constructs (membrane-localized fusion proteins CTLA4 and N-myristoylated DmrB) in the experiments described herein.
[0086] The excitation and emission spectra of green-state Janus are blue-shifted relative to mEos4b like mEos4bV70T. This improves its excitation under commonly-employed 488 nm laser illumination, compensating for its lower peak excitation coefficient. (mEos4b is only about 55% maximally excited at this wavelength whereas Janus is nearer its excitation maximum). As such, Janus is bright in green channel confocal applications. However, the Janus red state retains longer-wavelength spectral peaks, with excitation maximum at 571 nm and emission maximum at 585 nm. This is one of the largest red Stokes-shifts among available PC-FPs. The excitation spectrum in the red form also permits convenient and efficient excitation under both 561 and 568 nm laser illumination commonly employed in confocal and super-resolution experiments. These findings are superior to both fluorescent proteins, mKikGR and Dendra2, which have red excitation peaks considerably above and below 561 and 568 nm.
[0087] Relative to commonly-used PC-FPs in the EosFP family, Janus displays exceptional photoconversion contrast and red state brightness in ensemble photoconversion experiments, both in vitro (purified Janus protein) and in cellulo (overexpressed Janus protein in cultured cells). It has bright fluorescent green and red states noted above, which make it attractive for optical highlighting applications. Photoconversion from green to red states requires lower intensity and/or less duration of phototoxic ultraviolet/violet light in the range of 365-405 nm available in common lamp and laser light sources. Janus photoconversion also appears to escape dark and/or protonated-state shelving observed in mEos4b and mEos4b-V70T, producing its red state on a shorter time scale in ensemble photoconversion measurements.
[0088] Janus is useful as a probe in super-resolution, photoactivated localization microscopy (PALM), because it has a high single molecule photon yield and low photoblinking tendency (<25% of molecules exhibit reversible dark state transitions under concurrent 405 and 561 illumination). Undesirable blinking is a common characteristic of popular photoconvertible fluorescent proteins with His-Tyr-Gly chromophores (mEos2, mEos3.2, mEos4b, mMaple1-3), and can cause systematic artifacts in PALM data. PC-FPs with lower reported blinking tendencies (Dendra2, mKikGR and A69T variant of mEos2) suffer from reduced molecular brightness (Dendra2, mEos2-A69T) or documented residual dimerization tendency (mKikGR).
[0089] The Janus photoconvertible fluorescent protein has advantages over other commercially available products in that it has an exceptional photoconversion contrast. Other advantages include generating a bright red state fluorescence for ensemble and single-molecule measurements; having a low photoblinking rate in single molecule localization microscopy; and is highly monomeric.
[0090] In some aspects, Janus fluorescent proteins can be used in applications for optical highlighting, super-resolution, and photoactivated localization microscopy (PALM).
[0091] In summary, along with its excellent performance as a fusion tag and optical highlighter, these photophysical characteristics translate to better localization precision and minimal overcounting error in single molecule PALM experiments. In some aspects, the Janus fluorescent protein can be used as a molecule counting probe.
[0092] Ignis Fluorescent Protein. The Ignis photoconvertible fluorescent protein has the highest green state pKa reported for any green to red photoconvertible fluorescent protein currently available, and a resultant increase in the absorbance of UV/Violet light by the neutral phenol form of its chromophore (peak ˜385 nm). This translates to more rapid photoconversion by UV/Violet light. Despite its remarkably elevated green state pKa, its red state pKa remains below 7. As a result, the majority of photoconverted red chromophores are fluorescent at or above physiological pH.
[0093] The extreme green state pKa was unexpected. Because of this unexpected property, in some aspects, the Ignis photoconvertible fluorescent protein can be used as a genetically-encoded photocleavable protein for protein purification and optogenetics applications as it is extremely sensitive to photoconversion by UV/violet illumination. cpIgnis is a circularly permutated form of Ignis that can be used as a genetically-encoded tag for photocleavage/optogenetics applications, divided at amino acid position 74/75 such that the N- and C-termini of Ignis have been relocated to asparagine 75 (Asn75, new N-terminus) and aspartate 74 (Asp74, new C-terminus). In cpIgnis, the chromophore is therefore at position His222-Tyr223-Gly224, and photoconversion induces a cleavage at between Phe221 and His223, liberating a twelve amino acid fragment inclusive of His222-Asp233.
[0094] Also disclosed herein are monoclonal antibodies or nanobodies to the His222-Asp233 “chromotag” epitope to permit biochemical/immunological detection of photocleaved products. In some aspects, the antibodies or nanobodies can be used in applications where near-instantaneous protein cleavage and subsequent tracking via biochemical or optical means are desirable.
[0095] The Ignis fluorescent protein has advantages over other commercially available products in that it has the highest recorded green state pKa in green-to-red photoconvertible fluorescent proteins. This means the cleavage of His63-Tyr62 proceeds efficiently at physiological pH due to abundance of violet/UV-absorbing neutral chromophores. It requires lower doses of potentially damaging violet/UV light, which is a distinct advantage in live-cell imaging and optogenetics applications.
[0096] In some aspects, Ignis fluorescent proteins can be used in photocleavable protein purification and optogenetics applications; super-resolution photoactivated localization microscopy (PALM); and as the basis for developing a chromotag epitope that can be used as a photocleavage-dependent epitope tag.
[0097] Compositions
[0098] Disclosed herein are photoconvertible fluorescent proteins or variants thereof comprising one or more mutations or substitutions of the mEos4b protein coding sequence. The mEos4b protein sequence corresponds to (SEQ ID NO: 1).
[0099] Disclosed herein are photoconvertible fluorescent proteins or variants thereof, wherein the photoconvertible fluorescent proteins or variants thereof comprise the coding region of the mEos4b protein. In some aspects, the coding region can comprise at least one or more mutations or substitutions.
TABLE-US-00001 TABLE 1 Amino acid sequences. SEQ ID NO: Sequence Name 1 MVSAIKPDMRIKLRMEGNVNGHHFVIDGDGTGKPYEGKQT mEos4b MDLEVKEGGPLPFAFDILTTAFHYGNRVFVKYPDNIQDYFK QSFPKGYSWERSLTFEDGGICNARNDITMEGDTFYNKVRFY GTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIEMAL LLEGNAHYRCDFRTTYKAKEKGVKLPGAHFVDHAIEILSHD KDYNKVKLYEHAVAHSGLPDNARR 2 MVSAIKPDMRIKLRMEGNVNGHHFVIDGDGTGKPYEGKQT Janus IDLEVKEGGPLPFAFDILTTAFHYGNRVFTKYPDNIQDYFKQ SFPKGYSWERSLTFEDGGICNARNDITMEGDTFYNKVRFYG TNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIEMALL LEGNAHYRCDFRTTYKAKEKGVKLPGAHFVDHAIEILSHDK DYNKVKLYEHAVAHSGLPDNARR 3 MVSAIKPDMRIKLRMEGNVNGHHFVIDGDGTGKPYEGKQT Ignis IDLEVKEGGPLPFAFDILTTAFHYGNRVFTKYPDNIQDYFKQ SFPKGYSWERSLTFEDGGICNARNDITMEGDTFYNKVRFYG TNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIEMALL LEGNAHYRCDFRTTYKAKEKGVKLPGAHFVDHAMEILSHD KDYNKVKLYEHAVAHSGLPDNARR
[0100] In some aspects, the one or more mutations or substitutions can be at residue 41 or 70 of the mEos4b protein coding sequence. In some aspects, the one or more mutations or substitutions can be at residues 41 and 70 of the mEos4b protein coding sequence. In some aspects, the photoconvertible fluorescent protein having mutations or substitutions at residues 41 and 70 of the mEos4b protein coding sequence can have the amino acid sequence corresponding to SEQ ID NO: 2. In some aspects, the one or more mutations or substitutions can be at residue 41, 70 or 197 of the mEos4b protein coding sequence. In some aspects, the one or more mutations or substitutions can be at residues 41, 70 and 197 of the mEos4b protein coding sequence. In some aspects, the photoconvertible fluorescent protein having mutations or substitutions at residues 41, 70 and 197 of the mEos4b protein coding sequence can have the amino acid sequence corresponding to SEQ ID NO: 3. In some aspects, the mutation or substitution at residue 41 can be a substitution of a methionine residue. In some aspects, the mutation or substitution at amino acid residue 41 can be a methionine to an isoleucine residue mutation or substitution (Met41Ile). In some aspects, the mutation or substitution at residue 70 can be a substitution of a valine residue. In some aspects, the mutation or substitution at residue 70 can be a valine to a threonine residue mutation or substitution (Val70Thr). In some aspects, the mutation or substitution at residue 41 can be a methionine to an isoleucine residue mutation or substitution (Met41Ile) and the mutation or substitution at residue 70 can be a valine to a threonine residue mutation or substitution (Val70Thr). In some aspects, the mutation or substitution at residue 197 can be a substitution of an isoleucine residue. In some aspects, the mutation or substitution at residue 197 can be an isoleucine to a methionine residue mutation or substitution (Ile197Met). In some aspects, the mutation or substitution at residue 41 can be a methionine to an isoleucine residue mutation or substitution (Met41Ile); and the mutation or substitution at residue 70 can be a valine to a threonine residue mutation or substitution (Val70Thr); and the mutation or substitution at residue 197 can be an isoleucine to a methionine residue mutation or substitution (Ile197Met).
[0101] Disclosed herein are photoconvertible fluorescent proteins, wherein the photoconvertible fluorescent proteins comprise the coding region of the mEos4b protein, wherein the coding region can comprise a mutation or substitution at mutation or substitution at residues 41 and 70, wherein the mutation or substitution at residue 41 can be a methionine to an isoleucine residue mutation or substitution (Met41Ile); and the mutation or substitution at residue 70 can be a valine to a threonine residue mutation or substitution (Val70Thr). In some aspects, the protein can have an excitation maximum at 571 mm. In some aspects, the protein can have an emission maximum at 585 nm. In some aspects, the excitation and emission spectra of the photoconvertible fluorescent protein or variants disclosed herein can be blue-shifted relative to mEos4b.
[0102] Disclosed herein are photoconvertible fluorescent proteins, wherein the photoconvertible fluorescent proteins comprise the coding region of the mEos4b protein, wherein the coding region can comprise a mutation or substitution at mutation or substitution at residues 41, 70 and 197, wherein the mutation or substitution at residue 41 can be a methionine to an isoleucine residue mutation or substitution (Met41Ile); and the mutation or substitution at residue 70 can be a valine to a threonine residue mutation or substitution (Val70Thr); and the mutation or substitution at residue 197 can be an isoleucine to a methionine residue mutation or substitution (Ile197Met). In some aspects, the protein can be in a circularly-permutated form. In some aspects, the circularly-permutated form can be a photocleavable tag. In some aspects, the photoconvertible fluorescent protein can be divided at residues 74 and 75, such that the N- and C-termini of the photoconvertible fluorescent protein g are relocated. In some aspects, the asparagine of residue 75 can be at the N-termini and the aspartate residue of residue 74 can be at the C-termini.
[0103] In some aspects, any of the photoconvertible fluorescent proteins or variants thereof disclosed herein can have an absorbance of UV/violet light around 385 nm. In some aspects, any of the photoconvertible fluorescent proteins or variants thereof disclosed herein have no mutations or substitutions that are located at surface residues of mEos4b that confer monomeric character.
[0104] Disclosed herein are molecule probes. In some aspects, the molecular probes can comprise any of the photoconvertible fluorescent proteins or variants thereof described herein.
[0105] Disclosed herein are monomers, dimers or tetramers of any of the photoconvertible fluorescent proteins or variants thereof described herein. Disclosed herein are monomers of any of the photoconvertible fluorescent proteins or variants thereof described herein.
[0106] Also disclosed herein, are compositions comprising any of the photoconvertible fluorescent proteins or variants thereof described herein.
[0107] Methods
[0108] Disclosed herein are methods for analyzing a physiologically active substance in a cell. In some aspects, any of the photoconvertible fluorescent proteins or variants thereof described herein can be expressed in the cell. In some aspects, the physiologically active substance can be a protein, a vector or a transformant. In some aspects, the methods can comprise analyzing localization or dynamic situation of a protein in the cell.
[0109] Disclosed herein are methods of performing live cell imaging. In some aspects, any of the photoconvertible fluorescent proteins or variants thereof described herein can be expressed in the cell. In some aspects, the methods can comprise analyzing localization or dynamic situation of a protein in the cell.
[0110] Disclosed herein are methods of identifying and localizing an individual fluorescent molecule. In some aspects, the fluorescent molecule can be one or more of the photoconvertible fluorescent proteins or variants thereof described herein. In some aspects, the method can comprise photo-activated localization microscopy or stochastic optical reconstruction microscopy.
EXAMPLES
Example 1: Ensemble Characterization of mEos4b
[0111] Introduction. A wide range of photoconvertible proteins are available to measure dynamic processes or conduct single molecule photo-activated localization microscopy (PALM) experiments (see, Table 2). However, these probes often exhibit drawbacks that limit their use across disciplines, such that optical highlighters with excellent bulk photoconversion properties do not perform as well as fusion tags or single molecule probes. For example, the EosFP derivative, mEos2, is a bright single molecule probe but yields lower photoconversion contrast than mMaple and retains residual dimerization tendency. Popular PALM probes mEos3.2 and mMaple3 both exhibit high photoblinking rates that complicate quantitation of single proteins in situ. Low photoblinking probes such as PAmCherry and Dendra2 are dimmer at the single molecule level and PAmCherry tends to oligomerize. The high pKa of mMaple3 and its derivatives reduces the brightness of its green state and red states 227, though there is conflicting evidence about its single molecule brightness; some studies report comparable photon yields to mEos3.2 (˜103 photons per localization), while others demonstrate about half the brightness (˜5×102 photons) consistent with its reportedly lower red state extinction coefficient. Hence, there exists a need for a more generally-applicable PC-FP that exhibits desirable characteristics such as low photoblinking, high single molecule photon yield and photoconversion contrast, and demonstrated fusion tolerance. Additionally, fluorescent proteins can be sensitive to chemical fixatives used in specimen preservation (Sanders, D. W. et al. Distinct tau prion strains propagate in cells and mice and define different tauopathies. Neuron 82, 1271-1288 (2014)), including dose-dependent reduction in single molecule localizations after formaldehyde fixation (Subach, F. V. et al. Photoactivation mechanism of PAmCherry based on crystal structures of the protein in the dark and fluorescent states. Proc. Natl. Acad. Sci. U S. A. 106, 21097-21102 (2009)) development due to the two distinct absorbance maxima at 396 and 475 nm. The identities of these peaks were quickly ascribed to the neutral and anionic forms of the p-mEos4b was engineered to resist harsh chemical fixation through the removal of surface exposed residues that may react with aldehydes and osmium tetroxide (Paez Segala, M. G. et al. Fixation-resistant photoactivatable fluorescent proteins for correlative light and electron microscopy. Nat. Methods 12, 215-218 (2015)). The protein is highly monomeric and exhibits exceptionally high green state brightness among Kaede-like PC-FPs due to its extinction coefficient (78,170 M.sup.−1cm.sup.−1) and appreciably high quantum yield (0.84). Overall, mEos4b is a highly refined and robust PC-FP with desirable optical characteristics. However, mEos4b is incompletely characterized as both a PALM probe and optical highlighter. As described herein, mEos4b was analyzed at the ensemble level using a variety of in vitro and in cellulo assays and it was found that it exhibits sub-optimal photoconversion properties.
TABLE-US-00002 TABLE 2 Properties of Photocontrollable Fluorescent Proteins Before Activation/Conversion After Activation/Conversion PC Ex Em Ex Em Protein Structure PDB λ State pKa Bright. λ λ ε Φ State pKa Bright. λ λ ε Φ PA-GFP Monomer n/a 400 Off n/a n/a n/a n/a n/a n/a On n/a 13.75 504 517 17400 0.79 PAm- Monomer* n/a 405 Off n/a n/a n/a n/a 6500 n/a On 6.3 8.28 564 595 18000 0.46 Cherry 1 PAmKate Monomer* n/a 405 Off n/a n/a n/a n/a n/a n/a On 5.6 4.50 586 628 25000 0.18 Kaede-Like PC-FPs Kaede Tetramer n/a 380 Green 5.6 86.94 508 518 98800 0.88 Red 5.6 19.93 572 580 60400 0.33 EosFP Tetramer 2BTG, 390 Green n/a 50.40 506 516 72000 0.70 Red n/a 22.55 571 581 41000 0.55 1ZUX mEosFP Monomer* 3P8U 400 Green 5.3 43.01 505 516 67200 0.64 Red 6.5 22.94 569 581 37000 0.62 mEos2 Monomer* 3S05 405 Green 5.6 47.04 506 519 56000 0.84 Red 6.4 30.36 573 584 46000 0.66 mEos2- Monomer 5DTL 405 Green 8.2 15.31 495 509 24300 0.63 Red 7.4 7.59 565 580 11500 0.66 A69T mEos3.1 Monomer n/a 405 Green 5.2 73.37 505 513 88400 0.83 Red 6.0 20.77 570 580 33500 0.62 mEos3.2 Monomer n/a 405 Green 5.4 53.26 507 516 63400 0.84 Red 5.8 17.71 572 580 32200 0.55 mEos4a Monomer n/a 405 Green 5.3 71.84 505 515 83530 0.86 Red 5.7 43.31 571 580 61000 0.71 mEos4b Monomer n/a 405 Green 5.5 65.66 505 516 78170 0.84 Red 5.8 39.41 570 580 55500 0.71 DendFP Tetramer n/a 405 Green 6.5 58.50 492 508 90000 0.65 Red 5.2 23.80 557 575 35000 0.68 Dendra Monomer n/a 405 Green 6.6 14.70 488 505 21000 0.70 Red 6.9 14.40 556 575 20000 0.72 Dendra2 Monomer 2VZX 480 Green 6.6 22.50 490 507 45000 0.50 Red 6.9 19.25 553 573 35000 0.55 Dendra2- Monomer n/a 405 Green 6.0 23.80 502 518 42500 0.56 Red 7.0 22.66 563 578 35400 0.64 T69A KikGR1 Tetramer 4P76 365 Green 7.8 37.59 507 517 53700 0.70 Red 5.5 22.82 583 593 35100 0.65 mKikGR Monomer* n/a 390 Green 6.6 33.81 505 515 49000 0.69 Red 5.2 17.64 580 591 28000 0.63 mClav- Monomer* n/a 405 Green 8.0 14.63 488 504 19000 0.77 Red 7.3 16.96 566 583 32000 0.53 GR2 mMaple Monomer* n/a 380 Green 8.2 11.10 489 505 15000 0.74 Red 7.3 16.80 566 583 30000 0.56 mMaple2 Monomer* n/a 405 Green n/a n/a 492 506 n/a n/a Red n/a n/a 570 582 n/a n/a mMaple3 Monomer n/a 405 Green n/a 5.83 491 506 15760 0.37 Red n/a 12.46 568 583 23970 0.52 mox- Monomer n/a 405 Green n/a 25.15 490 504 50300 0.50 Red n/a 17.16 551 571 31200 0.55 Dendra2 mox- Monomer n/a 405 Green n/a 5.48 490 506 14800 0.37 Red n/a 12.60 569 584 24230 0.52 Maple3 Non-Kaede-Like PC-FPs PS-CFP Monomer n/a 405 Cyan 4.0 5.44 402 468 34000 0.16 Green 6.0 5.13 490 511 27000 0.19 PS-CFP2 Monomer n/a 405 Cyan n/a 8.60 400 468 43000 0.20 Green n/a 10.81 490 511 47000 0.23 PSm- Monomer 4Q7T 480 Orange 6.2 57.78 548 565 113300 0.51 Far-red 5.6 9.16 634 662 32700 0.28 Orange PSm- Monomer 4Q7U 489 Orange 6.6 31.11 546 561 51000 0.61 Far-red 5.4 7.18 619 651 18900 0.38 Orange2
[0112] To better characterize mEos4b, a 6×-His tagged form of the protein was purified in E. coli. Mass spectrometry confirmed the presence of peak at ˜30,025.97 Da consistent with the predicted molecular mass of 30,026 Da, though several additional species were also present near this mass including a species of ˜30,007.95 Da. These peaks may be consistent with dehydration of the chromophore or other intermediates formed during chromophore cyclization (Wachter, R. M. Chromogenic Cross-Link Formation in Green Fluorescent Protein. Acc. Chem. Res. 40, 120-127 (2007)), but additional studies are required to firmly assign their identities.
[0113] The excitation and emission spectra of purified mEos4b are given in
[0114] Ensemble Fluorescence Properties of mEos4b in vitro. Consistent with a predominantly anionic p-HBI chromophore, mEos4b shows a strong absorbance band that peaks near 505 nm in the native state (
[0115] Ensemble Photoconversion of mEos4b in cellulo. To examine the performance of mEos4b as an optical highlighter and fusion partner, the protein was genetically tagged to the C-terminus of a membrane-targeted, N-myristoylated DmrB (FKBP/F36V) domain and assayed its photoconversion properties with wide-field epifluorescence microscopy. HeLa cells on glass bottom dishes were transfected with N-Myr-DmrB:mEos4b, or controls N-Myr-DmrB mEos3.2 and N-Myr-DmrB:Dendra2 and observed live 24 hours later. Brightly fluorescent cells were photoconverted under a DAPI-filtered Xenon lamp and imaged in green and red channels to assess wide-field photoconversion. Surprisingly, the photoconversion properties of mEos4b were noticeably inferior to those of Dendra2 and mEos3.2 under identical illumination conditions (
[0116] The results suggest that Dendra2 exhibits greater photoconversion efficiency—that is, the number of molecules that successfully convert to a fluorescent red state—than mEos3.2 than mEos4b in wide-field epifluorescence applications. However, such a conclusion is complicated by the variable brightness and excitation efficiency of each probe under widefield illumination, which reflect the sum their photophysical/spectral properties. The FPbase fluorophore efficiency report tool (www.FPbase.org) (Lambert, T. J. FPbase: a community-editable fluorescent protein database. Nat. Methods 16, 277 (2019)) was used and the excitation efficiency and brightness of each probe was estimated under wide-field excitation with green FITC (Ex: 480/30, Em: 535/50) and red TRITC (Ex: 540/25, Em: 605/55) filter sets. The order of theoretical green brightness rounded to two digits is mEos4b (21.28)>mEos3.2 (16.20)>Dendra2 (8.38). The order of red brightness is mEos4b (16.47)>Dendra2 (7.47)>mEos3.2 (5.87). Hence, if the conversion were unitary, mEos4b might be expected to yield ˜0.77 units of red fluorescence per one unit of green (16.47/21.28=0.77). Similarly, mEos3.2 should yield ˜0.36, Dendra2˜0.89 units of red fluorescence per unit of green. The order of predicted photoconversion yield is Dendra2 (0.89)>mEos4b (0.77)>mEos3.2 (0.36). To test these ratios, measurements of red fluorescence of each probe after 30 seconds and 5 minutes of photoconversion was correlated to the initial green state fluorescence before photoconversion (
[0117] The slopes of regression curves are given in Table 3. The photoconversion yields inferred from the regressions are progressive between 30 seconds and 5 minutes, as expected. However, the overall yield at 5 minutes is higher than expected given the incomplete depletion of the green states observed. This may reflect some error in the estimated hypothetical brightness, photoconversion from a dark state to the red state (which would under-estimate the green fluorescence intensity), or other causes of reduced green state fluorescence in the experiment such as photobleaching prior to image acquisition. Nonetheless if it is assumed that these factors are consistent across samples, the order of wide-field photoconversion yields places mEos4b last, in contrast to expectations. Relative to initial green intensity, the order was Dendra2 (1.0970)>mEos3.2 (0.8688)>mEos4b (0.6208). When mEos3.2 and mEos4b yields were instead correlated relative to peak green intensity, the order was Dendra2 (1.0970)>mEos3.2 (0.3667)>mEos4b (0.3308).
[0118] Discussion. The experiments described herein provide baseline optical and photoconversion properties of mEos4b. Consistent with literature results, these findings show a high green state extinction coefficient, green-to-red photoconversion upon 385 nm illumination, and low acid sensitivity as evidenced by pKa values of 5.6 and 5.74 for the green and red states (respectively) (Paez Segala, M. G. et al. Fixation-resistant photoactivatable fluorescent proteins for correlative light and electron microscopy. Nat. Methods 12, 215-218 (2015)). However, an unreported slow maturation of the protein was also characterized in vitro. A likely source of this slow maturation is incomplete maturation in E. coli prior to purification. In this regard, it is noted that the purification scheme involves a short IPTG induction at 32-34C (to enhance soluble protein yield), followed by immediate column purification, whereas others have expressed the protein in autoinduction media for prolonged periods at 37° C. (Paez Segala, M. G. et al. Fixation-resistant photoactivatable fluorescent proteins for correlative light and electron microscopy. Nat. Methods 12, 215-218 (2015); and Studier, F. W. Protein production by auto-induction in high density shaking cultures. Protein Expr. Purif. 41, 207-234 (2005)). It was suspected that prolonged expression at higher temperature increases the fraction of fully-matured molecules. However, it was found that lower temperatures to be important for mEos4b and mEos3.2 expression in the cells (NiCO2 Bl21), and hence have not directly tested this possibility.
TABLE-US-00003 TABLE 3 Linear Regression Statistics for Fig. 14 Vs. Initial Green Vs. Peak Green 0:00:30 0:05:00 0:05:00 Protein Slope R.sup.2 Slope R.sup.2 Slope R.sup.2 Dendra2 0.5166 ± 0.9795 1.0970 ± 0.9135 n/a n/a 0.0236 0.1067 mEos3.2 0.2665 ± 0.7951 0.8688 ± 0.8689 0.3667 ± 0.8466 0.0391 0.0974 0.0451 mEos4b 0.3954 ± 0.8285 0.6208 ± 0.6348 0.3308 ± 0.8998 0.0436 0.1142 0.0268
[0119] Wide-field photoconversion in live HeLa cells revealed unexpectedly poor photoconversion performance of mEos4b relative to popular Kaede-like PC-FPs, mEos3.2 and Dendra2. It is noted that the photoconversion contrast of mEos4b deviates from that of mEos3.2 at later time points in
[0120] The remarkable increase in mEos3.2 and mEos4b green states upon initial UV/Violet photoconversion revealed the existence of a dark, photoactivatable pool of proteins in live cells. This pool may be composed of proteins with mature (cyclized), but conformationally-strained or isomerized chromophores. Consistent with this possibility, it was recently shown that green mEos2 molecules can be driven into a dark state by illumination with green light (Thédié, D., Berardozzi, R., Adam, V. & Bourgeois, D. Photoswitching of Green mEos2 by Intense 561 nm Light Perturbs Efficient Green-to-Red Photoconversion in Localization Microscopy. J. Phys. Chem. Lett. 8, 4424-4430 (2017)), and both mEos4b green and red states exhibit reversible photoswitching between dark and fluorescent states (Paez Segala, M. G. et al. Fixation-resistant photoactivatable fluorescent proteins for correlative light and electron microscopy. Nat. Methods 12, 215-218 (2015)); and (De Zitter, E. et al. Mechanistic investigation of mEos4b reveals a strategy to reduce track interruptions in sptPALM. bioRxiv 475939 (2018)). It is tempting to speculate that the dark pool of mEos3.2 and mEos4b molecules observed in this study is a similar chemical species. Alternatively, this dark pool could be related to the slow maturation of observed for mEos4b in vitro, though this seems unlikely, because the recombinant protein does not demonstrate any appreciable increase in the absorbance of its 505 nm peak upon initial photoconversion with 385 nm light (
Example 2: Engineering the mEos4b Chromophore Environment
[0121] Introduction. The results of wide-field mEos4b photoconversion experiments raised the question of how to improve the photoconversion properties of mEos4b in order to produce a fixation-resistant and high-contrast PC-FP. The results suggested that both the photoconversion rate and overall red fluorescence yield of mEos4b are low, and both characteristics may negatively impinge on the use of mEos4b in quantitative localization microscopy. The green chromophore pKa of Kaede-like PC-FPs influences the photoconversion rate by increasing the fraction of molecules with protonated, neutral chromophores that absorb in the UV/violet range. A higher green pKa is therefore desirable. However, a high red stake pKa is undesirable as it will favor non-fluorescent, protonated red chromophores.
[0122] The currently-available Kaede-like PC-FPs may be categorized based on the shift in their chromophore pKa upon photoconversion from green to red. “Natural” PC-FPs, Kaede, EosFP-derivatives (mEos2, mEos3.2, mEos4b) and Dendra derivatives generally exhibit a positive, “ascending” pKa shift, with greater red pKa than green. In contrast, the synthetically-derived PC-FPs, mClavGR2, mMaple, mMaple2, mMaple3, KikGR, mKikGR each exhibit a “descending” shift in their chromophore pKa after photoconversion No monomeric Kaede-like PC-FP exists in the “descending” category with a pKa below physiological pH. mKikGR is the closest example (green pKa: 6.6; red pKa: 5.2), but its green state pKa is not exceptionally high, it exhibits undesirable oligomerization tendency (Wang, S., Moffitt, J. R., Dempsey, G. T., Xie, X. S. & Zhuang, X. Characterization and development of photoactivatable fluorescent proteins for single-molecule-based superresolution imaging. Proc. Natl. Acad. Sci. U.S.A. 111, 8452-8457 (2014)) and has not been developed to resist chemical fixation.
[0123] It was tested whether the direction and magnitude of pKa shift during photoconversion is central to efficient acquisition of a bright red state, and that a descending shift across the physiological pH range may yield an enhanced PC-FP. If true, the photoconversion properties of mEos4b could be improved through rational engineering of the chromophore environment to promote a high green state pKa and low red state pKa. Described herein are several mEos4b variants engineered for improved chromophore pKa characteristics.
[0124] Rational Selection of Target Sites for Mutagenesis in mEos4b. An alignment of mEos4b with monomeric PC-FPs is provided in
[0125] It was noted the conspicuous presence of methionine at position 40 in the PC-FPs with ascending pKa values. In contrast, PC-FPs with descending pKa values have a bulky nonpolar aliphatic residue (valine or isoleucine) in the equivalent position. In the structures of mEos2 and KikGR these residues are found immediately adjacent to the chromophore histidine imidazole moiety (
[0126] Another structural difference between mEos2 and KikGR is the alternative identity of residue 196 (197 in mEos4b), which resides near the chromophore tyrosine phenol ring (
[0127] A third position of interest that varies between PC-FPs with ascending and descending chromophore pKa values is residue 142, which is invariantly proline in EosFP derivatives, Dendra2, and mKikGR, but valine in the mMaple family. Residue 142 precedes the conserved Ser143, which forms well-documented hydrogen bonds with the chromophore tyrosine hydroxyl in anthozoan fluorescent proteins (Shu, X., Shaner, N. C., Yarbrough, C. A., Tsien, R. Y. & Remington, S. J. Novel Chromophores and Buried Charges Control Color in mFruits, Biochemistry 45, 9639-9647 (2006)); (Subach, F. V. & Verkhusha, V. V. Chromophore Transformations in Red Fluorescent Proteins. Chem. Rev. 112, 4308-4327 (2012)); and (Adam, V., Nienhaus, K., Bourgeois, D. & Nienhaus, G. U. Structural basis of enhanced photoconversion yield in green fluorescent protein-like protein Dendra2. Biochemistry 48, 4905-4915 (2009)). The cyclized side chain of homologous Pro141 in mEos2 is oriented toward the solvent and may speculatively impose some rigidity on the early residues of the β7 strand (including homologous Ser142), which passes immediately over the chromophore tyrosine in the PC-FPs. Therefore, it was tested whether the amino acid at position 142 in mEos4b may alter the conformation and hydrogen bonding of Ser143 to the chromophore, which may in turn differentially stabilize the anionic chromophore and alter its acidity.
[0128] Valine at the equivalent position of Pro142 in mMaple-family proteins is interesting due to its hydrophobicity and solvent exposure, and it is unclear how this residue impacts PC-FP photochemistry as it was introduced randomly alongside several other mutations during directed evolution of mMaple from mClavGR2. Unfortunately, no crystal structures of either protein are available. However, both were derived from a synthetic mTFP1 template (McEvoy, A. L. et al. mMaple: A Photoconvertible Fluorescent Protein for Use in Multiple Imaging Modalities. PLoS ONE 7, (2012)); and (Hoi, H. et al. A Monomeric Photoconvertible Fluorescent Protein for Imaging of Dynamic Protein Localization. J. Mol. Biol. 401, 776-791 (2010)), and it is noted that in the crystal structures of mTFP0.7, Ser146 (homolog of Ser143 in mEos4b) can be found in two conformations—one oriented outward from the beta barrel and one oriented inward toward the chromophore tyrosine (Henderson, J. N., Ai, H., Campbell, R. E. & Remington, S. J. Structural basis for reversible photobleaching of a green fluorescent protein homologue. Proc. Natl. Acad. Sci. 104, 6672-6677 (2007)), suggesting some plasticity in this region of β7. In mTFP1 and mClavGR2, the preceding residue (and homolog to Pro142 in mEos4b) is an alanine. Valine exhibits greater beta-strand preference than alanine, and hence the valine found in mMaple at this position may improve beta strand stability (Bhattacharjee, N. & Biswas, P. Position-specific propensities of amino acids in the β-strand. BMC Struct. Biol. 10, 29 (2010)). In support of this possibility, β7 rigidity and proper orientation of Ser143 homolog H148 was the important factor in development of the CFP derivative mTurquoise2 (Goedhart, J. et al. Structure-guided evolution of cyan fluorescent proteins towards a quantum yield of 93%. Nat. Commun. 3, 751 (2012)). If true, then an isosteric threonine substitution may be better tolerated at this position as it has similarly high beta-strand preference (Bhattacharjee, N. & Biswas, P. Position-specific propensities of amino acids in the β-strand. BMC Struct. Biol. 10, 29 (2010)) but would interact better with the bulk solvent due to its polar hydroxyl group. Therefore, to better understand the role of position 142 and potentially improve the folding/structural integrity of mEos4b variants, the effects of P142V and P142T were also examined.
[0129] Chromophore Characteristics of mEos4b Variants. mEos4b-V70T. As noted above, the A69T substitution has well-documented effects in mEos2 and mEos3.2, and its analogous substitution in mEos4b (V70T) demonstrates similar impacts on chromophore photochemistry (Turkowyd Bartosz et al. A General Mechanism of Photoconversion of Green-to-Red Fluorescent Proteins Based on Blue and Infrared Light Reduces Phototoxicity in Live—Cell Single—Molecule Imaging. Angew. Chem. Int. Ed. 56, 11634-11639 (2017)); and (Berardozzi, R., Adam, V., Martins, A. & Bourgeois, D. Arginine 66 Controls Dark-State Formation in Green-to-Red Photoconvertible Fluorescent Proteins. J. Am. Chem. Soc. 138, 558-565 (2016)). Thus, mEos4b photochemistry with mEos4b and mEos4b-V70T as guide templates was assessed. To complement the measurements of mEos4b chromophore acidity, the mEos4b-V70T pKa values were measured. In contrast to literature, a green pKa of 7.21±0.03 and red pKa of 6.96±0.05 for this variant was found (
[0130] Substitutions at Position 41 in mEos4b and mEos4b-V70T It was tested whether Met41 may interact with the chromophore histidine in mEos4b, and whether an introduction of a bulky, aliphatic side chain such as valine or isoleucine (observed in KikGR and mMaple-family proteins) could therefore specifically influence characteristics of the red chromophore. To examine the role of M41 in mEos4b photochemistry, an isoleucine was introduced at this position in mEos4b and mEos4b-V70T, as it presumably imposes the greatest steric and hydrophobic influence on the chromophore environment among nonpolar, aliphatic amino acids. It was found that mEos4b-M41I has an absorbance peak at 505 nm. However, purified solutions of this variant were dim to the eye and exhibited substantially reduced absorbance relative to mEos4b. Nonetheless, mEos4b-M41I did photoconvert under 385 nm LED illumination (
[0131] Despite the generally disappointing results of mEos4b-M41I, the M41I substitution produced a brightly fluorescent variant with improved photoconversion properties when introduced into the mEos4b-V70T template. The initial photoconversion tests were so encouraging that the mEos4b-M41I/V70T variant was named “Janus”—after the two-faced Roman god of transitions. Like mEos4b-V70T, the absorbance spectrum of native Janus at pH 7.4 features a prominent peak at 385 nm indicating substantial chromophore protonation (
[0132] Like mEos4b-V70T and Dendra2, Janus exhibits a hypsochromic shift in its green fluorescence spectrum relative to mEos4b, with excitation and emission maxima at 493 nm and 509 nm, respectively (
[0133] Methionine Substitution at Position 197 in mEos4b and Janus. Kaede-like PC-FPs except KikGR and mKikGR feature an isoleucine at position 197 (numbering relative to mEos4b). In KikGR and mKikGR, the homologous residue is instead a methionine (Met199). Given the proximity of Met199 to the chromophore tyrosine in KikGR (
[0134] mEos4b-I197M was not clearly fluorescent and this variant was not further characterized. This negative result suggested that Kaede-like PC-FPs do not tolerate a methionine at both positions 41 and 197, since KikGR family proteins have a valine at position 41 and no known Kaede-like PC-FPs have methionine in both positions. Alternatively, I197M may fundamentally hinder chromophore formation in mEos4b independent of other chromophore-proximal residues. To discriminate between these possibilities, I197M was introduced into the Janus variant (isoleucine at position 41) to generate mEos4b-M41I/V70T/I197M. Surprisingly, solutions of this mutant were faintly green to the eye but formed a deep red color within mere seconds of 385 nm LED illumination. The rapidity of photoconversion from an initially muted, indistinct material conjured the image of an igniting flame, and this variant was named “Ignis.”
[0135] Like the mEos4b variants examined herein, Ignis forms a p-HBI chromophore as indicated by a broad absorbance band with peak at 446 nm in 1M NaOH. However, the native chromophore is almost entirely protonated at pH 7.4 (
[0136] The fluorescence spectra of Ignis are provided in
[0137] Valine and Threonine Substitutions at Position 142 of Janus. Characterization of P142V and P142T variants is described herein. Given the improved performance of Janus relative to mEos4b and mEos4b-V70T, P142V and P142T were introduced into this variant in lieu of mEos4b to improve folding or pKa characteristics of the probe. The absorbance spectra of Janus-P142V and Janus-P142T are provided in
[0138] Ensemble Fluorescence Photoconversion of mEos4b and Janus in vitro. The absorbance spectra of Janus solutions photoconverted under 385 nm LED illumination prompted examination of the photoconversion rate as measured via fluorescence. Droplets of mEos4b and Janus were prepared as emulsions in 8-octanol and photoconversion time courses of single isolated droplets were measured with confocal laser scanning microscopy (Kremers, G.-J. & Piston, D. Photoconversion of Purified Fluorescent Proteins and Dual-probe Optical Highlighting in Live Cells. JOVE J. Vis. Exp. e1995 (2010)). Here 405 nm laser scans were used to photoconvert each protein, followed by 488 nm and 561 nm laser scans to readout fluorescence from the green and red forms, respectively (
[0139] Overall, Janus photoconverted much more efficiently than mEos4b. Single exponential fits through the red fluorescent maxima revealed that Janus reaches a plateau at ˜1.79±0.09×the initial green intensity, whereas mEos4b reached ˜0.50±0.02 times the initial green intensity (
[0140] These results also revealed an initial increase in green fluorescence intensity for both proteins at the first post-conversion time points analyzed (
[0141] Benchmarking mEos4b Variants as Optical Highlighters. To better establish the performance of mEos4b, mEos4b-V70T and Janus in practical conditions, live cell confocal photoconversion experiments were performed and the photoconversion contrast of each probe was compared to Dendra2 and mEos3.2. N-myristoylated DmrB:PCFP fusions were expressed in HeLa cells and progressively photoconverted with 15-second pulses of low intensity 405 nm laser illumination. Contrast values after 10 and 20 pulses (150 and 300 seconds, respectively) are given in
[0142] Discussion. This Example examined residue-specific effects on the chromophore acidity and photoconversion properties of mEos4b. The principle conclusions of this study concern the influence of specific residues on chromophore pKa in mEos4b, and the resulting impact of altered chromophore photochemistry on photoconversion performance.
[0143] A Nuanced View of Threonine 70 and Green Chromophore pKa. The data indicate that mEos4b-V70T can be classified as a PC-FP with descending pKa upon photoconversion, though the magnitude of this descent (˜0.2 pH units) is modest in comparison to other PC-FPs. Under monoprotic Henderson-Hasselbalch behavior, green mEos4b-V70T chromophores should be ˜40% protonated, and red mEos4b-V70T chromophores ˜73% deprotonated at physiological pH. If photoconversion is largely dependent on the fraction of available neutral green chromophores, mEos4b-V70T should convert quickly and yield a majority population of anionic (fluorescent) chromophores. However, it was found that both mEos4b and mEos4b-V70T photoconverted similarly in vitro at early time points under 385 nm LED illumination. In contrast, Janus and Ignis proteins photoconvert efficiently in vitro as indicated by the accumulation of red anionic chromophore in their absorbance spectra upon 385 nm mediated illumination. Recombinant Janus outperforms mEos4b in fluorescence photoconversion assays despite revealing a lower photoconversion rate constant in the protein droplet assay. These results, however, do not report on the molecular quantum yield of photoconversion (i.e., how many molecules reach a red state per photon absorbed) without correcting for protein extinction coefficient and molecular brightness (McEvoy, A. L. et al. mMaple: A Photoconvertible Fluorescent Protein for Use in Multiple Imaging Modalities. PLoS ONE 7, (2012)); and (Habuchi, S., Tsutsui, H., Kochaniak, A. B., Miyawaki, A. & Oijen, A. M. van. mKikGR, a Monomeric Photoswitchable Fluorescent Protein. PLOS ONE 3, e3944 (2008)). The measurements of single molecule photoconversion kinetics as disclosed herein can provide additional measurements of this property. Nonetheless, these data provide a functional assessment of PC-FP performance under commonly used illumination conditions. Moreover, the recombinant data are remarkably consistent with in cellulo photoconversion results, which establish Janus as superior to mEos4b, mEos4b-V70T, mEos3.2 and Dendra2 as an optical highlighter.
[0144] The photoconversion performance of mEos4b derivatives tested here are at first perplexing because mEos4b-V70T, Janus, and Ignis each possess the V70T substitution that is known to elevate the green state chromophore pKa of EosFP family PC-FPs (Turkowyd Bartosz et al. A General Mechanism of Photoconversion of Green-to-Red Fluorescent Proteins Based on Blue and Infrared Light Reduces Phototoxicity in Live-Cell Single-Molecule Imaging. Angew. Chem. Int. Ed. 56, 11634-11639 (2017)); and (Berardozzi, R., Adam, V., Martins, A. & Bourgeois, D. Arginine 66 Controls Dark-State Formation in Green-to-Red Photoconvertible Fluorescent Proteins. J. Am. Chem. Soc. 138, 558-565 (2016)), rendering them more similar to Dendra2 (Adam, V., Nienhaus, K., Bourgeois, D. & Nienhaus, G. U. Structural basis of enhanced photoconversion yield in green fluorescent protein-like protein Dendra2. Biochemistry 48, 4905-4915 (2009)). Indeed, green pKa values were measured at 7.21, 7.57 and 8.59 for these proteins, respectively. Yet the results indicate that the higher green state pKa conferred by V70T is insufficient to substantially improve photoconversion in mEos4b derivatives in vitro. In this light, it is significant that KikGR and mKikGR both have elevated green state pKa values and reportedly efficient photoconversion (Tsutsui, H., Karasawa, S., Shimizu, H., Nukina, N. & Miyawaki, A. Semi-rational engineering of a coral fluorescent protein into an efficient highlighter. EMBO Rep. 6, 233-238 (2005)); and (Turkowyd Bartosz et al. A General Mechanism of Photoconversion of Green-to-Red Fluorescent Proteins Based on Blue and Infrared Light Reduces Phototoxicity in Live-Cell Single-Molecule Imaging. Angew. Chem. Int. Ed. 56, 11634-11639 (2017)), yet neither contain substitutions equivalent to V70T. Indeed, both proteins contain a valine at the equivalent position 70, like mEos4b. This observation challenges an explicit role of a Thr70-Arg67 interaction in mediating photoconversion efficiency in mEos4b—as has been suggested from work in Dendra2 and mEos2-A69T—despite the clear effect that this interaction has on chromophore pKa in the three proteins. Therefore, one interpretation of these studies is that elevated green pKa is important but not sufficient for green-to-red photoconversion in Kaede-like PC-FPs.
[0145] Alternative Factors in Photoconversion: Red pKa and pKa Descent? The poor photoconversion of mEos4b-V70T raises the question of what additional factors must be present to increase photoconversion rate and/or yield? One factor appears to be a sufficiently low red chromophore pKa, since photoconversion to a protonated red state would manifest as impaired photoconversion yield and lower photoconversion contrast. Both Janus and Ignis have a lower red state chromophore pKa (6.57, 6.72) than mEos4b-V70T (6.96), which result in ˜87% and ˜82% deprotonated red chromophores vs. 73% in mEos4b-V70T. It seems unlikely that 14% and 9% differences in chromophore protonation state can explain the superior photoconversion of Janus and Ignis alone, but it is likely important when coupled with the higher green state pKa (and therefore a greater availability of neutral, photo-convertible chromophore). These data are consistent with a model in which both the magnitude of pKa descent between green and red states, and the final red pKa, dictate photoconversion efficiency in Kaede-like PC-FPs.
[0146] How then does one explain the low photoconversion contrast and apparent plateau of red mEos4b chromophore observed in three independent experimental systems (live widefield photoconversion, swept-field confocal photoconversion, and confocal photoconversion of recombinant proteins in vitro)? First, a slower rate of photoconversion might be expected due to mEos4b's low green pKa (5.6), since less than 2% of chromophores are available for photoconversion at pH 7.4. However, this predicts a slow rate of continuous accumulation and not a plateau. The rapid halt in red chromophore accumulation suggests additional photochemistry at play. Two possible explanations include: (1) rapid photobleaching of the red state; and (2) an alternative photoconversion pathway that yields a long-lived or permanently dark chromophore product instead of a fluorescent red chromophore. The possible existence of an alternative photoconversion pathway/product is attractive since the 505 nm green absorbance peak of mEos4b continues to decline at time points beyond the plateau in red chromophore accumulation (
[0147] The Green Chromophore pKa of Ignis. The development of Ignis via reciprocal methionine/isoleucine substitutions on opposite ends of the chromophore (Met41Ile, and Ile197Met) is a particularly interesting result. The absorbance spectrum of Ignis is reminiscent of the T203I mutant of AvGFP (Heim, R., Prasher, D. C. & Tsien, R. Y. Wavelength mutations and posttranslational autoxidation of green fluorescent protein. Proc. Natl. Acad. Sci. U.S.A. 91, 12501-12504 (1994)); and (Ehrig, T., O'Kane, D. J. & Prendergast, F. G. Green-fluorescent protein mutants with altered fluorescence excitation spectra. FEBS Lett. 367, 163-166 (1995)). Like AvGFP T203I, the chromophore of Ignis is mostly protonated at pH 7.4 (about 94% assuming monoprotic behavior). It is noted that Thr203 occupies an influential position just above the chromophore tyrosine hydroxyl on the tenth beta strand (β10) of AvGFP (here “above” means nearer the N-terminus). Along with His148 and Ser205, Thr203 forms an intricate hydrogen bond network with the chromophore tyrosine phenolate and a water molecule, partially stabilizing the chromophore in its anionic state. In mEos2, Ile196 (homolog of Ile197 in mEos4b and Met197 in Ignis) is also located on β10, at the same position as Ser205 in AvGFP (
[0148] Initial Insight into the Role of Proline 142. Characterization of Janus-P142V and Janus-P142T support the role of Pro142 in stabilizing the green anionic chromophore as both valine and threonine substitutions result in a decreased absorbance of the anionic chromophore peak and substantial absorbance of the broad neutral chromophore peak at 385 nm. The consequences of valine substitution appear more severe than threonine, as evidenced by the clear difference in anionic absorbance bands between Janus-P142V and Janus-P142T. This may be consistent with a more stable conformation of (37 conferred by threonine due to its polarity and solvent exposure, as opposed to valine. This is an example of isosteric substitution on the surface of a fluorescent protein yielding a measurable impact on the properties of the buried chromophore, ostensibly due to the change in polarity of the side chain. How other polar residues at this position may influence the absorbance and fluorescence properties of Kaede-like PC-FPs is contemplated.
[0149] These data suggest that the green pKa values of both variants will be positively shifted relative to Janus. If true, it may partially explain the differences between mMaple from mClavGR2 achieved by directed evolution, since an alanine-to-valine substitution was introduced at this position in mMaple, and mMaple has a higher green pKa than mClavGR2 (McEvoy, A. L. et al. mMaple: A Photoconvertible Fluorescent Protein for Use in Multiple Imaging Modalities. PLoS ONE 7, (2012)).
[0150] Other modifications are introduced at internal sites that should have little impact on the self-association of the highly monomeric mEos4b. However, introduction of valine could pose a problem due to its hydrophobicity. It is noted that despite the presence of this valine in mMaple3, it is highly monomeric, and its monomerization was achieved through the incorporation of the same amino acid substitutions that rendered mEos3.2 and mEos4a/mEos4b monomeric relative to mEos2 (Wang, S., Moffitt, J. R., Dempsey, G. T., Xie, X. S. & Zhuang, X. Characterization and development of photoactivatable fluorescent proteins for single-molecule-based superresolution imaging. Proc. Natl. Acad. Sci. U.S.A. 111, 8452-8457 (2014)). Therefore, it is not anticipated that this mutation will have an effect on oligomerization propensity of Janus-P142V.
Example 3: Single Molecule Characterization of mEos4b Derivatives
[0151] Introduction. The ensemble fluorescence properties of fluorescent proteins reflect an average of population-wide single molecule emissions. Measurements of fluorescence at the single-molecule level therefore affords greater understanding of fluorescent proteins. PC-FPs exhibit substantial diversity in their single molecule fluorescence characteristics. Differences between PC-FPs should be considered carefully when selecting a probe for single molecule experiments to avoid inappropriate experimental or analytical approaches. Unfortunately, the single molecule properties of new fluorescent proteins are not routinely characterized alongside bulk fluorescence properties. Hence, PC-FPs were adopted for use before their characteristics were fully understood—leading to post-hoc discoveries such as photoblinking in mEos2.
[0152] Single molecule techniques such as PALM permit sensitive dissection of photophysical behaviors of individual PC-FPs. including blinking statistics, photoconversion kinetics, and photon yields. The photoconversion properties of mEos4b, mEos4b-V70T, Janus and Ignis suggested differences in the photophysics of the green-to-red chromophore transformation, as well as possible variations in the fluorescence properties of the red chromophore. PALM is well-suited to measure these properties. As described herein, PALM was used to measure single molecule fluorescence from populations of each PC-FP in vitro. The results reveal the photophysical origins of differences observed in preceding ensemble fluorescence experiments.
[0153] Two principle illumination schemes were utilized in the in vitro PALM experiments (
[0154] Blinking Propensity of mEos4b Derivatives. Photoblinking of PC-FPs is a common phenomenon that must be characterized and properly accounted for in PALM experiments. Although the precise mechanism(s) that govern photoblinking in PC-FPs are incompletely understood, the A69T substitution in mEos2 reduces the molecule's intrinsic photoblinking probability (Berardozzi, R., Adam, V., Martins, A. & Bourgeois, D. Arginine 66 Controls Dark-State Formation in Green-to-Red Photoconvertible Fluorescent Proteins. J. Am. Chem. Soc. 138, 558-565 (2016)). Because the low-blinking PC-FP, Dendra2, also possesses a threonine at the equivalent position (Thr74), it was tested whether this residue might control photoblinking in Kaede-like PC-FPs. However, this hypothesis is challenged by the fact that both mMaple and mMaple3 exhibit high blinking propensities despite the presence of a threonine at position 78 (equivalent to positions 69 in mEos2 and 74 in Dendra2; see
[0155] In contrast to mEos4b, mEos4b-V70T, Janus, and Ignis each possess threonine at position 70. A such, it was reasoned that mEos4b-V70T should exhibit reduced blinking propensity relative to mEos4b (like mEos2-A69T relative to mEos2) since the chromophore-oriented mutation introduced into mEos2 during the engineering of mEos4b was A70V (meant to improve chromophore packing) (Paez Segala, M. G. et al. Fixation-resistant photoactivatable fluorescent proteins for correlative light and electron microscopy. Nat. Methods 12, 215-218 (2015)). However, it was not clear how Janus and Ignis might blink since both contain additional Met41Ile substitutions relative to mEos4b and mEos4b-V70T, and the equivalent residue to Ile41 in high-blinking mMaple3 is also an isoleucine. As noted herein, this isoleucine resides near the imidazole of His63 in the red chromophore and may therefore influence its excited state dynamics.
[0156] To understand the intrinsic blinking behavior of each protein, picomolar solutions in PBS pH 7.4 were deposited on clean glass coverslips and imaged with PALM. After washing to remove unattached molecules, the sparsely adhered molecules were exposed to ten seconds of low-power 405 laser illumination (˜2 W/cm.sup.2). The 405 nm laser was then switched off and a high-power 561 nm readout laser (˜500 W/cm.sup.2) was turned on to excite red state fluorescence (
[0157] A summary of blinking statistics is provided in Table 4. The mEos4b blinking distribution revealed a blinking probability (1-p) of 0.73 and a mean of 2.7 blinks per molecule (
TABLE-US-00004 TABLE 4 Summary of Blinking Statistics Without 405 pH 7.4 pH 8.0 p.sup.Geo B.sub.0 RF Mean N.sub.MOl p.sup.Geo B.sub.0 RF Mean N.sub.MOl mEos4b 0.27 ± 0.28 2.7 615 0.33 ± 0.345 2.0 653 0.01 0.02 mEos4b- 0.69 ± 0.66 0.45 455 0.70 ± 0.69 0.42 388 V7OT 0.04 0.02 Janus 0.77 ± 0.745 0.30 873 0.76 ± 0.735 0.32 529 0.02 0.02 Ignis 0.70 ± 0.69 0.42 1283 0.74 ± 0.72 0.36 1245 0.03 0.02 mEos4b 0.40 ± 0.415 1.5 4454 0.43 ± 0.44 1.3 2643 0.02 0.03 mEos4b- 0.71 ± 0.68 0.40 4973 0.73 ± 0.71 0.36 3464 V7OT 0.03 0.03 Janus 0.80 ± 0.77 0.25 4852 0.82 ± 0.79 0.23 4417 0.03 0.02 Ignis 0.76 ± 0.74 0.31 4874 0.76 ± 0.745 0.31 5450 0.02 0.02
[0158] Buffer pH influences the protonation state of the HYG chromophore, but the effect of pH on blinking is unclear. It was also tested whether alkaline pH might reduce photoblinking by favoring the anionic state of the chromophore. At pH 8.0 there was a strong trend toward less photoblinking for mEos4b (p=0.0527, two sample Kolmogorov-Smirnov test). The geometric fit to the data indicated a mean of 2.0 blinks per molecule (
[0159] PALM experiments are normally run in the presence of pulsed or continuous UV/violet illumination that gradually increases in intensity over the course of an experiment (in order to maintain a steady photoactivation rate). Therefore, next, the effect of concurrent illumination with 561 nm and 405 nm laser light on PC-FP blinking propensity was examined (see Scheme 2 in
[0160] On/Off-Times of mEos4b Derivatives. Blinking is the manifestation of physical transitions between fluorescent “on” and non-fluorescent “off” states (
[0161] The decay rate of on-time distributions, k.sub.on, may be fit to the single exponential relationship in Equation 4.3.1.
f(t)=ae.sup.−k.sup.
Here, k.sub.on is the sum of dark state transition rate, k.sub.d, and the bleaching rate, k.sub.b, and the average on time can be calculated as 1/k.sub.on. Additionally, the instantaneous probability of blinking is equal to the fraction of total off state transitions, (k.sub.d+k.sub.b) attributable to the dark state transition rate, k.sub.d (Equation 4.3.2). Note that this latter probability is equivalent to (1−p), where p is the zero-blink probability calculated from geometric fits to the blinking distribution.
Off-times can be fit to monophasic (Avilov, S. et al. In cellulo Evaluation of Phototransformation Quantum Yields in Fluorescent Proteins Used As Markers for Single-Molecule Localization Microscopy. PLoS ONE 9, (2014)) or biphasic (Lee, S.-H., Shin, J. Y., Lee, A. & Bustamante, C. Counting single photoactivatable fluorescent molecules by photoactivated localization microscopy (PALM). Proc. Natl. Acad. Sci. U.S.A. 109, 17436-17441 (2012)); and (Annibale, P., Vanni, S., Scarselli, M., Rothlisberger, U. & Radenovic, A. Quantitative Photo Activated Localization Microscopy: Unraveling the Effects of Photoblinking. PLOS ONE 6, e22678 (2011)) exponential decay equations (Equations 4.3.2 and 4.3.3) to obtain the return rate(s) from nonfluorescent dark state(s). Two return rates (slow k.sub.r1 and fast k.sub.r2) with a ratio α=k.sub.r2/k.sub.r1 were observed for mEos2 and may reflect two dark states or modes of fluorescence reacquisition, whereas a single monophasic return rate (k.sub.rm) instead suggests a single type of transition.
The on- and off-time distributions of mEos4b derivatives were examined at pH 7.4 and pH 8.0 in both the presence and absence of 405 nm illumination. Kinetic parameters derived from fits are summarized in Table 5. On-times were well fit to the single exponential of equation 4.3.1, but in contrast to some prior studies, off-time distributions were suitably fit by monophasic exponential equations (standard error/RMSE<0.01) and did not support the involvement of a slow return rate described by k.sub.r1 (though this may relate to different integration times, see Discussion). In each case examined, the fast rate constant fit to Equation 4.3.4, k.sub.r2, was nearly equivalent to the monophasic rate constant, k.sub.rm, fit by equation 4.3.3, and k.sub.r1 was three to four order of magnitude smaller than k.sub.r2. Unless otherwise specified the monophasic fit parameter, k.sub.rm is discussed below.
TABLE-US-00005 TABLE 5 Photokinetic Statistics of mEos4b and Derivatives Without 405 pH 7.4 pH 8.0 k.sub.rl k.sub.rl k.sub.on k.sub.d k.sub.b (x10.sup.-5) k.sub.r2 k.sub.rm k.sub.on k.sub.d k.sub.b (x10.sup.-5) k.sub.r2 k.sub.rm mEos4b 7.06 ± 5.15 1.91 7.95 ± 0.718 ± 0.715 ± 7.59 ± 5.05 2.54 9.55 ± 0.71 ± 0.705 ± 0.80 8.3 0.018 0.018 0.94 8.7 0.018 0.017 mEos4b 4.51 ± 1.39 3.12 30.6 ± 0.913 ± 0.893 ± 5.33 ± 1.57 3.76 23.7 ± 0.58 ± 0.567 ± -V7OT 0.34 0.913 5.33 12 0.037 0.036 0.54 13 0.31 0.030 Janus 5.62 ± 1.30 4.32 28.9 ± 1.48 ± 1.46 ± 4.72 ± 1.15 3.57 32.9± 1.39± 1.37± 0.53 12 0.043 0.043 0.23 13 0.046 0.045 Ignis 8.57 ± 2.54 6.03 28.8 ± 2.22 ± 2.21 ± 7.15 ± 1.88 5.27 26.7 ± 1.86 ± 1.85 ± 0.52 11 0.048 0.048 0.38 10 0.046 0.045 With 405 pH 7.4 pH 8.0 k.sub.rl k.sub.rl k.sub.on k.sub.d k.sub.b (x10.sup.-5) k.sub.r2 k.sub.rm k.sub.on k.sub.d k.sub.b (x10.sup.-5) k.sub.r2 k.sub.rm mEos4b 6.27 ± 3.73 2.54 4.02 ± 1.90 ± 1.9 ± 6.21 ± 3.53 2.68 3.32 ± 2.11 ± 2.10± 0.19 6.21 12 0.038 0.038 0.16 19 0.052 0.052 mEos4b 6.01 ± 1.74 4.27 6.08 ± 2.07 ± 2.07 ± 5.34 ± 1.41 3.92 2.66 ± 1.88 ± 1.88 ± -V7OT 0.42 7.8 0.027 0.026 0.31 15 0.043 0.043 Janus 4.88 ± 0.97 3.91 11.7 ± 2.08 ± 2.08 ± 4.60 ± 0.85 3.75 8.26± 1.92± 1.91 0.29 9.1 0.033 0.033 0.24 13 0.044 ±0.043 Ignis 8.51 ± 2.03 6.48 23.1 ± 2.24 ± 2.22 ± 7.11 ± 1.70 5.41 16.9 ± 1.89 ± 1.88 ± 0.33 8.3 0.037 0.037 0.22 8.4 0.033 0.033
[0162] At pH 7.4, mEos4b shows an average on time of ˜0.14 seconds (k.sub.on=7.06±0.80 s.sup.−1, error reported as 95% confidence interval). In the presence of 405 nm light, k.sub.on was fit to a lower value of 6.27±0.19 s.sup.−1 (
[0163] The on-time distribution of mEos4b-V70T at pH 7.4 indicates an average on-time of ˜0.22 seconds (k.sub.on=4.51±0.34 s.sup.−1)—about 63% of the value of mEos4b under the same conditions. Unlike mEos4b, 405 nm light increased the k.sub.on of mEos4b-V70T (6.01±0.19 s.sup.−1), such that the average on time was reduced to ˜0.17 seconds. Given the lower blinking rate of mEosb-V70T, most of the on-time decay is attributable to the photobleaching rate, k.sub.b, which was substantially increased by 405 nm irradiation.
[0164] In the absence of 405 nm light, the dark state return rate of mEos4b-V70T was 0.893±0.036 s.sup.−1, and this increased to 2.07±0.026 s.sup.−1 with 405 nm irradiation (
[0165] Janus exhibited intermediate pH 7.4 on times with a k.sub.on of 5.61±0.53 s.sup.−1. Unlike mEos4b-V70T, k.sub.on was lower with concurrent 405 nm illumination, at 4.88±0.29 s.sup.−1 (
[0166] Ignis on times at pH 7.4 were the shortest of the four proteins tested, with k.sub.on values fit to 8.57±0.52 s.sup.−1 and 8.51±0.60 s.sup.−1 in the absence and presence of 405 nm illumination, respectively (
[0167] Given its low blinking rate, the on state decay rates of Ignis are mostly described by the bleaching rate, k.sub.b, which were the highest of the tested PC-FPs regardless of pH or illumination scheme. Off-time distributions generally revealed return rates between 1.86±0.046 and 2.24±0.037 s.sup.−1. Like other PC-FPs examined, these rates were slightly lower at pH 8.0, but insensitive to 405 nm laser light (
[0168] Spatio-Temporal Grouping and Dark Time, T.sub.D. Overcounting due to photoblinking can be corrected by grouping together temporally distinct, but spatially adjacent emissions that originate from the same molecule (e.g. “spatio-temporal grouping”). In the case of a single PC-FP (or obligate monomer fused to a PC-FP) this is relatively simple, because the emissions within close spatial proximity to the initial emission may be assumed to arise from the same molecule. In this case, accurate grouping requires knowledge of the average spread between sub-pixel localizations (usually about 45-90 nm), because the localized emission events may be grouped together within this distance regardless of the temporal gap between their appearances in the experiment. However, when multiple molecules occupy the same space within the resolution of a PALM experiment, one cannot assume that every emission originates from the same molecule. Hence, grouping of nearby emissions across the entire time course of an experiment will result in under-counting by merging emissions that actually originate from independent molecules.
[0169] PALM experiments separate the emissions of spatially overlapping molecules in the temporal dimension, so it should be possible to discriminate between molecules that photoactivate/photoconvert at different time points if the rate of photoactivation of new molecules occurs on a larger time scale than the duration of a molecule's photoblinking period. This raises the question of how much “dark” time (T.sub.D) must elapse between sequential (spatially overlapping) emissions in a PALM experiment before the next emission can be confidently assigned as the first emission of a new, independent molecule.
[0170] This question can be examined empirically by measuring how the number of ungrouped localizations decays with increasing values of T.sub.D. With no dark time, every continuous burst of fluorescence is counted as an independent molecule. As T.sub.D is increased, the number of estimated molecules decreases as more emissions are grouped together (
[0171] The 95% dark times of Janus and Ignis at pH 7.4 and pH 8.0 are significantly shorter than those of mEos4b and mEos4b-V70T. Janus required 4.8±0.70 seconds of dark time at pH 7.4, and 4.57±1.4 seconds of dark time at pH 8.0. Ignis required 3.66±0.15 seconds and 3.57±0.32 seconds of dark time at pH 7.4 and pH 8.0, respectively. This is consistent with both the lower blinking and the faster dark state return rates of Janus and Ignis vs. mEos4b. The longer 95% dark time required by mEos4b-V70T absent 405 nm light relates to its slower dark state return rates and longer dark state dwell times than Janus or Ignis (1.2-1.76 vs. 0.45-0.73 seconds, respectively).
[0172] In response to 405 nm light, 95% dark times were reduced for mEos4b, meos4b-V70T and Janus. At pH 7.4 and 8.0, mEos4b was reduced from 8.1±0.36 sec and 7.4±0.56 sec to 3.7±0.53 sec and 3.67±0.15 sec, respectively. Likewise, mEos4b-V70T transitioned from 7.53±0.74 sec and 6.87±0.91 sec to 2.53±0.58 sec and 1.97±0.33 sec. Janus required the shortest T.sub.D values with 405 illumination at 2.02±0.39 sec and 1.64±0.21 sec. In contrast, Ignis resembled mEos4b, particularly at pH 8.0 though the data were much more variable (
[0173] The unexpected divergence between mEos4b/mEos4b-V70T and Janus/Ignis dark times prompted the shapes of T.sub.D decay curves to be examined for each PC-FP. Overall, the curves were well fit by biphasic exponential decay models and revealed the contributions of both fast and slow decay rates. The magnitude of contribution by the slow rate was suppressed by 405 nm laser illumination for the probes tested except Ignis (which remained unchanged), such that the fast decay rate dominated the decay profiles (“% Fast” in
[0174] Photoconversion Kinetics of mEos4b Derivatives. As described herein, the photoconversion of mEos4b and its engineered derivatives were monitored by the ensemble absorbance or fluorescence intensity of the photoconverted red chromophore. However, measurements of absorption and fluorescence intensity may not directly reveal the molecular photoconversion rate (e.g., how many individual proteins convert from green to red per unit time) without knowledge of the extinction coefficient and quantum yield of the red species being measured. In principle, if photoconversion goes to completion, then the moles of native green species could be neatly related to the moles of resulting red chromophore simply by comparing the extinction coefficients or relative fluorescence yields of each species. However, this is impractical for several reasons highlighted in preceding experiments: (1) The presence of residual green chromophore signal indicates incomplete photoconversion vitro and in cellulo; (2) Excitation maxima (and therefore excitation efficiencies) vary between each PC-FP, which influences fluorescence intensity independent of chromophore content; (3) Photobleaching reduces measured fluorescence intensities; and (4) The red chromophore content reaches a plateau prior to green chromophore depletion. Together these factors complicate the interpretation of photoconversion rates and limit mechanistic insight into the differences observed between each PC-FP.
[0175] The substantial improvements in photoconversion contrast and red chromophore accumulation in Janus and Ignis might be explained by improved photoconversion rates at the single molecule level. To this end, the rate at which new red molecules appeared during a PALM experiment was measured. Samples were illuminated first with a 561 nm laser, and then a 405 nm laser at constant power to stimulate photoconversion (Scheme 2,
[0176] Cumulative single molecule photoconversion plots were fit with mono- and biphasic exponential association models to extract photoconversion rate constants (Thédié, D., Berardozzi, R., Adam, V. & Bourgeois, D. Photoswitching of Green mEos2 by Intense 561 nm Light Perturbs Efficient Green-to-Red Photoconversion in Localization Microscopy. J. Phys. Chem. Lett. 8, 4424-4430 (2017)) (
[0177] At pH 7.4, the monophasic fits revealed rate constants of 3.865±0.017×10.sup.−2 s.sup.−1 (mEos4b), 4.250±0.014×10.sup.−2 s.sup.−1 (mEos4b-V70T), 5.250±0.014×10.sup.−2 s.sup.−1 (Janus), and 16.21±0.08×10.sup.−2 s.sup.−1 (Ignis). Since the mutations that produced Janus and Ignis from mEos4b also substantially altered the pKa values of their green and red state chromophores, it was tested whether the solution pH might impact photoconversion kinetics. Since the green state pKa determines the fraction of fluorescent proteins in the neutral, photoconvertible state, it was assessed whether a more alkaline imaging buffer should reduce the rate of photoconversion observed for mEos4b-V70T, Janus, and Ignis, but have less impact on mEos4b since it is almost fully deprotonated at pH 7.4. Monophasic fits indicated rate constants of 2.656±0.015×10.sup.−2 s.sup.−1 (mEos4b), 2.712±0.011×10's.sup.−1 (mEos4b-V70T), 3.318±0.012×10's.sup.−1 (Janus), and 12.21±0.07×10's.sup.−1 (Ignis). Hence, photoconversion rates were reduced by 31% for mEos4b, 36% for mEos4b-V70T, 37% for Janus and 25% for Ignis pH 8.0 vs. 7.4 (
TABLE-US-00006 TABLE 6 Single Molecule Photoconversion Statistics Biphasic Exponential Association Model pH 7.4 pH 8.0 k.sub.1 (s.sup.−1) k.sub.2(s.sup.−1) % k.sub.1 k.sub.1 (s.sup.−1) k.sub.2(s.sup.−1) % k.sub.1 mEos4 0.1675 ± 0.0232 ± 24.23 ± 0.0801 ± 0.0135 ± 23.51 ± b 0.0023 0.0001 0.25 0.0028 0.0005 0.88 mEos4 0.1191± 0.0310 ± 22.65 ± 0.0928 ± 0.0194 ± 15.76 ± b- 0.0037 0.0004 0.92 0.0037 0.0003 0.79 V7OT Janus 0.0696 ± 0.0222 ± 74.05 ± 0.07359 ± 0.0286 ± 13.71 ± 0.0010 0.0016 1.91 0.0099 0.0009 4.05 Ignis 0.2315 ± 0.0381 ± 79.67 ± 0.1885 ± 0.0410 ± 71.83 ± 0.0008 0.0005 0.21 0.0016 0.0008 0.56 Monophasic Exponential Association Model pH 7.4 pH 8.0 k.sub.PC(s.sup.−1) Green OH Red O- k.sub.PC (s.sup.−1) Green OH Red O- mEos4 0.0387 ± 1.56 97.86 0.0266 ± 0.36 99.45 b 0.0002 0.0002 mEos4 0.0425 ± 39.23 73.36 0.0271 ± 13.95 91.64 b- 0.0001 0.0001 V7OT Janus 0.0547 ± 59.66 86.32 0.0332 ± 27.09 96.17 0.0001 0.0001 Ignis 0.1621 ± 93.94 82.71 0.1221 ± 79.55 95.01 0.0008 0.0007
[0178] Photon Yields of mEos4b Derivatives. The single-molecule photon yield of a PC-FP is a major determinant of its utility in PALM, since localization uncertainty is inversely proportional to the photons detected per molecule. Therefore, the single molecule photon yields of mEos4b, mEos4b-V70T, Janus and Ignis were analyzed under the same pH and laser illumination schemes described herein. The analysis was stratified into three categories: (1) photons per frame/localization; (2) photons per burst (for emissions spanning multiple consecutive frames); and (3) photons per molecule (the sum of the emissions per blinking molecule).
[0179] Histograms of the analyzed molecules along with the median and mean photon yields of each distribution to central tendency and skew of the data are summarized in Table 7. Generally, the order of photon yields was mEos4b>Janus>mEos4b-V70T>Ignis. The median (and mean) photon yield per mEos4b localization was 909.07 (mean: 1274.2) at pH 7.4, and slightly reduced to 762.71 (mean: 1131.2) in the presence of 405 nm light (
TABLE-US-00007 TABLE 7 Photon Yields Photons per Localization Photons per Burst Photons per Molecule pH 7.4 pH 8.0 pH 7.4 pH 8.0 pH 7.4 pH 8.0 (−405) (+ 405) (−405) (+ 405) (−405) (+ 405) (−405) (+ 405) (−405) (+ 405) (−405) (+ 405) mEos4b 909.07 762.71 977.53 667.74 1530.9 1183.2 1548.9 1076.9 7687.1 4769.4 6261 4181.3 (1274.2) (1131.2) (1352) (1075.4) (2442.5) (2625) (2533.7) (2518.8) (11037) (8405.2 (9929.1) (7435.6) mEos4b- 545.89 513.63 788.85 597.71 1089 804.33 1424.9 1053.5 2712.4 2660.5 3138.4 2582.7 V7OT (731.52) (686.72) (989.48) (806.2) (2139.9) (1864.1) (2553.3) (2238.4) (4600.1) (4062) (4757.8) (4294) Janus 753.67 621.51 762.9 727.9 1262.7 1231.3 1405.5 1501.1 2872.2 2929 3329.7 3020.9 (930.3) (826.25) (1077.5) (960.25) (2553.9) (2501.6) (2880.9) (2898.4) (4319) (4225.2) (4906.8) (4496.8) 402.72 413.48 501.09 476.66 579.22 595.25 803.77 762.46 1128.3 997.62 1374.1 1292.8 Ignis (528.27) (540.04) (657.31) (639.07) (1141.4) (1115.7) (1489.9) (1379.3) (1978.8) (1735.1) (2289.4) (2104.2)
[0180] mEos4b-V70T was consistently about 60% as bright as mEos4b on a per-frame basis, in agreement with the reportedly reduced photon yields in Dendra2 and mEos2-A69T vs. mEos2 and Dendra2-T69 Å (Berardozzi, R., Adam, V., Martins, A. & Bourgeois, D. Arginine 66 Controls Dark-State Formation in Green-to-Red Photoconvertible Fluorescent Proteins. J. Am. Chem. Soc. 138, 558-565 (2016)). However, when shifted into pH 8.0 buffer, the mean photon yield was increased by about 35% and the median by 31%. The median photon yield per burst at pH 7.4 was about 70% that of mEos4b (1089 photons), and the mean was nearly 88% of mEos4b at 2139.9 photons per burst. Excitingly, the photon yield per burst at pH 8.0 were close to mEos4b. Unfortunately, like mEos4b, mEos4b-V70T showed a noticeable loss in photon yields upon concurrent illumination with 405 nm light. Interestingly, the median photon yields were much more affected by 405 nm light at pH 8.0 than pH 7.4, as could be clearly seen in the shape the distribution of photons per localization.
[0181] Janus provided brighter single frame localizations than mEos4b-V70T at pH 7.4, with a median of 753.67 and a mean of 930.30 photons, while still being dimmer than mEos4b. Bursts were also brighter with a median 1262.7 and a mean 2553.9 photons, while molecular brightness was comparable to mEos4b-V70T. It is noted that these results are consistent with the slightly lower blinking probability of Janus vs. mEos4b-V70T and indicate that its similar molecular photon budget is delivered in a fewer number of brighter emission events. At pH 8.0, the median photon yields of Janus and mEos4b-V70T were similar at the level of localizations (762 vs. 788.85 photons) and bursts (1405.6 vs. 1424.9 photons), though the mean photon yields were modestly larger for Janus in each case (1077.50 vs. 989.48 and 2880.9 vs. 2553.3)—suggesting a greater skew toward bright localizations and bursts among Janus molecules.
[0182] One of the most remarkable findings of this study is that Janus retains its per burst and per molecule photon yields in the presence of 405 nm illumination, whereas both mEos4b and mEos4b-V70T exhibit substantial reductions in photon yields with 405 nm light. Although the numbers of photons per localization were modestly reduced, the per burst and per molecule photon yields were steady or even slightly increased upon 405 illumination. In fact, Janus molecules were, on average, as bright or brighter than mEos4b molecules at both pH 7.4 and 8.0 under concurrent illumination with 561 nm and 405 nm light.
[0183] Ignis is unambiguously dimmer than mEos4b, mEos4b-V70T and Janus. At pH 7.4 and pH 8.0, photon yields per localization were about half as large as mEos4b (localization means: 528.27 and 657.31, localization medians: 402.72 and 501.09). Photon yield per burst and per molecule were similarly about half that of mEos4b. Ignis was maximally bright at pH 8.0 with median brightness of 803 photons per molecule (median: 1489.9). Like Janus, the photon yields of Ignis were resilient to concurrent 405 nm laser illumination, despite be substantially lower overall.
[0184] Discussion. This work represents the first thorough single molecule characterization of mEos4b and its derivatives, and therefore provides an important reference point for applications that employ these probes in cellulo. This is important because, as a class, fixation-resistant PC-FPs stand to significantly improve ultrastructural analysis in applications such as correlative light and electron microscopy (CLEM) and tomography, where photophysical information may become important for proper experimental design and interpretation of ultrastructural information. Additionally, the photophysical analyses here provide insight into the residue-specific effects of substitutions that enhance photoconversion contrast and performance of each PC-FP in ensemble applications.
[0185] Blinking Propensity of mEos4b Derivatives. Blinking distributions rank Janus as the lowest-blinking PC-FP analyzed, offering 5-10% lower probability of blinking than mEos4b-V70T and ˜50% lower than mEos4b.
[0186] The low intrinsic photoblinking of Janus immediately suggests utility in single molecule counting experiments, since the degree of overcounting is inherently lower than many other PC-FPs (in fact, PA-mCherry is known to achieve a comparably low blinking rate under similar conditions (Baldering, T. N. et al. Synthetic and genetic dimers as quantification ruler for single-molecule counting with PALM. Mol. Biol. Cell mbcE18100661 (2019))). This contention is supported by the analyses of molecule count vs. T.sub.D for each protein, which found overcounting to be routinely lower for Janus than mEos4b or mEos4b-V70T, and similar to Ignis. These results further revealed that moderate intensity 405 nm light reduces photoblinking and the 95% dark time for each PC-FP. This has important consequences for quantitation, since the intensity of 405 nm light is gradually increased in most in cellulo PALM experiments in order to maintain a steady photoconversion/photoactivation rate (Betzig, E. et al. Imaging intracellular fluorescent proteins at nanometer resolution. Science 313, 1642-1645 (2006)); (Fricke, F., Beaudouin, J., Eils, R. & Heilemann, M. One, two or three? Probing the stoichiometry of membrane proteins by single-molecule localization microscopy. Sci. Rep. 5, 14072 (2015)); and (Lee, S.-H., Shin, J. Y., Lee, A. & Bustamante, C. Counting single photoactivatable fluorescent molecules by photoactivated localization microscopy (PALM). Proc. Natl. Acad. Sci. U.S.A. 109, 17436-17441 (2012)). If 405 nm light reduces photoblinking and dark time requirements, then one might expect that molecules activated later in a PALM experiment (where 405 nm intensity is higher) will blink less than molecules activated earlier in the imaging sequence and require less dark time for accurate spatio-temporal grouping.
[0187] An unexpected result of these experiments was that mEos4b-V70T required longer 95% dark time than Janus and Ignis in the absence of 405 nm light. This is surprising given its lower blinking propensity since the most well-characterized low-blinking PC-FP, Dendra2, requires short merging intervals (Lee, S.-H., Shin, J. Y., Lee, A. & Bustamante, C. Counting single photoactivatable fluorescent molecules by photoactivated localization microscopy (PALM). Proc. Natl. Acad. Sci. U.S.A. 109, 17436-17441 (2012)). However, this result is adequately explained by the low dark state recovery rate of mEos4b-V70T, k.sub.rm′ which resembles that of mEos4b. The 95% dark time result reveals a clear distinction between Met41-containing PC-FPs (mEos4b and mEos4b-V70T), and Ile41 PC-FPs (Janus and Ignis) when imaged independently under green (561 nm) laser light vs. concurrently with green and violet (405 nm) wavelengths.
[0188] Photokinetics of mEos4b Derivatives. Single molecule data were generally compatible with the simple kinetic model in
[0189] Off-time distributions were principally mono-exponential and did not support the contribution of two dark states with independent return rates (k.sub.r1 and k.sub.r2), in agreement with work from Avilov and colleagues on Dendra2 (Avilov, S. et al. In cellulo Evaluation of Phototransformation Quantum Yields in Fluorescent Proteins Used As Markers for Single-Molecule Localization Microscopy. PLoS ONE 9, (2014)). However, these results differ from at least three prior studies that examined dark state transitions in Kaede-like PC-FPs (Lee, S.-H., Shin, J. Y., Lee, A. & Bustamante, C. Counting single photoactivatable fluorescent molecules by photoactivated localization microscopy (PALM). Proc. Natl. Acad. Sci. U.S.A. 109, 17436-17441 (2012))(Annibale, P., Scarselli, M., Kodiyan, A. & Radenovic, A. Photoactivatable Fluorescent Protein mEos2 Displays Repeated Photoactivation after a Long-Lived Dark State in the Red Photoconverted Form. J. Phys. Chem. Lett. 1, 1506-1510 (2010)); and (Berardozzi, R., Adam, V., Martins, A. & Bourgeois, D. Arginine 66 Controls Dark-State Formation in Green-to-Red Photoconvertible Fluorescent Proteins. J. Am. Chem. Soc. 138, 558-565 (2016)). In these prior reports, PC-FP off-time distributions were fit to biphasic exponential decay models, indicating clear contributions of both fast and slow rates of return to the red fluorescent state. How may these discrepancies between studies be explained? First, it is possible that the red chromophores of mEos2 and mEos4b (or its derivatives) are photophysically distinct due to inherent variations in their chromophore environments.
[0190] However, given the otherwise similar behaviors of mEos2 and mEos4b—including blinking distributions characterized in this work and bulk fluorescence characteristics reported by others (Paez Segala, M. G. et al. Fixation-resistant photoactivatable fluorescent proteins for correlative light and electron microscopy. Nat. Methods 12, 215-218 (2015)); and (Turkowyd Bartosz et al. A General Mechanism of Photoconversion of Green-to-Red Fluorescent Proteins Based on Blue and Infrared Light Reduces Phototoxicity in Live-Cell Single-Molecule Imaging. Angew. Chem. Int. Ed. 56, 11634-11639 (2017))—this possibility seems relatively unsupported. Instead, the experimental design and instrumentation (particularly the illumination schemes and detection methods employed) are considered to be likely sources of variation between off time distributions. The present work utilized a 561 nm power density of ˜0.5 kW/cm.sup.2 and a 10 Hz frame rate (100 ms integration time). In contrast, the power densities in studies where mEos2 or Dendra2 showed biphasic off-time distributions varied between 0.25-4 kW/cm.sup.2 (most>1 kW/cm.sup.2), and were recorded at 33.3-20 Hz (30-50 ms integration times). Available evidence indicates that the short time constant of mEos2 (1/k.sub.r1) is inversely related to 561 nm laser intensity (though less is known about the impact of 561 nm intensity on the slow return rate) (Annibale, P., Scarselli, M., Kodiyan, A. & Radenovic, A. Photoactivatable Fluorescent Protein mEos2 Displays Repeated Photoactivation after a Long-Lived Dark State in the Red Photoconverted Form. J. Phys. Chem. Lett. 1, 1506-1510 (2010)). Speculatively, the lower 561 nm laser intensity and slower frame rates described herein might not adequately resolve k.sub.r1 from the slow state, k.sub.r2. However, Avilov et al. utilized an even shorter integration time of 30 ms and still observed mono-exponential behavior, though they employed substantially higher 561 nm intensities (5-7 kW/cm.sup.2) (Avilov, S. et al. In cellulo Evaluation of Phototransformation Quantum Yields in Fluorescent Proteins Used As Markers for Single-Molecule Localization Microscopy. PLoS ONE 9, (2014)). Although short dark states might ostensibly become vanishingly short under such intense excitation, the source of this discrepancy is unclear and requires further study of photokinetics under a variety of frame rates and illumination schemes. Nonetheless, despite the lack of a fast dark state recovery component (k.sub.r1) in the data, the mono-exponential recovery rates are remarkably similar to the slow k.sub.r2 values reported by others (between 0.4 and 1.6 for mEos2 and Dendra2, respectively) (Lee, S.-H., Shin, J. Y., Lee, A. & Bustamante, C. Counting single photoactivatable fluorescent molecules by photoactivated localization microscopy (PALM). Proc. Natl. Acad. Sci. U.S.A. 109, 17436-17441 (2012)); and (Berardozzi, R., Adam, V., Martins, A. & Bourgeois, D. Arginine 66 Controls Dark-State Formation in Green-to-Red Photoconvertible Fluorescent Proteins. J. Am. Chem. Soc. 138, 558-565 (2016)). By comparison, the k.sub.rm values were between 0.567 and 2.22 s.sup.−1. Ultimately, although the short-lived dark state and fast recovery rate are of biophysical interest, the long-lived dark state and slow recovery rate described by k.sub.r2 or k.sub.rm is most relevant to the analysis of PALM data as it influences the selection of an appropriate M.
[0191] Photoconversion Rates. The examination of PC-FP photoconversion with PALM provides a highly controlled, direct measurement of molecular photoconversion rate independent of molecular brightness and photobleaching effects. The results point to two principle conclusions: First, the overall order of photoconversion rates was Ignis>Janus>mEos4b-V70T>mEos4b. Although the data were generally well-described by single exponential association models (R.sup.2>0.96), it was clear that single rate constants under-estimated the initial photoconversion rate in several experiments. This led to the observation that, when explained as the result of fast and slow rate constants, mEos4b and mEos4b-V70T photoconversion is mostly attributed to a slower rate constant, whereas a fast photoconversion rate dominates for both Janus and Ignis. The second principle conclusion is that unlike in ensemble photoconversion experiments, the molecular photoconversion rate of each PC-FP tracks more closely with green chromophore pKa (though not proportionally). This is further substantiated by the observation that single molecule photoconversion rates were decreased at pH 8.0 vs. pH 7.4. It is interesting to note that despite the increased photoconversion rate of mEos4b-V70T relative to mEos4b, it still does not exhibit greater photoconversion contrast in cells. This stands in contrast to Dendra2, which has a similar green pKa (Fron, E. et al. Revealing the Excited-State Dynamics of the Fluorescent Protein Dendra2. J. Phys. Chem. B 117, 2300-2313 (2013)); and (Adam, V., Nienhaus, K., Bourgeois, D. & Nienhaus, G. U. Structural basis of enhanced photoconversion yield in green fluorescent protein-like protein Dendra2. Biochemistry 48, 4905-4915 (2009)). Overall this challenges the assumption that green pKa and photoconversion rate are principle determinants of photoconversion contrast, supporting involvement of other factors.
[0192] Photon Statistics. mEos4b has the largest per-molecule photon budget of PC-FPs examined herein. However, this can be misleading in the context of PALM, as the per-frame photon count is the principle determinant of localization precision and most of the photons generated per mEos4b molecule originate from blinking events after initial emissions. An ideal PALM probe for quantitative localization microscopy would deliver a high photon budget per localization, and blink infrequently. With this in mind, it is noted that Ignis is likely a poor PALM probe despite its low blinking rate due to its low brightness per frame and apparently high sensitivity to photobleaching. If the model of Berardozzi et al. is correct, and photobleaching pathways compete with photoblinking pathways (Berardozzi, R., Adam, V., Martins, A. & Bourgeois, D. Arginine 66 Controls Dark-State Formation in Green-to-Red Photoconvertible Fluorescent Proteins. J. Am. Chem. Soc. 138, 558-565 (2016)), then a sufficiently high photobleaching rate will fundamentally limit photon yield of PC-FPs. This may explain the low brightness of Ignis relative to the other PC-FPs tested.
[0193] In contrast to Ignis, Janus offers a low-blinking and bright PC-FP with several attractive trends in its photon statistics. Most notably, Janus maintains overall high photon yields per localization and per burst at pH 7.4 (in contrast to mEos4b-V70T), and nearly matches the photon yields of mEos4b when imaged at pH 8.0. Janus and mEos4b-V70T were similarly brightened at pH 8.0—presumably the result of a shift toward greater occupation of the anionic chromophore state. More importantly, Janus does not produce substantially fewer photons in response to moderate intensity 405 nm illumination at pH 8.0, unlike both mEos4b-V70T and mEos4b. In fact, at pH 8.0, Janus was the overall brightest PC-FP in the presence of 405 nm light, despite having the lowest blinking probability. This strongly supports the use of Janus as a PALM probe at pH 8.0, as blinking is minimized by continuous 405 nm illumination while photon yield and localization precision are both improved.
[0194] The Influence of Residues 70, 41, and 197 on mEos4b Photophysics. These single molecule data provide a strong means for understanding the roles of three residues in photophysical behaviors of mEos4b derivatives. Compared to mEos4b, the successive incorporation of V70T, M41I, and I197M substantially altered blinking, on/off state kinetics, photoconversion kinetics and photon statistics of each PC-FP examined. Consistent with the results of Berardozzi et al., the results described herein indicate that Thr70 shifts the dominant dark state transition pathway from photoblinking (k.sub.d) and toward photobleaching (k.sub.b) while simultaneously increasing the rate of 405-mediated photoconversion (k.sub.PC). The effect on photoconversion rate is likely the result of an increased green pKa and larger fraction of neutral chromophore. Consistently, the photoconversion rate of mEos4b-V70T was substantially reduced at pH 8.0 vs. pH 7.4 (
[0195] Unlike the effects of Thr70, the impact(s) of Met41Ile and Ile197Met in Janus and Ignis are more nuanced at the single molecule level. The clearest result of the M41I substitution is an increased dark state recovery rate in the absence of 405 nm light. This is distinct from V70T, which appears to principally limit entry to the dark state (and therefore photo-blinking). Instead, M41I appears to antagonize occupation of the dark state. This effect can be clearly seen in the off-time distributions and 1.6-2.4× larger dark state recovery rates (k.sub.rm) of Janus vs. mEos4b-V70T (
[0196] First, examination of the k.sub.on fits indicate trends suggestive of independent effects of 561 nm and 405 nm irradiation on the photokinetics of mEos4b derivatives, and these appear to relate neatly to single-residue substitutions. In the absence of 405 nm light, trends in k.sub.on are mainly the result of 561 nm light mediated photobleaching and dark state transitions (though residual photodamage from 405 nm pre-illumination should be considered, according to Scheme 1 in
[0197] Secondly, the single molecule results should also be considered alongside the in cellulo widefield and confocal photoconversion experiments described herein. Based on its enhanced photoconversion rate and presence of Thr70, it is expected that mEos4b-V70T will perform similarly to Dendra2. Indeed, the protein exhibits several photochemical similarities to Dendra2, including its absorbance spectrum, a hypsochromic shift in its excitation and emission spectra relative to mEos4b, and a low blinking rate. Nonetheless, mEos4b-V70T demonstrates poor photoconversion contrast much like its parent molecule, mEos4b. This is likely due to the presence of Met41 in mEos4b-V70T, because the analogous residue in Dendra2 is not a methionine, but rather alanine (Ala45, see
[0198] Third, the presence or absence of chromophore-proximal methionine residues may have consequences compatible with the observations disclosed herein. The data permit two points of comparison, as methionine residues were removed and introduced on opposite sides of the mEos4b chromophore (Met41Ile in Janus, and Ile197Met in Ignis). Met41Ile “unlocked” greater photoconversion contrast in Janus vs. mEos4b-V70T, whereas addition of Met197 to generate Ignis from Janus resulted in a dimmer protein with 1.4-1.7× greater k.sub.b, indicative of rapid photobleaching. Although at first these results seem unrelated, they may be different manifestations of similar phenomena involving oxidative modification of methionine residues (Met41 in mEos4b and mEos4b-V70T, and Met197 in Ignis). Studies by Duan and coworkers of the EosFP derivative, IrisFP, suggest that sulfur-containing residues (methionine, cysteine) contribute to photobleaching of the chromophore through oxidative modifications at low illumination intensities≤10 W/cm.sup.2 (commonly used for ensemble excitation and also PALM photoconversion) (Duan, C. et al. Structural Evidence for a Two-Regime Photobleaching Mechanism in a Reversibly Switchable Fluorescent Protein. J. Am. Chem. Soc. 135, 15841-15850 (2013)); and (Duan, C. et al. Rational design of enhanced photoresistance in a photoswitchable fluorescent protein. Methods Appl. Fluoresc. 3, 014004 (2015)). In IrisFP, the side chains of Met159 and Cys171 are photo-oxidized to sulfoxides, and this provokes several conformational changes in the chromophore pocket that ultimately lock the chromophore in a non-fluorescent, neutral state with characteristic absorbance peak at 385 nm (Duan, C. et al. Structural Evidence for a Two-Regime Photobleaching Mechanism in a Reversibly Switchable Fluorescent Protein. J. Am. Chem. Soc. 135, 15841-15850 (2013)). Notably, photobleaching of IrisFP was performed with 405 nm and 488 nm lasers, and green-to-red photoconversion was evident in the crystal structures as negative electron density between Phe61 and His62 (Reference 242, their
[0199] In summary the single molecule examination of mEos4b derivatives revealed surprising characteristics of high contrast PC-FPs, Janus and Ignis, which may be attributed to reciprocal methionine-isoleucine substitutions at positions 41 and 197 of mEos4b. Among the PC-FPs tested, these data support the use of Janus as a PALM probe due to its robust photon yields (even in the presence of 405 nm light), rapid photoconversion rate, low photoblinking propensity, and rapid dark state recovery rate.