ANTI-ILT3 ANTIBODIES AND ANTIBODY DRUG CONJUGATES
20220227863 · 2022-07-21
Inventors
- Jaime Rene Darce (Arlington, MA, US)
- Scott Michael Lonning (Westford, MA, US)
- Nels Eric Pederson (Mansfield, MA, US)
- Klarisa Rikova (Reading, MA, US)
- Aleksandr Tkachev (Cambridge, MA, US)
Cpc classification
C07K2317/33
CHEMISTRY; METALLURGY
A61K2039/507
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
A61K47/6849
HUMAN NECESSITIES
C07K2317/92
CHEMISTRY; METALLURGY
A61K47/6825
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61K47/68
HUMAN NECESSITIES
Abstract
Disclosed herein are anti-immunoglobulin-like transcript-3 (ILT3) antibodies and antibody drug conjugates (ADCs), including compositions and methods of using said antibodies and ADCs.
Claims
1.-195. (canceled)
196. An isolated antibody, or antigen binding portion thereof, that binds to immunoglobulin-like transcript 3 (ILT3), wherein the antibody, or antigen binding portion thereof, comprises: a heavy chain variable region comprising an amino acid sequence that is at least 95% identical to SEQ ID NO: 81 and a light chain variable region comprising an amino acid sequence that is at least 95% identical to SEQ ID NO: 84; a heavy chain variable region comprising an amino acid sequence that is at least 95% identical to SEQ ID NO: 1 and a light chain variable region comprising an amino acid sequence that is at least 95% identical to SEQ ID NO: 5; a heavy chain variable region comprising an amino acid sequence that is at least 95% identical to SEQ ID NO: 53 and a light chain variable region comprising an amino acid sequence that is at least 95% identical to SEQ ID NO: 57; a heavy chain variable region comprising an amino acid sequence that is at least 95% identical to SEQ ID NO: 74 and a light chain variable region comprising an amino acid sequence that is at least 95% identical to SEQ ID NO: 78; or a heavy chain variable region comprising an amino acid sequence that is at least 95% identical to SEQ ID NO: 104 and a light chain variable region comprising an amino acid sequence that is at least 95% identical to SEQ ID NO: 100.
197. The isolated antibody, or antigen binding portion thereof, of claim 196, wherein the antibody, or antigen binding portion thereof, comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 48, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 83, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 82, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 52, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 73, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 50; the antibody, or antigen binding portion thereof, comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 4, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 3, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 2, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 8, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 7, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 6; the antibody, or antigen binding portion thereof, comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 56, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 55, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 54, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 60, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 59, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 58; the antibody, or antigen binding portion thereof, comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 77, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 76, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 75, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 60, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 73, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 50; or the antibody, or antigen binding portion thereof, comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 106, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 105, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 62, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 60, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 73, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 50.
198. An isolated nucleic acid encoding the antibody, or antigen binding portion thereof, of claim 196.
199. A pharmaceutical composition comprising the antibody, or antigen binding portion thereof, of claim 196, and a pharmaceutically acceptable carrier.
200. An antibody, or antigen binding portion thereof, of claim 196, conjugated to at least one drug.
201. The antibody, or antigen binding portion thereof, of claim 200, wherein the at least one drug is selected from the group consisting of an anti-apoptotic agent, a mitotic inhibitor, an anti-tumor antibiotic, an immunomodulating agent, a nucleic acid for gene therapy, an anti-angiogenic agent, an anti-metabolite, a boron-containing agent, a chemoprotective agent, a hormone agent, an anti-hormone agent, a corticosteroid, a photoactive therapeutic agent, an oligonucleotide, a radionuclide agent, a radiosensitizer, a topoisomerase inhibitor, and a tyrosine kinase inhibitor.
202. The antibody, or antigen binding portion thereof, of claim 200, wherein the at least one drug is conjugated to the antibody, or antigen-binding portion thereof, via a linker.
203. The antibody, or antigen binding portion thereof, of claim 200, wherein the antibody, or antigen binding portion thereof, is an IgG1 or IgG4 isotype.
204. A method for treating cancer, comprising administering a therapeutically effective amount of the antibody, or antigen binding portion thereof, of claim 196 to a subject in need thereof.
205. The method of claim 204, wherein the cancer is triple negative breast cancer (TNBC), acute myeloid leukemia, prostate cancer, breast cancer, lung cancer, colon cancer, colorectal cancer, melanomas, bladder cancer, brain/CNS cancer, cervical cancer, esophageal cancer, gastric cancer, head and neck cancer, kidney cancer, liver cancer, lymphomas, ovarian cancer, pancreatic cancer, or sarcomas.
206. The method of claim 204, wherein the antibody, or antigen binding portion thereof, is administered in combination with an immune checkpoint inhibitor.
207. A method for inhibiting or decreasing solid tumor growth in a subject having a solid tumor, said method comprising administering an effective amount of the antibody or antigen binding portion thereof of claim 196, to the subject having the solid tumor, such that the solid tumor growth is inhibited or decreased.
208. The method of claim 207, wherein the antibody or antigen binding portion thereof is administered in combination with an additional agent or an additional therapy.
209. The method of claim 208, wherein the additional agent is an immune checkpoint inhibitor.
210. A method for upregulating an immune response in a subject, comprising administering a therapeutically effective amount of the antibody or antigen binding portion thereof of claim 196 to the subject, thereby upregulating the immune response in the subject.
211. The method of claim 210, wherein the antibody, or antigen binding portion thereof, is administered in combination with an additional agent or an additional therapy.
212. The method of claim 211, wherein the additional agent is an immune checkpoint inhibitor.
213. The method of claim 210, wherein the subject has cancer.
214. A method for increasing T cell activation in a subject, comprising administering a therapeutically effective amount of the antibody, or antigen binding portion thereof, of claim 196 to the subject, thereby increasing T cell activation in the subject.
215. The method of claim 214, wherein the antibody, or antigen binding portion thereof, is administered in combination with an additional agent or an additional therapy.
216. The method of claim 215, wherein the additional agent is an immune checkpoint inhibitor.
217. The method of claim 214, wherein the subject has cancer.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0180]
[0181]
[0182]
[0183]
[0184]
[0185]
DETAILED DESCRIPTION
[0186] Various aspects of the disclosure relate to anti-ILT3 antibodies and antibody fragments, anti-ILT3 ADCs, and pharmaceutical compositions thereof, as well as nucleic acids, recombinant expression vectors and host cells for making such antibodies and fragments. Methods of using the antibodies and ADCs described herein to detect human ILT3, to bind to and inhibit human ILT3 on ILT3 expressing cells, including APCs, e.g., monocytes, dendritic cells (DCs) or macrophages (in vitro or in vivo), to upmodulate an immune response in vivo, increase T cell activation, and/or to treat ILT3-associated disorders, e.g., cancer, including, but not limited to, triple negative breast cancer (TNBC) or acute myeloid leukemia (AML). In one embodiment, the anti-ILT3 antibodies or ADCs of the invention are administered in combination with one or more immune checkpoint inhibitors (e.g., antibody or small molecule immune checkpoint inhibitors) for the treatment of a cancer, for example one or more of an anti-PD-1, anti-PD-L1, anti-CD38 antibody, or anti-CTLA4 antibody. In another embodiment of the invention, anti-ILT3 antibody drug conjugates (ADCs) of the invention (e.g., the ILT3 antibodies of the invention conjugated to a toxin) are internalized and induce cell death of cells endogenously expressing ILT3.
I. Definitions
[0187] In order that the invention may be more readily understood, certain terms are first defined. In addition, it should be noted that whenever a value or range of values of a parameter are recited, it is intended that values and ranges intermediate to the recited values are also intended to be part of this invention.
[0188] The terms “immunogobulin-like transcript 3 antibody” or “anti-ILT3 antibody”, used interchangeably herein, refer to an antibody that specifically binds to ILT3, e.g., human ILT3. An antibody “which binds” an antigen of interest, i.e., ILT3, is one capable of binding that antigen with sufficient affinity such that the antibody is useful in targeting a cell expressing the antigen. In a preferred embodiment, the antibody specifically binds to human ILT3 (hILT3). Examples of anti-ILT3 antibodies are disclosed in Example 2, below. Unless otherwise indicated, the term “anti-ILT3 antibody” is meant to refer to an antibody which binds to wild type ILT3, a variant, or an isoform of ILT3.
[0189] Three different invention of ILT3 produced by alternative splicing have been identified. An exemplary amino acid sequence of wild type human ILT3, which contains 448 amino acids, is provided below as SEQ ID NO: 149 (GenBank Accession No. AAH26309.1), where the signal peptide (amino acid residues 1-21) are underlined. The mature form of wild type ILT3 corresponds to the protein without the signal peptide, i.e., amino acid residues 22 to 448 of SEQ ID NO: 149.
TABLE-US-00001 1 miptftallc lglslgprtd mqagplpkpt lwaepgsvis wgnsvtiwcq gtleareyrl 61 dkeespapwd rqnplepknk arfsipsmte dyagryrcyy rspvgwsqps dplelvmtga 121 yskptlsalp splvtsgksv tllcqsrspm dtfllikera ahpllhlrse hgaqqhqaef 181 pmspvtsvhg gtyrcfsshg fshyllshps dplelivsgs legprpsptr svstaagped 241 qplmptgsvp hsglrrhwev ligvlvvsil llslllflll qhwrqgkhrt laqrqadfqr 301 ppgaaepepk dgglqrrssp aadvqgenfc aavkntqped gvemdtrqsp hdedpqavty 361 akvkhsrprr emasppspls gefldtkdrq aeedrqmdte aaaseapqdv tyarlhsftl 421 rqkateppps qegaspaeps vyatlaih
[0190] ILT3 is a member of the leukocyte immunoglublin-like receptor (LIR) family and belongs to the subfamily B class of LIR receptors. The protein contains two extracellular immunoglobulin-like domains at amino acid residues 27-118 and 130-198, a transmembrane domain at amino acid residues 260-280, and three cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs) at amino acid residues 358-363, 410-415, and 440-445, which are involved in immune regulation.
[0191] The terms “specific binding” or “specifically binding”, as used herein, in reference to the interaction of an ILT3 antibody or an ADC with a second chemical species, mean that the interaction is dependent upon the presence of a particular structure (e.g., an antigenic determinant or epitope) on the chemical species; for example, an antibody recognizes and binds to a specific protein structure rather than to proteins generally. If an antibody or ADC is specific for epitope “A”, the presence of a molecule containing epitope A (or free, unlabeled A), in a reaction containing labeled “A” and the antibody, will reduce the amount of labeled A bound to the antibody or ADC.
[0192] In one embodiment, the phrase “specifically binds to hILT3” or “specific binding to hILT3”, as used herein, refers to the ability of an anti-ILT3 antibody or ADC to interact with ILT3 (human or cynomolgus monkey ILT3) with a dissociation constant (K.sub.D) of about 2,000 nM or less, about 1,000 nM or less, about 500 nM or less, about 200 nM or less, about 100 nM or less, about 75 nM or less, about 25 nM or less, about 21 nM or less, about 12 nM or less, about 11 nM or less, about 10 nM or less, about 9 nM or less, about 8 nM or less, about 7 nM or less, about 6 nM or less, about 5 nM or less, about 4 nM or less, about 3 nM or less, about 2 nM or less, about 1 nM or less, about 0.5 nM or less, about 0.3 nM or less, about 0.1 nM or less, about 0.01 nM or less, or about 0.001 nM or less. In another embodiment, the phrase “specifically binds to hILT3” or “specific binding to hILT3”, as used herein, refers to the ability of an anti-ILT3 antibody or ADC to interact with hILT3 with a dissociation constant (K.sub.D) of between about 1 pM (0.001 nM) to 2,000 nM, between about 500 pM (0.5 nM) to 1,000 nM, between about 500 pM (0.5 nM) to 500 nM, between about 1 nM) to 200 nM, between about 1 nM to 100 nM, between about 1 nM to 50 nM, between about 1 nM to 20 nM, or between about 1 nM to 5 nM. In one embodiment, K.sub.D is determined by surface plasmon resonance. In another embodiment, K.sub.D is determined as described in Example 2, below.
[0193] The term “antibody” broadly refers to an immunoglobulin (Ig) molecule, generally comprised of four polypeptide chains, two heavy (H) chains and two light (L) chains, or any functional fragment, mutant, variant, or derivative thereof, that retains the essential target binding features of an Ig molecule. Such mutant, variant, or derivative antibody formats are known in the art. Non-limiting embodiments of which are discussed below.
[0194] In a full-length antibody, each heavy chain is comprised of a heavy chain variable region (abbreviated herein as HCVR or VH) and a heavy chain constant region. The heavy chain constant region is comprised of three domains, CH1, CH2 and CH3. Each light chain is comprised of a light chain variable region (abbreviated herein as LCVR or VL) and a light chain constant region. The light chain constant region is comprised of one domain, CL. The VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. Immunoglobulin molecules can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY) and class (e.g., IgG1, IgG2, IgG 3, IgG4, IgA1 and IgA2) or subclass.
[0195] The term “antigen binding portion” of an antibody (or simply “antibody portion”), as used herein, refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., hIL-13). It has been shown that the antigen binding function of an antibody can be performed by fragments of a full-length antibody. Such antibody embodiments may also be bispecific, dual specific, or multi-specific formats; specifically binding to two or more different antigens. Examples of binding fragments encompassed within the term “antigen binding portion” of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab′).sub.2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546, Winter et al., PCT publication WO 90/05144 A1 herein incorporated by reference), which comprises a single variable domain; and (vi) an isolated complementarity determining region (CDR). Furthermore, although the two domains of the Fv fragment, VL and VH, are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883). Such single chain antibodies are also intended to be encompassed within the term “antigen binding portion” of an antibody. In certain embodiments, scFv molecules may be incorporated into a fusion protein. Other forms of single chain antibodies, such as diabodies are also encompassed. Diabodies are bivalent, bispecific antibodies in which VH and VL domains are expressed on a single polypeptide chain, but using a linker that is too short to allow for pairing between the two domains on the same chain, thereby forcing the domains to pair with complementary domains of another chain and creating two antigen binding sites (see e.g., Holliger, P., et al. (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448; Poljak, R. J., et al. (1994) Structure 2:1121-1123). Such antibody binding portions are known in the art (Kontermann and Dubel eds., Antibody Engineering (2001) Springer-Verlag. New York. 790 pp. (ISBN 3-540-41354-5).
[0196] The term “antibody construct” as used herein refers to a polypeptide comprising one or more the antigen binding portions disclosed herein linked to a linker polypeptide or an immunoglobulin constant domain. Linker polypeptides comprise two or more amino acid residues joined by peptide bonds and are used to link one or more antigen binding portions. Such linker polypeptides are well known in the art (see e.g., Holliger, P., et al. (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448; Poljak, R. J., et al. (1994) Structure 2:1121-1123). An immunoglobulin constant domain refers to a heavy or light chain constant domain. Antibody portions, such as Fab and F(ab′).sub.2 fragments, can be prepared from whole antibodies using conventional techniques, such as papain or pepsin digestion, respectively, of whole antibodies. Moreover, antibodies, antibody portions and immunoadhesion molecules can be obtained using standard recombinant DNA techniques, as described herein.
[0197] An “isolated antibody”, as used herein, is intended to refer to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds ILT3 is substantially free of antibodies that specifically bind antigens other than ILT3). An isolated antibody that specifically binds ILT3 may, however, have cross-reactivity to other antigens, such as ILT3 molecules from other species. Moreover, an isolated antibody may be substantially free of other cellular material and/or chemicals.
[0198] The term “humanized antibody” refers to antibodies which comprise heavy and light chain variable region sequences from a nonhuman species (e.g., a mouse) but in which at least a portion of the VH and/or VL sequence has been altered to be more “human-like”, i.e., more similar to human germline variable sequences. In particular, the term “humanized antibody” is an antibody or a variant, derivative, analog or fragment thereof which immunospecifically binds to an antigen of interest and which comprises a framework (FR) region having substantially the amino acid sequence of a human antibody and a complementary determining region (CDR) having substantially the amino acid sequence of a non-human antibody. As used herein, the term “substantially” in the context of a CDR refers to a CDR having an amino acid sequence at least 80%, preferably at least 85%, at least 90%, at least 95%, at least 98% or at least 99% identical to the amino acid sequence of a non-human antibody CDR. A humanized antibody comprises substantially all of at least one, and typically two, variable domains (Fab, Fab′, F(ab′).sub.2, FabC, Fv) in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin (i.e., donor antibody) and all or substantially all of the framework regions are those of a human immunoglobulin consensus sequence. Preferably, a humanized antibody also comprises at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. In some embodiments, a humanized antibody contains both the light chain as well as at least the variable domain of a heavy chain. The antibody also may include the CH1, hinge, CH2, CH3, and CH4 regions of the heavy chain. In some embodiments, a humanized antibody only contains a humanized light chain. In other embodiments, a humanized antibody only contains a humanized heavy chain. In specific embodiments, a humanized antibody only contains a humanized variable domain of a light chain and/or humanized heavy chain.
[0199] The humanized antibody can be selected from any class of immunoglobulins, including IgM, IgG, IgD, IgA and IgE, and any isotype, including without limitation IgG1, IgG2, IgG3 and IgG4. The humanized antibody may comprise sequences from more than one class or isotype, and particular constant domains may be selected to optimize desired effector functions using techniques well-known in the art.
[0200] The terms “Kabat numbering,” “Kabat definitions,” and “Kabat labeling” are used interchangeably herein. These terms, which are recognized in the art, refer to a system of numbering amino acid residues which are more variable (i.e., hypervariable) than other amino acid residues in the heavy and light chain variable regions of an antibody, or an antigen binding portion thereof (Kabat et al. (1971) Ann. NY Acad, Sci. 190:382-391 and, Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242). For the heavy chain variable region, the hypervariable region ranges from amino acid positions 31 to 35 for CDR1, amino acid positions 50 to 65 for CDR2, and amino acid positions 95 to 102 for CDR3. For the light chain variable region, the hypervariable region ranges from amino acid positions 24 to 34 for CDR1, amino acid positions 50 to 56 for CDR2, and amino acid positions 89 to 97 for CDR3.
[0201] As used herein, the term “CDR” refers to the complementarity determining region within antibody variable sequences. There are three CDRs in each of the variable regions of the heavy chain (HC) and the light chain (LC), which are designated CDR1, CDR2 and CDR3 (or specifically HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and LC CDR3), for each of the variable regions. The term “CDR set” as used herein refers to a group of three CDRs that occur in a single variable region capable of binding the antigen. The exact boundaries of these CDRs have been defined differently according to different systems. The system described by Kabat (Kabat et al., Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987) and (1991)) not only provides an unambiguous residue numbering system applicable to any variable region of an antibody, but also provides precise residue boundaries defining the three CDRs. These CDRs may be referred to as Kabat CDRs. Chothia and coworkers (Chothia &Lesk, J. Mol. Biol. 196:901-917 (1987) and Chothia et al., Nature 342:877-883 (1989)) found that certain sub-portions within Kabat CDRs adopt nearly identical peptide backbone conformations, despite having great diversity at the level of amino acid sequence. These sub-portions were designated as L1, L2 and L3 or H1, H2 and H3 where the “L” and the “H” designates the light chain and the heavy chains regions, respectively. These regions may be referred to as Chothia CDRs, which have boundaries that overlap with Kabat CDRs. Other boundaries defining CDRs overlapping with the Kabat CDRs have been described by Padlan (FASEB J. 9:133-139 (1995)) and MacCallum (J Mol Biol 262(5):732-45 (1996)). Still other CDR boundary definitions may not strictly follow one of the above systems, but will nonetheless overlap with the Kabat CDRs, although they may be shortened or lengthened in light of prediction or experimental findings that particular residues or groups of residues or even entire CDRs do not significantly impact antigen binding. The methods used herein may utilize CDRs defined according to any of these systems, although preferred embodiments use Kabat or Chothia defined CDRs.
[0202] As used herein, the term “framework” or “framework sequence” refers to the remaining sequences of a variable region minus the CDRs. Because the exact definition of a CDR sequence can be determined by different systems, the meaning of a framework sequence is subject to correspondingly different interpretations. The six CDRs (CDR-L1, CDR-L2, and CDR-L3 of light chain and CDR-H1, CDR-H2, and CDR-H3 of heavy chain) also divide the framework regions on the light chain and the heavy chain into four sub-regions (FR1, FR2, FR3 and FR4) on each chain, in which CDR1 is positioned between FR1 and FR2, CDR2 between FR2 and FR3, and CDR3 between FR3 and FR4. Without specifying the particular sub-regions as FR1, FR2, FR3 or FR4, a framework region, as referred by others, represents the combined FR's within the variable region of a single, naturally occurring immunoglobulin chain. As used herein, a FR represents one of the four sub-regions, and FRs represents two or more of the four sub-regions constituting a framework region.
[0203] The framework and CDR regions of a humanized antibody need not correspond precisely to the parental sequences, e.g., the donor antibody CDR or the consensus framework may be mutagenized by substitution, insertion and/or deletion of at least one amino acid residue so that the CDR or framework residue at that site does not correspond to either the donor antibody or the consensus framework. In a preferred embodiment, such mutations, however, will not be extensive. Usually, at least 80%, preferably at least 85%, more preferably at least 90%, and most preferably at least 95% of the humanized antibody residues will correspond to those of the parental FR and CDR sequences. As used herein, the term “consensus framework” refers to the framework region in the consensus immunoglobulin sequence. As used herein, the term “consensus immunoglobulin sequence” refers to the sequence formed from the most frequently occurring amino acids (or nucleotides) in a family of related immunoglobulin sequences (See e.g., Winnaker, From Genes to Clones (Verlagsgesellschaft, Weinheim, Germany 1987). In a family of immunoglobulins, each position in the consensus sequence is occupied by the amino acid occurring most frequently at that position in the family. If two amino acids occur equally frequently, either can be included in the consensus sequence.
[0204] “Percent (%) amino acid sequence identity” with respect to a peptide or polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the specific peptide or polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. In one embodiment, the disclosure includes an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to an amino acid sequence set forth in any one of SEQ ID NOs: 1 to 110.
[0205] The term “multivalent antibody” is used herein to denote an antibody comprising two or more antigen binding sites. In certain embodiments, the multivalent antibody may be engineered to have the three or more antigen binding sites, and is generally not a naturally occurring antibody.
[0206] The term “multispecific antibody” refers to an antibody capable of binding two or more unrelated antigens.
[0207] The term “dual variable domain” or “DVD,” as used interchangeably herein, are antigen binding proteins that comprise two or more antigen binding sites and are tetravalent or multivalent binding proteins. Such DVDs may be monospecific, i.e., capable of binding one antigen or multispecific, i.e. capable of binding two or more antigens. DVD binding proteins comprising two heavy chain DVD polypeptides and two light chain DVD polypeptides are referred to a DVD Ig. Each half of a DVD Ig comprises a heavy chain DVD polypeptide, and a light chain DVD polypeptide, and two antigen binding sites. Each binding site comprises a heavy chain variable domain and a light chain variable domain with a total of 6 CDRs involved in antigen binding per antigen binding site. In one embodiment, the CDRs described herein are used in an anti-ILT3 DVD.
[0208] The term “activity” includes activities such as the binding specificity/affinity of an antibody or ADC for an antigen, for example, an anti-hILT3 antibody that binds to an ILT3 antigen. In one embodiment, an anti-ILT3 antibody or anti-ILT3 ADC activity includes, but it not limited to, binding to ILT3 in vitro; binding to ILT3 on cells expressing ILT3 in vivo (such as, for example, APCs including dentritic cells (DCs), monocytes, and macrophages, B-cells, and natural killer (NK) cells, as well as tumor infiltrating immune cells such as myeloid cells); upmodulating immune response in vivo; increasing T cell activation in vivo; increasing CD8+ T cell expansion and effector functions that would result in anti-tumor response; inducing cell death in cells expressing ILT3, including myeloid derived suppressor cells (MDSCs); inhibiting cancer cell invasion and metastasis; decreasing or inhibiting cancer, e.g., triple negative breast cancer (TNBC) and acute myeloid leukemia (AML); and decreasing or inhibiting tumor cellular proliferation or tumor growth in vivo. In some embodiments, the tumor can be an ILT3 negative tumor or an ILT3 positive tumor. In one embodiment, an anti-ILT3 antibody is capable of being internalized into a cell expressing ILT3.
[0209] The term “epitope” refers to a region of an antigen that is bound by an antibody, antibody fragment, or ADC. In certain embodiments, epitope determinants include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl, or sulfonyl, and, in certain embodiments, may have specific three dimensional structural characteristics, and/or specific charge characteristics. In certain embodiments, an antibody is said to specifically bind an antigen when it preferentially recognizes its target antigen in a complex mixture of proteins and/or macromolecules.
[0210] The term “surface plasmon resonance”, as used herein, refers to an optical phenomenon that allows for the analysis of real-time biospecific interactions by detection of alterations in protein concentrations within a biosensor matrix, for example using the BIAcore system (Pharmacia Biosensor AB, Uppsala, Sweden and Piscataway, N.J.). For further descriptions, see Jonsson, U., et al. (1993) Ann. Biol. Clin. 51:19-26; Jönsson, U., et al. (1991) Biotechniques 11:620-627; Johnsson, B., et al. (1995) J. Mol. Recognit. 8:125-131; and Johnnson, B., et al. (1991) Anal. Biochem. 198:268-277.
[0211] The term “k.sub.on” or “k.sub.a”, as used herein, is intended to refer to the on rate constant for association of an antibody to the antigen to form the antibody/antigen complex.
[0212] The term “k.sub.off” or “k.sub.d”, as used herein, is intended to refer to the off rate constant for dissociation of an antibody from the antibody/antigen complex.
[0213] The term “K.sub.D”, as used herein, is intended to refer to the equilibrium dissociation constant of a particular antibody-antigen interaction. K.sub.D is calculated by k.sub.a/k.sub.d. In one embodiment, the antibodies of the invention have a K.sub.D of about 2,000 nM or less, about 1,000 nM or less, about 500 nM or less, about 200 nM or less, about 100 nM or less, about 75 nM or less, about 25 nM or less, about 21 nM or less, about 12 nM or less, about 11 nM or less, about 10 nM or less, about 9 nM or less, about 8 nM or less, about 7 nM or less, about 6 nM or less, about 5 nM or less, about 4 nM or less, about 3 nM or less, about 2 nM or less, about 1 nM or less, about 0.5 nM or less, about 0.3 nM or less, about 0.1 nM or less, about 0.01 nM or less, or about 0.001 nM or less.
[0214] The term “competitive binding”, as used herein, refers to a situation in which a first antibody competes with a second antibody, for a binding site on a third molecule, e.g., an antigen. In one embodiment, competitive binding between two antibodies is determined using FACS analysis.
[0215] The term “competitive binding assay” is an assay used to determine whether two or more antibodies bind to the same epitope. In one embodiment, a competitive binding assay is a competition fluorescent activated cell sorting (FACS) assay which is used to determine whether two or more antibodies bind to the same epitope by determining whether the fluorescent signal of a labeled antibody is reduced due to the introduction of a non-labeled antibody, where competition for the same epitope will lower the level of fluorescence.
[0216] The term “labeled antibody” as used herein, refers to an antibody, or an antigen binding portion thereof, with a label incorporated that provides for the identification of the binding protein, e.g., an antibody. Preferably, the label is a detectable marker, e.g., incorporation of a radiolabeled amino acid or attachment to a polypeptide of biotinyl moieties that can be detected by marked avidin (e.g., streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or colorimetric methods). Examples of labels for polypeptides include, but are not limited to, the following: radioisotopes or radionuclides (e.g., .sup.3H, .sup.14C, .sup.35S, .sup.90Y, .sup.99Tc, .sup.111In, .sup.125I, .sup.131, .sup.177Lu, .sup.166Ho, or .sup.153Sm); fluorescent labels (e.g., FITC, rhodamine, lanthanide phosphors), enzymatic labels (e.g., horseradish peroxidase, luciferase, alkaline phosphatase); chemiluminescent markers; biotinyl groups; predetermined polypeptide epitopes recognized by a secondary reporter (e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags); and magnetic agents, such as gadolinium chelates.
[0217] The term “antibody-drug-conjugate” or “ADC” refers to a binding protein, such as an antibody or antigen binding fragment thereof, chemically linked to one or more chemical drug(s) (also referred to herein as agent(s)) that may optionally be therapeutic or cytotoxic agents. In a preferred embodiment, an ADC includes an antibody, a cytotoxic or therapeutic drug, and a linker that enables attachment or conjugation of the drug to the antibody. An ADC typically has anywhere from 1 to 8 drugs conjugated to the antibody, including drug loaded species of 2, 4, 6, or 8. Non-limiting examples of drugs that may be included in the ADCs are mitotic inhibitors, antitumor antibiotics, immunomodulating agents, vectors for gene therapy, alkylating agents, antiangiogenic agents, antimetabolites, boron-containing agents, chemoprotective agents, hormones, antihormone agents, corticosteroids, photoactive therapeutic agents, oligonucleotides, radionuclide agents, topoisomerase inhibitors, tyrosine kinase inhibitors, and radiosensitizers.
[0218] The terms “immunogobulin-like transcript 3 antibody drug conjugate,” “anti-ILT3 antibody drug conjugate,” or “anti-ILT3 ADC”, used interchangeably herein, refer to an ADC comprising an antibody that specifically binds to ILT3, whereby the antibody is conjugated to one or more chemical agent(s) or payloads. In one embodiment, the chemical agent is linked to the antibody via a linker.
[0219] The term “drug-to-antibody ratio” or “DAR” refers to the number of drugs, e.g., IGN, auristatin, or maytansinoid, attached to the antibody of the ADC. The DAR of an ADC can range from 1 to 8, although higher loads, e.g., 10, are also possible depending on the number of linkage site on an antibody. The term DAR may be used in reference to the number of drugs loaded onto an individual antibody, or, alternatively, may be used in reference to the average or mean DAR of a group of ADCs.
[0220] The term “ILT3 associated disorder,” as used herein, includes any disorder or disease (including proliferative disorders, e.g., cancer) that is marked, diagnosed, detected or identified by a phenotypic or genotypic aberration of ILT3 genetic components or expression during the course or etiology of the disease or disorder. In this regard an ILT3 phenotypic aberration or determinant may, for example, comprise increased or decreased levels of ILT3 protein expression on one cell population, e.g., a cancer cell population, or an immune cell population (such as a tumor infiltrating cell population), as compared to another cell population, e.g., a normal cell population, or increased or decreased ILT3 protein expression on certain definable cell populations, or increased or decreased ILT3 protein expression at an inappropriate phase or stage of a cell lifecycle. It will be appreciated that similar expression patterns of genotypic determinants (e.g., mRNA transcription levels) of ILT3 may also be used to classify or detect ILT3 associated disorders. An “ILT3 associated disorder,” as used herein, also includes a disorder characterized by infiltration of cells expressing ILT3, e.g., tumor infiltrating immune cells or myeloid derived suppressor cells (MDSCs). In one embodiment, an ILT3 associated disorder is triple negative breast cancer (TNBC). In one embodiment, an ILT3 associated disorder is acute myeloid leukemia (AML).
[0221] An “ILT3 associated disorder,” as used herein, also includes inflammatory disorders including, but not limited to, pigmented villonodular synovitis (PVNS). In one embodiment, an anti-ILT3 antibody or ADC of the present invention can be used to treat an inflammatory disorder in a subject including, but not limited to PVNS.
[0222] The term “cancer,” as used herein, is meant to refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth. Examples of cancer include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies. More particular examples of such cancers include, but are not limited to, breast cancer (Luminal A, TNBC, Ductal), prostate cancer, squamous cell tumors, squamous cell carcinoma (e.g., squamous cell lung cancer or squamous cell head and neck cancer), neuroendocrine tumors, urothelial cancer, vulvar cancer, mesothelioma, liver cancer, bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, lung cancer, small cell lung cancer, non-small cell lung cancer, cutaneous or intraocular malignant melanoma, renal cancer, uterine cancer, ovarian cancer, colorectal cancer, colon cancer, rectal cancer, cancer of the anal region, stomach cancer, testicular cancer, uterine cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, non-Hodgkin's lymphoma, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of The urethra, cancer of the penis, solid tumors of childhood, lymphocytic lymphoma, cancer of the bladder, cancer of the kidney or ureter, carcinoma of the renal pelvis, neoplasm of the central nervous system (CNS), primary CNS lymphoma, tumor angiogenesis, spinal axis tumor, brain stem glioma, pituitary adenorna, Kaposi's sarcoma, epidermoid cancer, environmentally induced cancers including those induced by asbestos, hematologic malignancies including, for example, multiple myeloma, B-cell lymphoma, Hodgkin lymphoma/primary mediastinal B-cell lymphoma, non-Hodgkin's lymphomas, acute myeloid lymphoma, chronic myelogenous leukemia, chronic lymphoid leukemia, follicular lymphoma, diffuse large B-cell lymphoma, Burkitt's lymphoma, immunoblastic large cell lymphoma, precursor B-lymphoblastic lymphoma, mantle cell lymphoma, acute lymphoblastic leukemia, mycosis fungoides, anaplastic large cell lymphoma, T-cell lymphoma, and precursor T-lymphoblastic lymphoma, and any combinations of said cancers. Acute myeloid leukemia, adrenocortical carcinoma, ladder urothelial carcinoma, cervical squamous cell carcinoma, endocervical adenocarcinoma, diffuse large B cell lymphoma, glioblastoma multiforme, chronic lymphocytic leukemia, brain lower grade glioma, head and neck squamous cell carcinoma, hepatocellular carcinoma, lung adenocarcinoma, large squamous cell carcinoma, cutaneous melanoma, ovarial serous cystadenocarcinoma, gastric cancer, soft tissue sarcoma, testicular germ cell cancer, thymoma, thyroid carcinoma, uterine corpus endometrial carcinoma, uterine carcinosarcoma, kidney renal clear cell carcinoma, and kidney renal papillary cell carcinoma. The present invention is also applicable to treatment of metastatic cancers.
[0223] In one embodiment, an anti-ILT3 antibody or ADC of the present invention can be used to treat a cancer in a subject including, but not limited to Hodgkin's lymphoma, acute myeloid leukemia, adrenocortico carcinoma, ladder urothelial carcinoma, breast cancer (Luminal A, TNBC, Ductal), cervical squamous cell carcinoma, endocervical adenocarcinoma, colorectal adenocarcinoma, diffuse large B cell lymphoma, non-hodgkin's lymphoma, glioblastoma multiforme, chronic lymphocytic leukemia, brain lower grade glioma, head and neck squamous cell carcinoma, hepatocellular carcinoma, lung adenocarcinoma, small cell lung cancer, large squamous cell carcinoma, cutaneous melanoma, ovarial serous cystadenocarcinoma, gastric cancer, soft tissue sarcoma, mesothelioma, pancreatic adenocarcinoma, testicular germ cell cancer, thymoma, thyroid carcinoma, uterine corpus endometrial carcinoma, uterine carcinosarcoma, kidney renal clear cell carcinoma, and kidney renal papillary cell carcinoma.
[0224] In one embodiment, the antibodies or ADCs of the invention are administered to a patient having a solid tumor, including an advanced solid tumor. In one embodiment, the tumor expresses ILT3 or contains tumor infiltrating immune cells or myeloid derived suppressor cells (MDSCs) expressing ILT3. In another embodiment, the tumor does not express ILT3 and/or does not contain tumor infiltrating immune cells or MDSCs expressing ILT3. In another embodiment, administration of the antibodies of the invention to a patient upregulates an immune response in the patient. In another embodiment, administration of ADCs of the invention induce cell death of ILT3 expressing cells.
[0225] The term “ILT3 expressing tumor,” as used herein, refers to a tumor which expresses ILT3 protein (including a tumor comprising tumor infiltrating cells that express ILT3 protein), such as a triple negative breast cancer (TNBC) tumor. In one embodiment, ILT3 expression in a tumor is determined using immunohistochemical staining of tumor cell membranes, where any immunohistochemical staining above background level in a tumor sample indicates that the tumor is an ILT3 expressing tumor. In another embodiment, an ILT3 expressing tumor, e.g., a TNBC tumor expressing ILT3, is identified in a patient when greater than 1%, greater than 2%, greater than 3%, greater than 4%, greater than 5%, greater than 6%, greater than 7%, greater than 8%, greater than 9%, greater than 10%, greater than 15%, greater than 20%, greater than 25%, or greater than 30%, greater than 40%, greater than 50%, greater than 60%, greater than 70%, greater than 80%, greater than 90%, or more of the cells in a tumor sample are positive for ILT3 expression. In one embodiment, the ILT3 expressing cells in the sample are tumor infiltrating immune cells. In another embodiment, ILT3 positive expression is determined based on membrane staining as determined by, e.g., immunohistochemistry (IHC) analysis.
[0226] An ILT3 expressing tumor is identified as having an “elevated level of ILT3” or “expressing ILT3 at an elevated level” when level level of ILT3 is higher than in tissue surrounding the cancer. In sonic embodiments, an “elevated level of ILT3” is one in which 5% or more of the cells in a tumor sample have membrane staining. In some embodiments a “high level” in regard to ILT3 is 5% or more staining, for example, 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100% of the cells in the tumor sample are stained. In some embodiments, the protein expression levels can be measured by IHC analysis. In another embodiment, the ILT3 expressing cells in the sample are tumor infiltrating immune cells.
[0227] An ILT3 expressing tumor is identified as having a “low level of ILT3” or “expressing ILT3 at a low level” is one in which 5% or less of the cells in a tumor sample have membrane staining In some embodiments a “low level” in regard to ILT3 is 5% or less staining, for example, 4.9, 4.5, 4, 3, 2, 1, 0.9, 0.8, 0.7, 0.6, 0.5, 0.4, 0.3, 0.2, 0.1% or less of the cells in the tumor sample are stained. In some embodiments, the protein expression levels can be measured by IHC analysis. In another embodiment, the ILT3 expressing cells in the sample are tumor infiltrating immune cells.
[0228] A cell that expresses no ILT3 can also be described as expressing a “low level of ILT3”. Thus, the phrase “expresses a low level of ILT3” encompasses no ILT3 expression. In some embodiments, a low level of ILT3 is within the background staining levels. In some embodiments, a sample that is ILT3 “negative” has no ILT3 expression or a low level of ILT3. In some embodiments, ILT3 staining is negative when no or less than 5%, 4%, 3%, 2%, or 1% of the cells have membrane staining for ILT3.
[0229] As used herein, the term TNBC “tumor sample” refers to a tumor tissue or cell sample obtained from a TNBC tumor. The sample can include both tumor cells and tumor infiltrating cells, e.g., tumor infiltrating immune cells.
[0230] As used herein, the term “non-cancer sample” or “normal sample” refers to a sample from a normal tissue (e.g., a breast tissue sample). In some embodiments, the non-cancer sample comes from the same subject, but is from a different part of the subject than that being tested. In some embodiments, the non-cancer sample is from a tissue area surrounding or adjacent to the cancer, e.g., TNBC. In some embodiments, the non-cancer sample is not from the subject being tested, but is a sample from a subject known to have, or not to have, a disorder in question (for example, a particular cancer such as TNBC or ILT3 related disorder). In some embodiments, the non-cancer sample is from the same subject, but from a point in time before the subject developed cancer. In some embodiments, the reference sample is from a benign cancer sample (for example, benign breast cancer sample), from the same or a different subject.
[0231] Methods for detecting expression of ILT3 in a tumor are known in the art. For example, immunohistochemistry (IHC) analysis was used by the inventors to show that ILT3 is expressed in triple negative breast cancer (TNBC) tissue. In particular, ILT3 was shown to be predominantly expressed by CD68.sup.+ tumor infiltrating immune cells (see Example 1).
[0232] The terms “overexpress,” “overexpression,” or “overexpressed” interchangeably refer to a gene that is transcribed or translated at a detectably greater level, usually in a cancer cell, in comparison to a normal cell. Overexpression therefore refers to both overexpression of protein and RNA (due to increased transcription, post transcriptional processing, translation, post translational processing, altered stability, and altered protein degradation), as well as local overexpression due to altered protein traffic patterns (increased nuclear localization), and augmented functional activity, e.g., as in an increased enzyme hydrolysis of substrate. Thus, overexpression refers to either protein or RNA levels. Overexpression can also be by 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more in comparison to a normal cell or comparison cell. In certain embodiments, the anti-ILT3 antibodies or ADCs are used to treat solid tumors likely to overexpress ILT3.
[0233] The term “administering” as used herein is meant to refer to the delivery of a substance (e.g., an anti-ILT3 antibody or ADC) to achieve a therapeutic objective (e.g., the treatment of an ILT3-associated disorder or the inhibition or reduction of a tumor or the treatment of an inflammatory disorder such as PVNS). Modes of administration may be parenteral, enteral and topical. Parenteral administration is usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal and intrasternal injection and infusion.
[0234] The term “combination therapy”, as used herein, refers to the administration of two or more therapeutic substances, e.g., an anti-ILT3 antibody or ADC and an additional therapeutic agent. The additional therapeutic agent may be administered concomitant with, prior to, or following the administration of the anti-ILT3 antibody or ADC. In one embodiment, the anti-ILT3 antibodies or ADCs of the invention are administered in combination with one or more immune checkpoint inhibitors (e.g., one or more antibody or small molecule immune checkpoint inhibitors) for the treatment of a cancer or an inflammatory disorder such as PVNS.
[0235] As used herein, the term “effective amount” or “therapeutically effective amount” refers to the amount of a drug, e.g., an antibody or ADC, which is sufficient to reduce or ameliorate the severity and/or duration of a disorder, e.g., cancer, or an inflammatory disorder such as PVNS, or one or more symptoms thereof, prevent the advancement of a disorder, cause regression of a disorder, prevent the recurrence, development, onset or progression of one or more symptoms associated with a disorder, detect a disorder, or enhance or improve the prophylactic or therapeutic effect(s) of another therapy (e.g., prophylactic or therapeutic agent). The effective amount of an antibody or ADC may, for example, inhibit tumor growth (e.g., inhibit an increase in tumor volume), decrease tumor growth (e.g., decrease tumor volume), reduce the number of cancer cells, and/or relieve to some extent one or more of the symptoms associated with the cancer. The effective amount may, for example, improve disease free survival (DFS), improve overall survival (OS), or decrease likelihood of recurrence.
[0236] Various aspects of the invention are described in further detail in the following subsections.
II. Anti-ILT3 Antibodies
[0237] One aspect disclosed herein provides humanized anti-ILT3 antibodies, or antigen binding portions thereof. Another aspect disclosed herein provides human anti-ILT3 antibodies, or antigen binding portions thereof. In one embodiment, the antibodies disclosed herein bind human ILT3. In another embodiment, the antibodies disclosed herein bind cynomolgus monkey ILT3. In another embodiment, the antibodies disclosed herein bind human ILT3 expressed on APCs, e.g., dentritic cells (DCs), monocytes, and macrophages, B-cells, and natural killer (NK) cells. In another embodiment, the antibodies disclosed herein bind human ILT3 expressed on tumor infiltrating immune cells, e.g., myeloid cells. In another embodiment, the antibodies disclosed herein bind human ILT3 expressed on tumor cells.
[0238] Another aspect disclosed herein features antibody drug conjugates (ADCs) comprising an anti-ILT3 antibody described herein and at least one drug(s). The antibodies or ADCs disclosed herein have characteristics including, but not limited to, binding to human ILT3 in vitro, binding human ILT3 expressed on APCs, e.g., dentritic cells (DCs), monocytes, and macrophages, B-cells, and natural killer (NK) cells, binding human ILT3 expressed on tumor infiltrating immune cells, e.g., myeloid cells, binding human ILT3 expressed on tumor cells, upregulating an immune response in vivo, increasing T cell activation in vivo; increasing CD8+ T cell expansion and effector functions that would result in anti-tumor response, inducing cell death in cells expressing ILT3, including, but not limited to, myeloid derived suppressor cells (MDSCs) and tumor associated macrophages, and decreasing or inhibiting cancer, tumor cellular proliferation or tumor growth, or tumor invasion and metastasis. ADCs disclosed herein, in particular, have characteristics including, but not limited to, inducing cell death in cells expressing ILT3, e.g., myeloid cells expressing ILT3. In one embodiment, an anti-ILT3 antibody or ADC disclosed herein is capable of being internalized into a cell expressing ILT3.
[0239] In one embodiment, anti-ILT3 antibodies are disclosed which have the ability to bind to ILT3, as described in the Examples below. Collectively, the novel antibodies are referred to herein as “ILT3 antibodies.” The anti-ILT3 antibodies, ADCs, or antigen binding fragments thereof, are able to inhibit or decrease tumor growth in vivo. The tumor can be an ILT3 negative tumor or an ILT3 expressing tumor. In various embodiments, anti-ILT3 antibodies, ADCs, or antigen binding fragments thereof, are capable of modulating a biological function of ILT3. In other embodiments of the foregoing aspects, the anti-ILT3 antibodies, ADCs, or antigen binding fragments thereof, bind ILT3 on cells expressing ILT3. Thus, the disclosure includes anti-ILT3 antibodies, ADCs, or antigen binding fragments thereof, that are effective at inhibiting or decreasing tumor growth.
[0240] In addition, the present inventors have shown that ILT3 is expressed by tumor infiltrating cells in triple negative breast cancer (see Example 1). TNBC is notoriously biologically aggressive and difficult to treat (see, Wahba and El-Haddad (2015) Cancer Biol. Med. 12(2): 106-116). According, the anti-ILT3 antibodies, ADCs, and antigen-binding portions thereof, can be used for the treatment of TNBC in a subject. In one embodiment, greater than 1%, greater than 2%, greater than 3%, greater than 4%, greater than 5%, greater than 6%, greater than 7%, greater than 8%, greater than 9%, greater than 10%, greater than 15%, greater than 20%, greater than 25%, or greater than 30%, greater than 40%, greater than 50%, greater than 60%, greater than 70%, greater than 80%, greater than 90%, or more of the cells in a TNBC tumor sample are positive for ILT3 expression. In another embodiment, a TNBC tumor sample has a high level of ILT3 expression. For example, in one embodiment, at least 5% or more of the cells in a TNBC tumor sample have membrane staining. In another embodiment, a TNBC tumor sample obtained from the subject displays a low level of expression of ILT3. The expression level of ILT3 can be determined by any method known in the art. For example, the expression level of ILT3 can be determined via immunohistochemical analysis. In another embodiment, the TNBC has been previously treated with another anti-cancer agent or anti-cancer therapy, e.g., a chemotherapy. In one embodiment, the TNBC is resistant to chemotherapy.
[0241] Antibodies having combinations of any of the aforementioned characteristics are contemplated as aspects of the disclosure. ADCs, described in more detail below, may also have any of the foregoing characteristics.
[0242] One aspect of the disclosure features an anti-human ILT3 (anti-hILT3) Antibody Drug Conjugate (ADC) comprising an anti-hILT3 antibody conjugated to a drug via a linker. Exemplary anti-ILT3 antibodies (and sequences thereof) that can be used in the ADCs are described herein.
[0243] The anti-ILT3 antibodies described herein provide the ADCs with the ability to bind to ILT3 such that the cytotoxic molecule attached to the antibody may be delivered to the ILT3-expressing cell, particularly a ILT3 expressing cancer cell or a myeloid derived suppressor cell (MDSC).
[0244] While the term “antibody” is used throughout, it should be noted that antibody fragments (i.e., antigen-binding portions of an anti-ILT3 antibody) are also included in the disclosure and may be included in the embodiments (methods and compositions) described throughout. For example, an anti-ILT3 antibody fragment may be conjugated to the drugs, as described herein. In certain embodiments, an anti-ILT3 antibody binding portion is a Fab, a Fab′, a F(ab′)2, a Fv, a disulfide linked Fv, an scFv, a single domain antibody, or a diabody.
[0245] Example 2 describes the generation of twenty-one human recombinant ILT3 antibodies against the extracellular domain of human ILT3. The heavy and light chain variable region amino acid sequences for these human antibodies are set forth in Table 2. The heavy and light chain variable region nucleic acid sequences for these human antibodies are set forth in Table 3.
[0246] Thus, in one embodiment, the disclosure includes human anti-hILT3 antibodies, or antigen binding portions thereof, comprising a heavy chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:1, 9, 17, 24, 29, 35, 40, 45, 53, 61, 68, 74, 79, 81, 85, 90, 98, 101, 104, 107 and 108; and a light chain variable region comprising an amino acid sequence selected from the group consisting of 5, 13, 20, 27, 32, 38, 44, 49, 57, 65, 72, 78, 80, 84, 89, 94, and 100.
[0247] In one embodiment, the disclosure includes a human anti-hILT3 antibody, or antigen binding portion thereof, comprising an HC CDR set (CDR1, CDR2, and CDR3) selected from the group consisting of SEQ ID NOs: 2, 3, and 4; SEQ ID NOs: 10, 11, and 12; SEQ ID NOs: 2, 18, and 19; SEQ ID NOs: 10, 25, and 26; SEQ ID NOs: 30, 31, and 12; SEQ ID NOs: 36, 37, and 12; SEQ ID NOs: 41, 42, and 43; SEQ ID NOs: 46, 47, and 48; SEQ ID NOs: 54, 55, and 56; SEQ ID NOs: 62, 63, and 64; SEQ ID NOs: 69, 70, and 71; SEQ ID NOs: 75, 76, and 77; SEQ ID NOs: 46, 70, and 71; SEQ ID NOs: 82, 83, and 48; SEQ ID NOs: 86, 87, and 88; SEQ ID NOs: 91, 92, and 93; SEQ ID NOs: 46, 63, and 99; SEQ ID NOs: 102, 103, and 48; SEQ ID NOs: 62, 105, and 106; and SEQ ID NOs: 109, 110, and 106.
[0248] and an LC CDR set (CDR1, CDR2, and CDR3) selected from the group consisting of SEQ ID NOs: 6, 7, and 8; SEQ ID NOs: 14, 15, and 16; SEQ ID NOs: 21, 22, and 23; SEQ ID NOs: 6, 7, and 28; SEQ ID NOs: 33, 34, and 16; SEQ ID NOs: 33, 39, and 16; SEQ ID NOs: 50, 51, and 52; SEQ ID NOs: 59, 59, and 60; SEQ ID NOs: 66, 67, and 60; SEQ ID NOs: 50, 73, and 52; SEQ ID NOs: 50, 73, and 60; and SEQ ID NOs: 95, 96, and 97.
[0249] In one embodiment, an anti-ILT3 antibody, or antigen binding portion thereof, is the human antibody E2F12H8 (also referred to herein as 1E2F12H8). The E2F12H8 antibody comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 4, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 3, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 2, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 8, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 7, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 6. In further embodiments, disclosed herein is an antibody having a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 1 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 5.
[0250] In some embodiments, an anti-ILT3 antibody, or antigen-binding portion thereof, comprises a heavy chain comprising an amino acid sequence set forth in SEQ ID NO: 1, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 1, and/or a light chain comprising an amino acid sequence set forth in SEQ ID NO: 5, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 5.
[0251] In one embodiment, the disclosure features an anti-ILT3 antibody, or antigen binding portion thereof, which is the human antibody E12H10 (also referred to herein as 1E12H10). The E12H10 antibody comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 12, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 11, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 10, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 16, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 15, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 14. In further embodiments, the disclosure provides an antibody having a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 9 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 13.
[0252] In some embodiments, an anti-ILT3 antibody, or antigen-binding portion thereof, comprises a heavy chain comprising an amino acid sequence set forth in SEQ ID NO: 9, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 9, and/or a light chain comprising an amino acid sequence set forth in SEQ ID NO: 13, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 13.
[0253] In one embodiment, the disclosure features an anti-ILT3 antibody, or antigen binding portion thereof, which is the human antibody 3C4A3. The 3C4A3 antibody comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 19, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 18, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 2, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 23, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 22, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 21. In further embodiments, the disclosure provides an antibody having a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 17 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 20.
[0254] In some embodiments, an anti-ILT3 antibody, or antigen-binding portion thereof, comprises a heavy chain comprising an amino acid sequence set forth in SEQ ID NO: 17, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 17, and/or a light chain comprising an amino acid sequence set forth in SEQ ID NO: 20, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 20.
[0255] In one embodiment, the disclosure features an anti-ILT3 antibody, or antigen binding portion thereof, which is the human antibody 8E11B6. The 8E11B6 antibody comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 26, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 25, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 10, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 28, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 7, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 6. In further embodiments, the disclosure provides an antibody having a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 24 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 27.
[0256] In some embodiments, an anti-ILT3 antibody, or antigen-binding portion thereof, comprises a heavy chain comprising an amino acid sequence set forth in SEQ ID NO: 24, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 24, and/or a light chain comprising an amino acid sequence set forth in SEQ ID NO: 27, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 27.
[0257] In one embodiment, the disclosure features an anti-ILT3 antibody, or antigen binding portion thereof, which is the human antibody 17E8_27 C5. The 17E8_27C5 antibody comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 12, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 31, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 30, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 16, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 34, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 33. In further embodiments, the disclosure provides an antibody having a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 29 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 32.
[0258] In some embodiments, an anti-ILT3 antibody, or antigen-binding portion thereof, comprises a heavy chain comprising an amino acid sequence set forth in SEQ ID NO: 29, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 29, and/or a light chain comprising an amino acid sequence set forth in SEQ ID NO: 32, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 32.
[0259] In one embodiment, the disclosure features an anti-ILT3 antibody, or antigen binding portion thereof, which is the human antibody 17F4_27C6. The 17F4_27C6 antibody comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 12, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 37, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 36, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 16, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 39, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 33. In further embodiments, the disclosure provides an antibody having a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 35 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 38.
[0260] In some embodiments, an anti-ILT3 antibody, or antigen-binding portion thereof, comprises a heavy chain comprising an amino acid sequence set forth in SEQ ID NO: 35, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 35, and/or a light chain comprising an amino acid sequence set forth in SEQ ID NO: 38, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 38.
[0261] In one embodiment, the disclosure features an anti-ILT3 antibody, or antigen binding portion thereof, which is the human antibody 11H10_27 D4. The 11H10_27 D4 antibody comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 43, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 42, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 41, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 16, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 34, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 33. In further embodiments, the disclosure provides an antibody having a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 40 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 44.
[0262] In some embodiments, an anti-ILT3 antibody, or antigen-binding portion thereof, comprises a heavy chain comprising an amino acid sequence set forth in SEQ ID NO: 40, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 40, and/or a light chain comprising an amino acid sequence set forth in SEQ ID NO: 44, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 44.
[0263] In one embodiment, the disclosure features an anti-ILT3 antibody, or antigen binding portion thereof, which is the human antibody 1C4_24B4. The 1C4_24B4 antibody comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 48, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 47, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 46, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 52, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 51, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 50. In further embodiments, the disclosure provides an antibody having a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 45 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 49.
[0264] In some embodiments, an anti-ILT3 antibody, or antigen-binding portion thereof, comprises a heavy chain comprising an amino acid sequence set forth in SEQ ID NO: 45, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 45, and/or a light chain comprising an amino acid sequence set forth in SEQ ID NO: 49, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 49.
[0265] In one embodiment, the disclosure features an anti-ILT3 antibody, or antigen binding portion thereof, which is the human antibody 20H6_24C3. The 20H6_24C3 antibody comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 56, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 55, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 54, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 60, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 59, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 58. In further embodiments, the disclosure provides an antibody having a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 53 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 57.
[0266] In some embodiments, an anti-ILT3 antibody, or antigen-binding portion thereof, comprises a heavy chain comprising an amino acid sequence set forth in SEQ ID NO: 53, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 53, and/or a light chain comprising an amino acid sequence set forth in SEQ ID NO: 57, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 57.
[0267] In one embodiment, the disclosure features an anti-ILT3 antibody, or antigen binding portion thereof, which is the human antibody 14E7_27C1. The 14E7_27C1 antibody comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 64, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 63, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 62, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 60, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 67, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 66. In further embodiments, the disclosure provides an antibody having a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 61 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 65.
[0268] In some embodiments, an anti-ILT3 antibody, or antigen-binding portion thereof, comprises a heavy chain comprising an amino acid sequence set forth in SEQ ID NO: 61, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 61, and/or a light chain comprising an amino acid sequence set forth in SEQ ID NO: 65, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 65.
[0269] In one embodiment, the disclosure features an anti-ILT3 antibody, or antigen binding portion thereof, which is the human antibody 5A2_24 A1. The 5A2_24 A1 antibody comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 71, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 70, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 69, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 52, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 73, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 50. In further embodiments, the disclosure provides an antibody having a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 68 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 72.
[0270] In some embodiments, an anti-ILT3 antibody, or antigen-binding portion thereof, comprises a heavy chain comprising an amino acid sequence set forth in SEQ ID NO: 68, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 68, and/or a light chain comprising an amino acid sequence set forth in SEQ ID NO: 72, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 72.
[0271] In one embodiment, the disclosure features an anti-ILT3 antibody, or antigen binding portion thereof, which is the human antibody 5E3_24B4. The 5E3_24B4 antibody comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 77, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 76, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 75, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 60, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 73, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 50. In further embodiments, the disclosure provides an antibody having a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 74 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 78.
[0272] In some embodiments, an anti-ILT3 antibody, or antigen-binding portion thereof, comprises a heavy chain comprising an amino acid sequence set forth in SEQ ID NO: 74, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 74, and/or a light chain comprising an amino acid sequence set forth in SEQ ID NO: 78, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 78.
[0273] In one embodiment, the disclosure features an anti-ILT3 antibody, or antigen binding portion thereof, which is the human antibody 7C12_24A6. The 7C12_24A6 antibody comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 71, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 70, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 46, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 60, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 73, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 50. In further embodiments, the disclosure provides an antibody having a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 79 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 80.
[0274] In some embodiments, an anti-ILT3 antibody, or antigen-binding portion thereof, comprises a heavy chain comprising an amino acid sequence set forth in SEQ ID NO: 79, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 79, and/or a light chain comprising an amino acid sequence set forth in SEQ ID NO: 80, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 80.
[0275] In one embodiment, the disclosure features an anti-ILT3 antibody, or antigen binding portion thereof, which is the human antibody 6H9_27 D5. The 6H9_27 D5 antibody comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 48, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 83, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 82, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 52, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 73, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 50. In further embodiments, the disclosure provides an antibody having a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 81 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 84.
[0276] In some embodiments, an anti-ILT3 antibody, or antigen-binding portion thereof, comprises a heavy chain comprising an amino acid sequence set forth in SEQ ID NO: 81, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 81, and/or a light chain comprising an amino acid sequence set forth in SEQ ID NO: 84, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 84.
[0277] In one embodiment, the disclosure features an anti-ILT3 antibody, or antigen binding portion thereof, which is the human antibody 10A5_24 A2. The 10A5_24 A2 antibody comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 88, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 87, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 86, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 52, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 73, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 50. In further embodiments, the disclosure provides an antibody having a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 85 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 89.
[0278] In some embodiments, an anti-ILT3 antibody, or antigen-binding portion thereof, comprises a heavy chain comprising an amino acid sequence set forth in SEQ ID NO: 85, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 85, and/or a light chain comprising an amino acid sequence set forth in SEQ ID NO: 89, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 89.
[0279] In one embodiment, the disclosure features an anti-ILT3 antibody, or antigen binding portion thereof, which is the human antibody 16B10_27 D2. The 16B10_27 D2 antibody comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 93, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 92, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 91, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 97, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 96, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 95. In further embodiments, the disclosure provides an antibody having a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 90 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 94.
[0280] In some embodiments, an anti-ILT3 antibody, or antigen-binding portion thereof, comprises a heavy chain comprising an amino acid sequence set forth in SEQ ID NO: 90, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 90, and/or a light chain comprising an amino acid sequence set forth in SEQ ID NO: 94, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 94.
[0281] In one embodiment, the disclosure features an anti-ILT3 antibody, or antigen binding portion thereof, which is the human antibody 3D8D11. The 3D8D11 antibody comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 99, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 63, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 46, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 60, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 73, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 50. In further embodiments, the disclosure provides an antibody having a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 98 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 100.
[0282] In some embodiments, an anti-ILT3 antibody, or antigen-binding portion thereof, comprises a heavy chain comprising an amino acid sequence set forth in SEQ ID NO: 98, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 98, and/or a light chain comprising an amino acid sequence set forth in SEQ ID NO: 100, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 100.
[0283] In one embodiment, the disclosure features an anti-ILT3 antibody, or antigen binding portion thereof, which is the human antibody 3H3_24B2. The 3H3_24B2 antibody comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 48, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 103, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 102, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 60, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 73, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 50. In further embodiments, the disclosure provides an antibody having a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 101 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 100.
[0284] In some embodiments, an anti-ILT3 antibody, or antigen-binding portion thereof, comprises a heavy chain comprising an amino acid sequence set forth in SEQ ID NO: 101, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 101, and/or a light chain comprising an amino acid sequence set forth in SEQ ID NO: 100, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 100.
[0285] In one embodiment, the disclosure features an anti-ILT3 antibody, or antigen binding portion thereof, which is the human antibody 6B6_24B5. The 6B6_24B5 antibody comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 106, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 105, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 62, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 60, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 73, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 50. In further embodiments, the disclosure provides an antibody having a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 104 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 100.
[0286] In some embodiments, an anti-ILT3 antibody, or antigen-binding portion thereof, comprises a heavy chain comprising an amino acid sequence set forth in SEQ ID NO: 104, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 104, and/or a light chain comprising an amino acid sequence set forth in SEQ ID NO: 100, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 100.
[0287] In one embodiment, the disclosure features an anti-ILT3 antibody, or antigen binding portion thereof, which is the human antibody 8C7_24B1. The 8C7_24B1 antibody comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 106, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 105, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 62, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 60, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 73, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 50. In further embodiments, the disclosure provides an antibody having a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 107 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 100.
[0288] In some embodiments, an anti-ILT3 antibody, or antigen-binding portion thereof, comprises a heavy chain comprising an amino acid sequence set forth in SEQ ID NO: 107, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 107, and/or a light chain comprising an amino acid sequence set forth in SEQ ID NO: 100, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 100.
[0289] In one embodiment, the disclosure features an anti-ILT3 antibody, or antigen binding portion thereof, which is the human antibody 4F4_27 D3. The 4F4_27 D3 antibody comprises a heavy chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 106, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 110, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 109, and a light chain variable region comprising a CDR3 domain comprising the amino acid sequence of SEQ ID NO: 60, a CDR2 domain comprising the amino acid sequence of SEQ ID NO: 73, and a CDR1 domain comprising the amino acid sequence of SEQ ID NO: 50. In further embodiments, the disclosure provides an antibody having a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 108 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 100.
[0290] In some embodiments, an anti-ILT3 antibody, or antigen-binding portion thereof, comprises a heavy chain comprising an amino acid sequence set forth in SEQ ID NO: 108, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 108, and/or a light chain comprising an amino acid sequence set forth in SEQ ID NO: 100, or a sequence having at least 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 100.
[0291] The foregoing anti-ILT3 antibody CDR sequences establish a novel family of ILT3 binding proteins, isolated in accordance with this disclosure, and comprising antigen binding polypeptides that include the CDR sequences listed in Table 2, as well as in the Sequence Summary.
[0292] To generate and to select CDRs having preferred ILT3 binding and/or neutralizing activity with respect to hILT3, standard methods known in the art for generating antibodies, or antigen binding portions thereof, and assessing the ILT3 binding and/or neutralizing characteristics of those antibodies, or antigen binding portions thereof, may be used, including but not limited to those specifically described herein (see, e.g., Example 2).
[0293] In certain embodiments, the antibody comprises a heavy chain constant region, such as an IgG 1, IgG2, IgG3, IgG4, IgA, IgE, IgM, or IgD constant region. In certain embodiments, the anti-ILT3 antibody, or antigen binding portion thereof, comprises a heavy chain immunoglobulin constant domain selected from the group consisting of a human IgG constant domain, a human IgM constant domain, a human IgE constant domain, and a human IgA constant domain. In further embodiments, the antibody, or antigen binding portion thereof, has an IgG1 heavy chain constant region, an IgG2 heavy chain constant region, an IgG3 constant region, or an IgG4 heavy chain constant region. Preferably, the heavy chain constant region is an IgG1 heavy chain constant region or an IgG4 heavy chain constant region. Furthermore, the antibody can comprise a light chain constant region, either a kappa light chain constant region or a lambda light chain constant region. Preferably, the antibody comprises a kappa light chain constant region. Alternatively, the antibody portion can be, for example, a Fab fragment or a single chain Fv fragment.
[0294] In certain embodiments, the anti-ILT3 antibody binding portion is a Fab, a Fab′, a F(ab′)2, a Fv, a disulfide linked Fv, an scFv, a single domain antibody, or a diabody.
[0295] In certain embodiments, the anti-ILT3 antibody, or antigen binding portion thereof, is a multispecific antibody, e.g. a bispecific antibody.
[0296] In certain embodiments, the anti-ILT3 antibody, or antigen binding portion thereof, comprises a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 1 and/or a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 5.
[0297] In certain embodiments, the anti-ILT3 antibody, or antigen binding portion thereof, comprises a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 9 and/or a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 13.
[0298] In certain embodiments, the anti-ILT3 antibody, or antigen binding portion thereof, comprises a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 17 and/or a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 20.
[0299] In certain embodiments, the anti-ILT3 antibody, or antigen binding portion thereof, comprises a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 24 and/or a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 27.
[0300] In certain embodiments, the anti-ILT3 antibody, or antigen binding portion thereof, comprises a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 29 and/or a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 32.
[0301] In certain embodiments, the anti-ILT3 antibody, or antigen binding portion thereof, comprises a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 35 and/or a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 38. In certain embodiments, the anti-ILT3 antibody, or antigen binding portion thereof, comprises a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 40 and/or a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 44.
[0302] In certain embodiments, the anti-ILT3 antibody, or antigen binding portion thereof, comprises a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 45 and/or a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 49.
[0303] In certain embodiments, the anti-ILT3 antibody, or antigen binding portion thereof, comprises a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 53 and/or a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 57.
[0304] In certain embodiments, the anti-ILT3 antibody, or antigen binding portion thereof, comprises a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 61 and/or a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 65.
[0305] In certain embodiments, the anti-ILT3 antibody, or antigen binding portion thereof, comprises a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 68 and/or a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 72. In certain embodiments, the anti-ILT3 antibody, or antigen binding portion thereof, comprises a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 74 and/or a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 78.
[0306] In certain embodiments, the anti-ILT3 antibody, or antigen binding portion thereof, comprises a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 79 and/or a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 80.
[0307] In certain embodiments, the anti-ILT3 antibody, or antigen binding portion thereof, comprises a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 81 and/or a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 84.
[0308] In certain embodiments, the anti-ILT3 antibody, or antigen binding portion thereof, comprises a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 85 and/or a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 89.
[0309] In certain embodiments, the anti-ILT3 antibody, or antigen binding portion thereof, comprises a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 90 and/or a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 94.
[0310] In certain embodiments, the anti-ILT3 antibody, or antigen binding portion thereof, comprises a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 98 and/or a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 100.
[0311] In certain embodiments, the anti-ILT3 antibody, or antigen binding portion thereof, comprises a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 101 and/or a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 100.
[0312] In certain embodiments, the anti-ILT3 antibody, or antigen binding portion thereof, comprises a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 104 and/or a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 100.
[0313] In certain embodiments, the anti-ILT3 antibody, or antigen binding portion thereof, comprises a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 107 and/or a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 100.
[0314] In certain embodiments, the anti-ILT3 antibody, or antigen binding portion thereof, comprises a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 108 and/or a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 100.
[0315] Replacements of amino acid residues in the Fc portion to alter antibody effector function are have been described (Winter, et al. U.S. Pat. Nos. 5,648,260 and 5,624,821, incorporated by reference herein). The Fc portion of an antibody mediates several important effector functions e.g. cytokine induction, ADCC, phagocytosis, complement dependent cytotoxicity (CDC) and half-life/clearance rate of antibody and antigen-antibody complexes. In some cases these effector functions are desirable for therapeutic antibody but in other cases might be unnecessary or even deleterious, depending on the therapeutic objectives. Certain human IgG isotypes, particularly IgG1 and IgG3, mediate ADCC and CDC via binding to FcγRs and complement C1q, respectively. Neonatal Fc receptors (FcRn) are the critical components determining the circulating half-life of antibodies. In still another embodiment at least one amino acid residue is replaced in the constant region of the antibody, for example the Fc region of the antibody, such that effector functions of the antibody are altered.
[0316] One embodiment includes a labeled anti-ILT3 antibody, or antibody portion thereof, where the antibody is derivatized or linked to one or more functional molecule(s) (e.g., another peptide or protein). For example, a labeled antibody can be derived by functionally linking an antibody or antibody portion of the disclosure (by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as another antibody (e.g., a bispecific antibody or a diabody), a detectable agent, a pharmaceutical agent, a protein or peptide that can mediate the association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag), and/or a cytotoxic or therapeutic agent selected from the group consisting of a mitotic inhibitor, an antitumor antibiotic, an immunomodulating agent, a vector for gene therapy, an alkylating agent, an antiangiogenic agent, an antimetabolite, a boron-containing agent, a chemoprotective agent, a hormone, an antihormone agent, a corticosteroid, a photoactive therapeutic agent, an oligonucleotide, a radionuclide agent, a topoisomerase inhibitor, a tyrosine kinase inhibitor, a radiosensitizer, and a combination thereof.
[0317] Useful detectable agents with which an antibody or antibody portion thereof, may be derivatized include fluorescent compounds. Exemplary fluorescent detectable agents include fluorescein, fluorescein isothiocyanate, rhodamine, 5-dimethylamine-1-napthalenesulfonyl chloride, phycoerythrin and the like. An antibody may also be derivatized with detectable enzymes, such as alkaline phosphatase, horseradish peroxidase, glucose oxidase and the like. When an antibody is derivatized with a detectable enzyme, it is detected by adding additional reagents that the enzyme uses to produce a detectable reaction product. For example, when the detectable agent horseradish peroxidase is present the addition of hydrogen peroxide and diaminobenzidine leads to a colored reaction product, which is detectable. An antibody may also be derivatized with biotin, and detected through indirect measurement of avidin or streptavidin binding.
[0318] In one embodiment, the antibody is conjugated to an imaging agent. Examples of imaging agents that may be used in the compositions and methods described herein include, but are not limited to, a radiolabel (e.g., indium), an enzyme, a fluorescent label, a luminescent label, a bioluminescent label, a magnetic label, and biotin.
[0319] In one embodiment, the antibodies or ADCs are linked to a radiolabel, such as, but not limited to, indium (.sup.111In). .sup.111Indium may be used to label the antibodies and ADCs described herein for use in identifying ILT3 positive tumors. In a certain embodiment, anti-ILT3 antibodies (or ADCs) described herein are labeled with .sup.111I via a bifunctional chelator which is a bifunctional cyclohexyl diethylenetriaminepentaacetic acid (DTPA) chelate (see U.S. Pat. Nos. 5,124,471; 5,434,287; and 5,286,850, each of which is incorporated herein by reference).
[0320] Another embodiment of the disclosure provides a glycosylated binding protein wherein the anti-ILT3 antibody or antigen binding portion thereof comprises one or more carbohydrate residues. Nascent in vivo protein production may undergo further processing, known as post-translational modification. In particular, sugar (glycosyl) residues may be added enzymatically, a process known as glycosylation. The resulting proteins bearing covalently linked oligosaccharide side chains are known as glycosylated proteins or glycoproteins. Antibodies are glycoproteins with one or more carbohydrate residues in the Fc domain, as well as the variable domain. Carbohydrate residues in the Fc domain have important effect on the effector function of the Fc domain, with minimal effect on antigen binding or half-life of the antibody (R. Jefferis, Biotechnol. Prog. 21 (2005), pp. 11-16). In contrast, glycosylation of the variable domain may have an effect on the antigen binding activity of the antibody. Glycosylation in the variable domain may have a negative effect on antibody binding affinity, likely due to steric hindrance (Co, M. S., et al., Mol. Immunol. (1993) 30:1361-1367), or result in increased affinity for the antigen (Wallick, S. C., et al., Exp. Med. (1988) 168:1099-1109; Wright, A., et al., EMBO J. (1991) 10:2717-2723).
[0321] One aspect of the disclosure is directed to generating glycosylation site mutants in which the O- or N-linked glycosylation site of the binding protein has been mutated. One skilled in the art can generate such mutants using standard well-known technologies. Glycosylation site mutants that retain the biological activity, but have increased or decreased binding activity, are another object of the disclosure.
[0322] In still another embodiment, the glycosylation of the anti-ILT3 antibody or antigen binding portion is modified. For example, an aglycoslated antibody can be made (i.e., the antibody lacks glycosylation). Glycosylation can be altered to, for example, increase the affinity of the antibody for antigen. Such carbohydrate modifications can be accomplished by, for example, altering one or more sites of glycosylation within the antibody sequence. For example, one or more amino acid substitutions can be made that result in elimination of one or more variable region glycosylation sites to thereby eliminate glycosylation at that site. Such aglycosylation may increase the affinity of the antibody for antigen. Such an approach is described in further detail in PCT Publication WO2003016466A2, and U.S. Pat. Nos. 5,714,350 and 6,350,861, each of which is incorporated herein by reference in its entirety.
[0323] Additionally or alternatively, a modified anti-ILT3 antibody can be made that has an altered type of glycosylation, such as a hypofucosylated antibody having reduced amounts of fucosyl residues or an antibody having increased bisecting GlcNAc structures. Such altered glycosylation patterns have been demonstrated to increase the ADCC ability of antibodies. Such carbohydrate modifications can be accomplished by, for example, expressing the antibody in a host cell with altered glycosylation machinery. Cells with altered glycosylation machinery have been described in the art and can be used as host cells in which to express recombinant antibodies to thereby produce an antibody with altered glycosylation. See, for example, Shields, R. L. et al. (2002) J. Biol. Chem. 277:26733-26740; Umana et al. (1999) Nat. Biotech. 17:176-1, as well as, European Patent No: EP 1,176,195; PCT Publications WO 03/035835; WO 99/54342 80, each of which is incorporated herein by reference in its entirety.
[0324] Protein glycosylation depends on the amino acid sequence of the protein of interest, as well as the host cell in which the protein is expressed. Different organisms may produce different glycosylation enzymes (e.g., glycosyltransferases and glycosidases), and have different substrates (nucleotide sugars) available. Due to such factors, protein glycosylation pattern, and composition of glycosyl residues, may differ depending on the host system in which the particular protein is expressed. Glycosyl residues useful may include, but are not limited to, glucose, galactose, mannose, fucose, n-acetylglucosamine and sialic acid. Preferably the glycosylated binding protein comprises glycosyl residues such that the glycosylation pattern is human.
[0325] Differing protein glycosylation may result in differing protein characteristics. For instance, the efficacy of a therapeutic protein produced in a microorganism host, such as yeast, and glycosylated utilizing the yeast endogenous pathway may be reduced compared to that of the same protein expressed in a mammalian cell, such as a CHO cell line. Such glycoproteins may also be immunogenic in humans and show reduced half-life in vivo after administration. Specific receptors in humans and other animals may recognize specific glycosyl residues and promote the rapid clearance of the protein from the bloodstream. Other adverse effects may include changes in protein folding, solubility, susceptibility to proteases, trafficking, transport, compartmentalization, secretion, recognition by other proteins or factors, antigenicity, or allergenicity. Accordingly, a practitioner may prefer a therapeutic protein with a specific composition and pattern of glycosylation, for example glycosylation composition and pattern identical, or at least similar, to that produced in human cells or in the species-specific cells of the intended subject animal.
[0326] Expressing glycosylated proteins different from that of a host cell may be achieved by genetically modifying the host cell to express heterologous glycosylation enzymes. Using recombinant techniques, a practitioner may generate antibodies or antigen binding portions thereof exhibiting human protein glycosylation. For example, yeast strains have been genetically modified to express non-naturally occurring glycosylation enzymes such that glycosylated proteins (glycoproteins) produced in these yeast strains exhibit protein glycosylation identical to that of animal cells, especially human cells (U.S. patent Publication Nos. 20040018590 and 20020137134 and PCT publication WO2005100584 A2).
[0327] Antibodies may be produced by any of a number of techniques. For example, expression from host cells, wherein expression vector(s) encoding the heavy and light chains is (are) transfected into a host cell by standard techniques. The various forms of the term “transfection” are intended to encompass a wide variety of techniques commonly used for the introduction of exogenous DNA into a prokaryotic or eukaryotic host cell, e.g., electroporation, calcium-phosphate precipitation, DEAE-dextran transfection and the like. Although it is possible to express antibodies in either prokaryotic or eukaryotic host cells, expression of antibodies in eukaryotic cells is preferable, and most preferable in mammalian host cells, because such eukaryotic cells (and in particular mammalian cells) are more likely than prokaryotic cells to assemble and secrete a properly folded and immunologically active antibody.
[0328] Preferred mammalian host cells for expressing the recombinant antibodies disclosed herein include Chinese Hamster Ovary (CHO cells) (including dhfr− CHO cells, described in Urlaub and Chasin, (1980) Proc. Natl. Acad. Sci. USA 77:4216-4220, used with a DHFR selectable marker, e.g., as described in R. J. Kaufman and P. A. Sharp (1982) Mol. Biol. 159:601-621), NSO myeloma cells, COS cells and SP2 cells. When recombinant expression vectors encoding antibody genes are introduced into mammalian host cells, the antibodies are produced by culturing the host cells for a period of time sufficient to allow for expression of the antibody in the host cells or, more preferably, secretion of the antibody into the culture medium in which the host cells are grown. Antibodies can be recovered from the culture medium using standard protein purification methods.
[0329] Host cells can also be used to produce functional antibody fragments, such as Fab fragments or scFv molecules. It will be understood that variations on the above procedure are within the scope of the disclosure. For example, it may be desirable to transfect a host cell with DNA encoding functional fragments of either the light chain and/or the heavy chain of an antibody. Recombinant DNA technology may also be used to remove some, or all, of the DNA encoding either or both of the light and heavy chains that is not necessary for binding to the antigens of interest. The molecules expressed from such truncated DNA molecules are also encompassed by the antibodies of the disclosure. In addition, bifunctional antibodies may be produced in which one heavy and one light chain are an antibody of the disclosure and the other heavy and light chain are specific for an antigen other than the antigens of interest by crosslinking an antibody of the disclosure to a second antibody by standard chemical crosslinking methods.
[0330] In a preferred system for recombinant expression of an antibody, or antigen binding portion thereof, a recombinant expression vector encoding both the antibody heavy chain and the antibody light chain is introduced into dhfr− CHO cells by calcium phosphate-mediated transfection. Within the recombinant expression vector, the antibody heavy and light chain genes are each operatively linked to CMV enhancer/AdMLP promoter regulatory elements to drive high levels of transcription of the genes. The recombinant expression vector also carries a DHFR gene, which allows for selection of CHO cells that have been transfected with the vector using methotrexate selection/amplification. The selected transformant host cells are cultured to allow for expression of the antibody heavy and light chains and intact antibody is recovered from the culture medium. Standard molecular biology techniques are used to prepare the recombinant expression vector, transfect the host cells, select for transformants, culture the host cells and recover the antibody from the culture medium. Still further the disclosure provides a method of synthesizing a recombinant antibody by culturing a host cell in a suitable culture medium until a recombinant antibody is synthesized. Recombinant antibodies may be produced using nucleic acid molecules corresponding to the amino acid sequences disclosed herein. In one embodiment, the nucleic acid molecules set forth in SEQ ID NOs: 111-148 are used in the production of a recombinant antibody. The method can further comprise isolating the recombinant antibody from the culture medium.
III. Anti-ILT3 Antibody Drug Conjugates (ADCs)
[0331] Anti-ILT3 antibodies described herein may be conjugated to a drug moiety to form an anti-ILT3 Antibody Drug Conjugate (ADC). Antibody-drug conjugates (ADCs) may increase the therapeutic efficacy of antibodies in treating disease, e.g., cancer, due to the ability of the ADC to selectively deliver one or more drug moiety(s) to target tissues or cells, e.g., ILT3 expressing tumors or ILT3 expressing cells. Thus, in certain embodiments, the disclosure provides anti-ILT3 ADCs for therapeutic use, e.g., treatment of cancer.
[0332] Anti-ILT3 ADCs comprise an anti-ILT3 antibody, i.e., an antibody that specifically binds to ILT3, linked to one or more drug moieties. The specificity of the ADC is defined by the specificity of the antibody, i.e., anti-ILT3. In one embodiment, an anti-ILT3 antibody is linked to one or more cytotoxic drug(s) which is delivered internally to a cancer cell expressing ILT3.
[0333] Examples of drugs that may be used in the anti-ILT3 ADCs are provided below, as are linkers that may be used to conjugate the antibody and the one or more drug(s). The terms “drug,” “agent,” and “drug moiety” are used interchangeably herein. The terms “linked” and “conjugated” are also used interchangeably herein and indicate that the antibody and moiety are covalently linked.
[0334] In some embodiments, the ADC has the following formula (formula I):
Ab-(L-D).sub.n (I)
wherein Ab an anti-ILT3 antibody described herein, and (L-D) is a Linker-Drug moiety. The Linker-Drug moiety is made of L- which is a Linker, and -D, which is a drug moiety having, for example, cytostatic, cytotoxic, or otherwise therapeutic activity against a target cell, e.g., a cell expressing ILT3; and n is an integer from 1 to 20. In some embodiments, n ranges from 1 to 8, 1 to 7, 1 to 6, 1 to 5, 1 to 4, 1 to 3, 1 to 2, or is 1. The DAR of an ADC is equivalent to the “n” referred to in Formula I. Additional details regarding drugs (D of Formula I) and linkers (L of Formula I) that may be used in the ADCs, as well as alternative ADC structures, are described below.
A. Anti-ILT3 ADCs: Exemplary Drugs for Conjugation
[0335] Anti-ILT3 antibodies may be used in ADCs to target one or more drug(s) to a cell of interest, e.g., a cell expressing ILT3. The anti-ILT3 ADCs disclosed herein provide a targeted therapy that may, for example, reduce the side effects often seen with anti-cancer therapies, as the one or more drug(s) is delivered to a specific cell. In one embodiment, the drug used in an ADC is saporin. In another embodiment, the drug used in an ADC is dacarbazine. In another embodiment, the drug used in an ADC is carboplatin.
[0336] Examples of drugs that may be used in ADCs, i.e., drugs that may be conjugated to the anti-ILT3 antibodies, are provided below, and include mitotic inhibitors, antitumor antibiotics, immunomodulating agents, gene therapy vectors, alkylating agents, antiangiogenic agents, antimetabolites, boron-containing agents, chemoprotective agents, hormone agents, glucocorticoids, photoactive therapeutic agents, oligonucleotides, radioactive isotopes, radiosensitizers, topoisomerase inhibitors, tyrosine kinase inhibitors, and combinations thereof.
1. Mitotic Inhibitors
[0337] In one aspect, anti-ILT3 antibodies may be conjugated to one or more mitotic inhibitor(s) to form an ADC for the treatment of cancer. The term “mitotic inhibitor”, as used herein, refers to a cytotoxic and/or therapeutic agent that blocks mitosis or cell division, a biological process particularly important to cancer cells. A mitotic inhibitor disrupts microtubules such that cell division is prevented, often by effecting microtubule polymerization (e.g., inhibiting microtubule polymerization) or microtubule depolymerization (e.g., stabilizing the microtubule cytoskeleton against depolymrization). Thus, in one embodiment, an anti-ILT3 antibody of the invention is conjugated to one or more mitotic inhibitor(s) that disrupts microtubule formation by inhibiting tubulin polymerization. In another embodiment, an anti-ILT3 antibody of the invention is conjugated to one or more mitotic inhibitor(s) that stabilizes the microtubule cytoskeleton from deploymerization. In one embodiment, the mitotic inhibitor used in the ADCs of the invention is Ixempra (ixabepilone). Examples of mitotic inhibitors that may be used in the anti-ILT3 ADCs of the invention are provided below. Included in the genus of mitotic inhibitors are auristatins, described below.
a. Dolastatins
[0338] The anti-ILT3 antibodies of the invention may be conjugated to at least one dolastatin to form an ADC. Dolastatins are short peptidic compounds isolated from the Indian Ocean sea hare Dolabella auricularia (see Pettit et al., J. Am. Chem. Soc., 1976, 98, 4677). Examples of dolastatins include dolastatin 10 and dolatstin 15. Dolastatin 15, a seven-subunit depsipeptide derived from Dolabella auricularia, and is a potent antimitotic agent structurally related to the antitubulin agent dolastatin 10, a five-subunit peptide obtained from the same organism. Thus, in one embodiment, the anti-ILT3 ADC of the invention comprises an anti-ILT3 antibody, as described herein, and at least one dolastatin. Auristatins are synthetic derivatives of dolastatin 10.
b. Auristatins
[0339] Anti-ILT3 antibodies may be conjugated to at least one auristatin. Auristatins represent a group of dolastatin analogs that have generally been shown to possess anticancer activity by interfering with microtubule dynamics and GTP hydrolysis, thereby inhibiting cellular division. For example, Auristatin E (U.S. Pat. No. 5,635,483) is a synthetic analogue of the marine natural product dolastatin 10, a compound that inhibits tubulin polymerization by binding to the same site on tubulin as the anticancer drug vincristine (G. R. Pettit, Prog. Chem. Org. Nat. Prod, 70: 1-79 (1997)). Dolastatin 10, auristatin PE, and auristatin E are linear peptides having four amino acids, three of which are unique to the dolastatin class of compounds. Exemplary embodiments of the auristatin subclass of mitotic inhibitors include, but are not limited to, monomethyl auristatin D (MMAD or auristatin D derivative), monomethyl auristatin E (MMAE or auristatin E derivative), monomethyl auristatin F (MMAF or auristatin F derivative), auristatin F phenylenediamine (AFP), auristatin EB (AEB), auristatin EFP (AEFP), and 5-benzoylvaleric acid-AE ester (AEVB). The synthesis and structure of auristatin derivatives are described in U.S. Patent Application Publication Nos. 2003-0083263, 2005-0238649 and 2005-0009751; International Patent Publication No. WO 04/010957, International Patent Publication No. WO 02/088172, and U.S. Pat. Nos. 6,323,315; 6,239,104; 6,034,065; 5,780,588; 5,665,860; 5,663,149; 5,635,483; 5,599,902; 5,554,725; 5,530,097; 5,521,284; 5,504,191; 5,410,024; 5,138,036; 5,076,973; 4,986,988; 4,978,744; 4,879,278; 4,816,444; and 4,486,414, each of which is incorporated by reference herein.
[0340] In one embodiment, anti-ILT3 antibodies are conjugated to at least one MMAE (mono-methyl auristatin E). Monomethyl auristatin E (MMAE, vedotin) inhibits cell division by blocking the polymerization of tubulin. Because of its super toxicity, it also cannot be used as a drug itself. In recent cancer therapy developments, it is linked to a monoclonal antibody (mAb) that recognizes a specific marker expression in cancer cells and directs MMAE to the cancer cells. In one embodiment, the linker linking MMAE to the anti-ILT3 antibody is stable in extracellular fluid (i.e., the medium or environment that is external to cells), but is cleaved by cathepsin once the ADC has bound to the specific cancer cell antigen and entered the cancer cell, thus releasing the toxic MMAE and activating the potent anti-mitotic mechanism.
[0341] The structure of MMAE is provided below.
##STR00001##
[0342] In one embodiment, the antibody is coupled to a single drug and, therefore, has a DAR of 1. In certain embodiments, the ADC will have a DAR of 2 to 8, or, alternatively, 2 to 4.
c. Maytansinoids
[0343] The anti-ILT3 antibodies of the invention may be conjugated to at least one maytansinoid to form an ADC. Maytansinoids are potent antitumor agents that were originally isolated from members of the higher plant families Celastraceae, Rhamnaceae, and Euphorbiaceae, as well as some species of mosses (Kupchan et al, J. Am. Chem. Soc. 94:1354-1356 [1972]; Wani et al, J. Chem. Soc. Chem. Commun. 390: [1973]; Powell et al, J. Nat. Prod. 46:660-666 [1983]; Sakai et al, J. Nat. Prod. 51:845-850 [1988]; and Suwanborirux et al, Experientia 46:117-120 [1990]). Evidence suggests that maytansinoids inhibit mitosis by inhibiting polymerization of the microtubule protein tubulin, thereby preventing formation of microtubules (see, e.g., U.S. Pat. No. 6,441,163 and Remillard et al., Science, 189, 1002-1005 (1975)). Maytansinoids have been shown to inhibit tumor cell growth in vitro using cell culture models, and in vivo using laboratory animal systems. Moreover, the cytotoxicity of maytansinoids is 1,000-fold greater than conventional chemotherapeutic agents, such as, for example, methotrexate, daunorubicin, and vincristine (see, e.g., U.S. Pat. No. 5,208,020).
[0344] Maytansinoids to include maytansine, maytansinol, C-3 esters of maytansinol, and other maytansinol analogues and derivatives (see, e.g., U.S. Pat. Nos. 5,208,020 and 6,441,163, each of which is incorporated by reference herein). C-3 esters of maytansinol can be naturally occurring or synthetically derived. Moreover, both naturally occurring and synthetic C-3 maytansinol esters can be classified as a C-3 ester with simple carboxylic acids, or a C-3 ester with derivatives of N-methyl-L-alanine, the latter being more cytotoxic than the former. Synthetic maytansinoid analogues are described in, for example, Kupchan et al., J. Med. Chem., 21, 31-37 (1978).
[0345] Suitable maytansinoids for use in ADCs of the invention can be isolated from natural sources, synthetically produced, or semi-synthetically produced. Moreover, the maytansinoid can be modified in any suitable manner, so long as sufficient cytotoxicity is preserved in the ultimate conjugate molecule. In this regard, maytansinoids lack suitable functional groups to which antibodies can be linked. A linking moiety desirably is utilized to link the maytansinoid to the antibody to form the conjugate, and is described in more detail in the linker section below. The structure of an exemplary maytansinoid, mertansine (DM1), is provided below.
##STR00002##
[0346] Representative examples of maytansinoids include, but are not limited, to DM1 (N.sup.2′-deacetyl-N.sup.2′-(3-mercapto-1-oxopropyl)-maytansine; also referred to as mertansine, drug maytansinoid 1; ImmunoGen, Inc.; see also Chari et al. (1992) Cancer Res 52:127), DM2, DM3 (N.sup.2′-deacetyl-N.sup.2′-(4-mercapto-1-oxopentyl)-maytansine), DM4 (4-methyl-4-mercapto-1-oxopentyl)-maytansine), and maytansinol (a synthetic maytansinoid analog). Other examples of maytansinoids are described in U.S. Pat. No. 8,142,784, incorporated by reference herein.
[0347] Ansamitocins are a group of maytansinoid antibiotics that have been isolated from various bacterial sources. These compounds have potent antitumor activities. Representative examples include, but are not limited to ansamitocin P1, ansamitocin P2, ansamitocin P3, and ansamitocin P4. In one embodiment of the invention, an anti-ILT3 antibody is conjugated to at least one DM1.
[0348] In one embodiment, an anti-ILT3 antibody is conjugated to at least one DM2. In one embodiment, an anti-ILT3 antibody is conjugated to at least one DM3. In one embodiment, an anti-ILT3 antibody is conjugated to at least one DM4.
2. Antitumor Antibiotics
[0349] Anti-ILT3 antibodies may be conjugated to one or more antitumor antibiotic(s) for the treatment of cancer. As used herein, the term “antitumor antibiotic” means an antineoplastic drug that blocks cell growth by interfering with DNA and is made from a microorganism. Often, antitumor antibiotics either break up DNA strands or slow down or stop DNA synthesis. Examples of antitumor antibiotics that may be included in the anti-ILT3 ADCs include, but are not limited to, actinomycines (e.g., pyrrolo[2,1-c][1,4]benzodiazepines), anthracyclines, calicheamicins, and duocarmycins. In addition to the foregoing, additional antitumor antibiotics that may be used in the anti-ILT3 ADCs include bleomycin (Blenoxane, Bristol-Myers Squibb), mitomycin, and plicamycin (also known as mithramycin).
3. Immunomodulating Agents
[0350] In one aspect, anti-ILT3 antibodies may be conjugated to at least one immunomodulating agent. As used herein, the term “immunomodulating agent” refers to an agent that can stimulate or modify an immune response. In one embodiment, an immunomodulating agent is an immunostimuator which enhances a subject's immune response. In another embodiment, an immunomodulating agent is an immunosuppressant which prevents or decreases a subject's immune response. An immunomodulating agent may modulate myeloid cells (monocytes, macrophages, dendritic cells, megakaryocytes and granulocytes) or lymphoid cells (T cells, B cells and natural killer (NK) cells) and any further differentiated cell thereof. Representative examples include, but are not limited to, bacillus calmette-guerin (BCG) and levamisole (Ergamisol). Other examples of immunomodulating agents that may be used in the ADCs include, but are not limited to, cancer vaccines, and cytokines.
[0351] As used herein, the term “cancer vaccine” refers to a composition (e.g., a tumor antigen and a cytokine) that elicits a tumor-specific immune response. The response is elicited from the subject's own immune system by administering the cancer vaccine, or, in the case of the instant disclosure, administering an ADC comprising an anti-ILT3 antibody and a cancer vaccine. In preferred embodiments, the immune response results in the eradication of tumor cells in the body (e.g., primary or metastatic tumor cells). The use of cancer vaccines generally involves the administration of a particular antigen or group of antigens that are, for example, present on the surface a particular cancer cell, or present on the surface of a particular infectious agent shown to facilitate cancer formation. In some embodiments, the use of cancer vaccines is for prophylactic purposes, while in other embodiments, the use is for therapeutic purposes. Non-limiting examples of cancer vaccines that may be used in the anti-ILT3 ADCs include, recombinant bivalent human papillomavirus (HPV) vaccine types 16 and 18 vaccine (Cervarix, GlaxoSmithKline), recombinant quadrivalent human papillomavirus (HPV) types 6, 11, 16, and 18 vaccine (Gardasil, Merck & Company), and sipuleucel-T (Provenge, Dendreon). Thus, in one embodiment, the anti-ILT3 antibody is conjugated to at least one cancer vaccine that is either an immunostimulator or is an immunosuppressant.
[0352] The anti-ILT3 antibodies may be conjugated to at least one cytokine. The term “cytokine” generally refers to proteins released by one cell population which act on another cell as intercellular mediators. Cytokines directly stimulate immune effector cells and stromal cells at the tumor site and enhance tumor cell recognition by cytotoxic effector cells (Lee and Margolin (2011) Cancers 3:3856). Numerous animal tumor model studies have demonstrated that cytokines have broad anti-tumor activity and this has been translated into a number of cytokine-based approaches for cancer therapy (Lee and Margoli, supra). Recent years have seen a number of cytokines, including GM-CSF, IL-7, IL-12, IL-15, IL-18 and IL-21, enter clinical trials for patients with advanced cancer (Lee and Margoli, supra).
[0353] Examples of cytokines that may be used in the ADCs include, but are not limited to, parathyroid hormone; thyroxine; insulin; proinsulin; relaxin; prorelaxin; glycoprotein hormones such as follicle stimulating hormone (FSH), thyroid stimulating hormone (TSH), and luteinizing hormone (LH); hepatic growth factor; fibroblast growth factor; prolactin; placental lactogen; tumor necrosis factor; mullerian-inhibiting substance; mouse gonadotropin-associated peptide; inhibin; activin; vascular endothelial growth factor; integrin; thrombopoietin (TPO); nerve growth factors such as NGF; platelet-growth factor; transforming growth factors (TGFs); insulin-like growth factor-I and -II; erythropoietin (EPO); osteoinductive factors; interferons such as interferon α, β, and γ, colony stimulating factors (CSFs); granulocyte-macrophage-C-SF (GM-CSF); and granulocyte-CSF (G-CSF); interleukins (ILs) such as IL-1, IL-1a, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-11, IL-12; tumor necrosis factor; and other polypeptide factors including LIF and kit ligand (KL). As used herein, the term cytokine includes proteins from natural sources or from recombinant cell culture and biologically active equivalents of the native sequence cytokines. Thus, in one embodiment, the disclosure provides an ADC comprising an anti-ILT3 antibody described herein and a cytokine.
[0354] The anti-ILT3 antibodies may be conjugated to at least one colony stimulating factor (CSF). Colony stimulating factors (CSFs) are growth factors that assist the bone marrow in making red blood cells. Because some cancer treatments (e.g., chemotherapy) can affect white blood cells (which help fight infection), colony-stimulating factors may be introduced to help support white blood cell levels and strengthen the immune system. Colony-stimulating factors may also be used following a bone marrow transplant to help the new marrow start producing white blood cells. Representative examples of CSFs that may be used in the anti-ILT3 ADCs include, but are not limited to erythropoietin (Epoetin), filgrastim (Neopogen (also known as granulocyte colony-stimulating factor (G-CSF); Amgen, Inc.), sargramostim (leukin (granulocyte-macrophage colony-stimulating factor and GM-CSF); Genzyme Corporation), promegapoietin, and Oprelvekin (recombinant IL-11; Pfizer, Inc.). Thus, in one embodiment, an ADC may comprise an anti-ILT3 antibody described herein and a CSF.
4. Alkylating Agents
[0355] The anti-ILT3 antibodies may be conjugated to one or more alkylating agent(s). Alkylating agents are a class of antineoplastic compounds that attaches an alkyl group to DNA. Examples of alkylating agents that may be used in the ADCs include, but are not limited to, pyrrolobenzodiazepines or PBDs, alkyl sulfonates, ethylenimimes, methylamine derivatives, epoxides, nitrogen mustards, nitrosoureas, triazines and hydrazines.
DNA Alkylating Agents
[0356] The term “DNA alkylating agent”, as used herein, includes a family of DNA alkylating agents including indolino-benzodiazepines (IGNs). IGNs represent a chemical class of cytotoxic molecules with high in vitro potency (IC.sub.50 values in the low pmol/L range) toward cancer cells. Examples of IGN DNA alkylating agents that can be used as a cytotoxic payload in an ADC are described in Miller et al. (2016) Molecular Cancer Therapeutics, 15(8)). The IGN compounds described in Miller et al. bind to the minor groove of DNA followed by covalent reaction of guanine residues with the two imine functionalities in the molecule resulting in cross-linking of DNA. The structure of an exemplary IGN is provided below.
##STR00003##
[0357] DNA alkylating agents also include pyrrolobenzodiazepines or PBDs, a class of natural products with antibiotic or anti-tumor properties, which are produced by various actinomycetes (a broad group of bacteria that form thread-like filaments in the soil). PBDs are a family of sequence-selective DNA minor-groove binding agents that form a covalent aminal bond between their C11-position and the C2-NH2 groups of guanine bases. As a class of DNA-crosslinking agents, they are significantly more potent than systemic chemotherapeutic drugs. As DNA minor groove binding agents, pyrrolobenzodiazepines bind and cross-link specific sites of DNA of the cancer cell, blocking cancer cell division without distorting its DNA helix, thus potentially avoiding the common phenomenon of emergent drug resistance.
[0358] The first example of a PBD monomer, the natural product anthramycin, was discovered in the 1960s, and the best known PBD dimer, SJG-136 (also known as SG2000, NSC 694501 or BN2629), was synthesized in the 1990s and has recently completed Phase II clinical trials in patients with leukaemia and ovarian cancer. Other agents belonging to the pyrrolo(1,4)benzodiazepine antibiotic group include abbeymycin, chicamycin, DC-81, mazethramycin, neothramycins A and B, porothramycin prothracarcin, sibanomicin (DC-102) sibiromycin and tomamycin.
[0359] Dimeric pyrrolobenzodiazepines can be used as the cytotoxic drug payloads in antibody-drug conjugates, including vadastuximab talirine (Seattle Genetics), which is being developed for the treatment of patients acute myeloid leukemia (AML), and rovalpituzumab tesirine. Kolltan Pharmaceuticals and Genentech/Roche are developing antibody-drug conjugates with pyrrolobenzodiazepine as the cytotoxic drug payload. Kolltan Pharmaceuticals' preclinical agent, KTN0182A, is an anti-KIT, PBD-containing antibody-drug conjugate which demonstrated potent anti-tumor activity in vitro and in vivo against a broad range of tumor types. ADCs conjugated with PBD are also described in, for example, Rios-Doria, J. et al. (2017) Cancer Res. 77(10); 2686 and Mantaj, J. et al. (2017) Angew Chem Int Ed Engl. January 9; 56(2): 462-488, the contents of which are incorporated herein by reference.
5. Antiangiogenic Agents
[0360] In one aspect, the anti-ILT3 antibodies described herein are conjugated to at least one antiangiogenic agent. Antiangiogenic agents inhibit the growth of new blood vessels. Antiangiogenic agents exert their effects in a variety of ways. In some embodiments, these agents interfere with the ability of a growth factor to reach its target. For example, vascular endothelial growth factor (VEGF) is one of the primary proteins involved in initiating angiogenesis by binding to particular receptors on a cell surface. Thus, certain antiangiogenic agents, that prevent the interaction of VEGF with its cognate receptor, prevent VEGF from initiating angiogenesis. In other embodiments, these agents interfere with intracellular signaling cascades. For example, once a particular receptor on a cell surface has been triggered, a cascade of other chemical signals is initiated to promote the growth of blood vessels. Thus, certain enzymes, for example, some tyrosine kinases, that are known to facilitate intracellular signaling cascades that contribute to, for example, cell proliferation, are targets for cancer treatment. In other embodiments, these agents interfere with intercellular signaling cascades. Yet, in other embodiments, these agents disable specific targets that activate and promote cell growth or by directly interfering with the growth of blood vessel cells. Angiogenesis inhibitory properties have been discovered in more than 300 substances with numerous direct and indirect inhibitory effects.
[0361] Representative examples of antiangiogenic agents that may be used in the ADCs include, but are not limited to, angiostatin, ABX EGF, C1-1033, PKI-166, EGF vaccine, EKB-569, GW2016, ICR-62, EMD 55900, CP358, PD153035, AG1478, IMC-C225 (Erbitux, ZD1839 (Iressa), OSI-774, Erlotinib (tarceva), angiostatin, arrestin, endostatin, BAY 12-9566 and w/fluorouracil or doxorubicin, canstatin, carboxyamidotriozole and with paclitaxel, EMD121974, S-24, vitaxin, dimethylxanthenone acetic acid, IM862, Interleukin-12, Interleukin-2, NM-3, HuMV833, PTK787, RhuMab, angiozyme (ribozyme), IMC-1C11, Neovastat, marimstat, prinomastat, BMS-275291, COL-3, MM1270, SU101, SU6668, SU11248, SU5416, with paclitaxel, with gemcitabine and cisplatin, and with irinotecan and cisplatin and with radiation, tecogalan, temozolomide and PEG interferon α1b, tetrathiomolybdate, TNP-470, thalidomide, CC-5013 and with taxotere, tumstatin, 2-methoxyestradiol, VEGF trap, mTOR inhibitors (deforolimus, everolimus (Afinitor, Novartis Pharmaceutical Corporation), and temsirolimus (Torisel, Pfizer, Inc.)), tyrosine kinase inhibitors (e.g., erlotinib (Tarceva, Genentech, Inc.), imatinib (Gleevec, Novartis Pharmaceutical Corporation), gefitinib (Iressa, AstraZeneca Pharmaceuticals), dasatinib (Sprycel, Brystol-Myers Squibb), sunitinib (Sutent, Pfizer, Inc.), nilotinib (Tasigna, Novartis Pharmaceutical Corporation), lapatinib (Tykerb, GlaxoSmithKline Pharmaceuticals), sorafenib (Nexavar, Bayer and Onyx), phosphoinositide 3-kinases (PI3K).
6. Antimetabolites
[0362] The anti-ILT3 antibodies may be conjugated to at least one antimetabolite. Antimetabolites are types of chemotherapy treatments that are very similar to normal substances within the cell. When the cells incorporate an antimetabolite into the cellular metabolism, the result is negative for the cell, e.g., the cell is unable to divide. Antimetabolites are classified according to the substances with which they interfere. Examples of antimetabolies that may be used in the ADCs include, but are not limited to, a folic acid antagonist (e.g., methotrexate), a pyrimidine antagonist (e.g., 5-Fluorouracil, Foxuridine, Cytarabine, Capecitabine, and Gemcitabine), a purine antagonist (e.g., 6-Mercaptopurine and 6-Thioguanine) and an adenosine deaminase inhibitor (e.g., Cladribine, Fludarabine, Nelarabine and Pentostatin), as described in more detail below.
7. Boron-Containing Agents
[0363] The anti-ILT3 antibody may be conjugated to at least one boron containing agent. Boron-containing agents comprise a class of cancer therapeutic compounds which interfere with cell proliferation. Representative examples of boron containing agents include, but are not limited, to borophycin and bortezomib (Velcade, Millenium Pharmaceuticals).
8. Chemoprotective Agents
[0364] The anti-ILT3 antibodies may be conjugated to at least one chemoprotective agent. Chemoprotective drugs are a class of compounds, which help protect the body against specific toxic effects of chemotherapy. Chemoprotective agents may be administered with various chemotherapies in order to protect healthy cells from the toxic effects of chemotherapy drugs, while simultaneously allowing the cancer cells to be treated with the administered chemotherapeutic. Representative chemoprotective agents include, but are not limited to amifostine (Ethyol, Medimmune, Inc.), which is used to reduce renal toxicity associated with cumulative doses of cisplatin, dexrazoxane (Totect, Apricus Pharma; Zinecard), for the treatment of extravasation caused by the administration of anthracycline (Totect), and for the treatment of cardiac-related complications caused by the administration of the antitumor antibiotic doxorubicin (Zinecard), and mesna (Mesnex, Bristol-Myers Squibb), which is used to prevent hemorrhagic cystitis during chemotherapy treatment with ifocfamide.
9. Photoactive Therapeutic Agents
[0365] The anti-ILT3 antibodies may be conjugated to at least one photoactive therapeutic agent. Photoactive therapeutic agents include compounds that can be deployed to kill treated cells upon exposure to electromagnetic radiation of a particular wavelength. Therapeutically relevant compounds absorb electromagnetic radiation at wavelengths which penetrate tissue. In preferred embodiments, the compound is administered in a non-toxic form that is capable of producing a photochemical effect that is toxic to cells or tissue upon sufficient activation. In other preferred embodiments, these compounds are retained by cancerous tissue and are readily cleared from normal tissues. Non-limiting examples include various chromagens and dyes.
10. Radionuclide Agents (Radioactive Isotopes)
[0366] The anti-ILT3 antibodies may be conjugated to at least one radionuclide agent. Radionuclide agents comprise agents that are characterized by an unstable nucleus that is capable of undergoing radioactive decay. The basis for successful radionuclide treatment depends on sufficient concentration and prolonged retention of the radionuclide by the cancer cell. Other factors to consider include the radionuclide half-life, the energy of the emitted particles, and the maximum range that the emitted particle can travel. In preferred embodiments, the therapeutic agent is a radionuclide selected from the group consisting of .sup.111In, .sup.177Lu, .sup.212Bi, .sup.213Bi, .sup.211At, .sup.62Cu, .sup.64Cu, .sup.67Cu, .sup.90Y, .sup.125I, .sup.131I, .sup.32P .sup.33P, .sup.47Sc, .sup.111Ag, .sup.67Ga, .sup.142Pr, .sup.153Sm, .sup.161Tb, .sup.166Dy, .sup.166Ho, .sup.186Re, .sup.188Re, .sup.189Re, .sup.212Pb, .sup.223Ra, .sup.225Ac, .sup.59Fe, .sup.75Se, .sup.77As, .sub.89Sr, .sub.99Mo, .sub.105Rh, .sub.109Pd, .sub.143Pr, .sub.149Pm, .sub.169Er, .sub.194Ir .sub.198Au, .sub.199Au, and .sub.211Pb. Also preferred are radionuclides that substantially decay with Auger-emitting particles. For example, Co-58, Ga-67, Br-80m, Tc-99m, Rh-103m, Pt-109, In-111, Sb-119, I-125, Ho-161, Os-189m and Ir-192. Decay energies of useful beta-particle-emitting nuclides are preferably Dy-152, At-211, Bi-212, Ra-223, Rn-219, Po-215, Bi-211, Ac-225, Fr-221, At-217, Bi-213 and Fm-255. Decay energies of useful alpha-particle-emitting radionuclides are preferably 2,000-10,000 keV, more preferably 3,000-8,000 keV, and most preferably 4,000-7,000 keV. Additional potential radioisotopes of use include .sup.11C, .sup.13N, .sup.15O, .sup.75Br, .sup.198Au, .sup.224Ac, .sup.126I, .sup.133I, .sup.77Br, .sup.113mIn, .sup.95Ru, .sup.97Ru, .sup.103Ru, .sup.105Ru, .sup.107Hg, .sup.203Hg, .sup.121mTe, .sup.122mTe, .sup.125mTe, .sup.165Tm, .sup.167Tm, .sup.168Tm, .sup.197Pt .sup.109Pd, .sup.105Rh.sup.142pr, .sup.143pr, .sup.161Tb .sup.66Ho, .sup.199Au, .sup.57Co, .sup.58Co, .sup.51Cr, .sup.59Fe, .sup.75Se, .sup.201Tl, .sup.225Ac, .sup.76Br, .sup.169Yb, and the like.
11. Radiosensitizers
[0367] The anti-ILT3 antibodies may be conjugated to at least one radiosensitizer. The term “radiosensitizer,” as used herein, is defined as a molecule, preferably a low molecular weight molecule, administered to animals in therapeutically effective amounts to increase the sensitivity of the cells to be radiosensitized to electromagnetic radiation and/or to promote the treatment of diseases that are treatable with electromagnetic radiation. Radiosensitizers are agents that make cancer cells more sensitive to radiation therapy, while typically having much less of an effect on normal cells. Thus, the radiosensitizer can be used in combination with a radiolabeled antibody or ADC. The addition of the radiosensitizer can result in enhanced efficacy when compared to treatment with the radiolabeled antibody or antibody fragment alone. Radiosensitizers are described in D. M. Goldberg (ed.), Cancer Therapy with Radiolabeled Antibodies, CRC Press (1995). Examples of radiosensitizers include gemcitabine, 5-fluorouracil, taxane, and cisplatin.
[0368] Radiosensitizers may be activated by the electromagnetic radiation of X-rays. Representative examples of X-ray activated radiosensitizers include, but are not limited to, the following: metronidazole, misonidazole, desmethylmisonidazole, pimonidazole, etanidazole, nimorazole, mitomycin C, RSU 1069, SR 4233, E09, RB 6145, nicotinamide, 5-bromodeoxyuridine (BUdR), 5-iododeoxyuridine (IUdR), bromodeoxycytidine, fluorodeoxyuridine (FUdR), hydroxyurea, cisplatin, and therapeutically effective analogs and derivatives of the same. Alternatively, radiosensitizers may be activated using photodynamic therapy (PDT). Representative examples of photodynamic radiosensitizers include, but are not limited to, hematoporphyrin derivatives, Photofrin(r), benzoporphyrin derivatives, NPe6, tin etioporphyrin (SnET2), pheoborbide a, bacteriochlorophyll a, naphthalocyanines, phthalocyanines, zinc phthalocyanine, and therapeutically effective analogs and derivatives of the same.
12. Topoisomerase Inhibitors
[0369] The anti-ILT3 antibodies may be conjugated to at least one topoisomerase inhibitor. Topoisomerase inhibitors are chemotherapy agents designed to interfere with the action of topoisomerase enzymes (topoisomerase I and II), which are enzymes that control the changes in DNA structure by catalyzing then breaking and rejoining of the phosphodiester backbone of DNA strands during the normal cell cycle. Representative examples of DNA topoisomerase I inhibitors include, but are not limited to, camptothecins and its derivatives irinotecan (CPT-11, Camptosar, Pfizer, Inc.) and topotecan (Hycamtin, GlaxoSmithKline Pharmaceuticals). Representative examples of DNA topoisomerase II inhibitors include, but are not limited to, amsacrine, daunorubicin, doxotrubicin, epipodophyllotoxins, ellipticines, epirubicin, etoposide, razoxane, and teniposide.
13. Tyrosine Kinase Inhibitors
[0370] The anti-ILT3 antibodies may be conjugated to at least one tyrosine kinase inhibitor. Tyrosine kinases are enzymes within the cell that function to attach phosphate groups to the amino acid tyrosine. By blocking the ability of protein tyrosine kinases to function, tumor growth may be inhibited. Examples of tyrosine kinases that may be used on the ADCs include, but are not limited to, Axitinib, Bosutinib, Cediranib, Dasatinib, Erlotinib, Gefitinib, Imatinib, Lapatinib, Lestaurtinib, Nilotinib, Semaxanib, Sunitinib, and Vandetanib.
14. Other Agents
[0371] Examples of other agents that may be used in the ADCs include, but are not limited to, abrin (e.g. abrin A chain), alpha toxin, Aleurites fordii proteins, amatoxin, crotin, curcin, dianthin proteins, diptheria toxin (e.g. diphtheria A chain and nonbinding active fragments of diphtheria toxin), deoxyribonuclease (Dnase), gelonin, mitogellin, modeccin A chain, Momordica charantia inhibitor, neomycin, onconase, phenomycin, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), pokeweed antiviral protein, Pseudomonas endotoxin, Pseudomonas exotoxin (e.g. exotoxin A chain (from Pseudomonas aeruginosa)), restrictocin, ricin A chain, ribonuclease (Rnase), Sapaonaria officinalis inhibitor, saporin, alpha-sarcin, Staphylcoccal enterotoxin-A, tetanus toxin, cisplatin, carboplatin, and oxaliplatin (Eloxatin, Sanofi Aventis), proteasome inhibitors (e.g. PS-341 [bortezomib or Velcade]), HDAC inhibitors (vorinostat (Zolinza, Merck & Company, Inc.)), belinostat, entinostat, mocetinostat, and panobinostat), COX-2 inhibitors, substituted ureas, heat shock protein inhibitors (e.g. Geldanamycin and its numerous analogs), adrenocortical suppressants, and the tricothecenes. (See, for example, WO 93/21232). Other agents also include asparaginase (Espar, Lundbeck Inc.), hydroxyurea, levamisole, mitotane (Lysodren, Bristol-Myers Squibb), and tretinoin (Renova, Valeant Pharmaceuticals Inc.).
[0372] It should be noted that the aforementioned groups of drug moieties that may be used in the anti-ILT3 ADCs are not exclusive, in that certain examples of drugs may be found in more than one category, e.g., ansamitocins are both mitotic inhibitors and antitumor antibiotics.
[0373] All stereoisomers of the above drug moieties are contemplated for use herein, i.e. any combination of R and S configurations at the chiral carbons of D.
[0374] The above agents (i.e., naked agents not conjugated to an antibody) may also be used in combination therapies with the anti-ILT3 antibodies described herein. In one embodiment, anti-ILT3 antibodies or ADCs are used with any of the foregoing agents in a combination therapy to treat cancer, where the agent is administered prior to, at the same time as, or following administration of the anti-ILT3 antibody or ADC to the subject.
B. Anti-ILT3 ADCs: Exemplary Linkers
[0375] An anti-ILT3 ADC comprises an anti-ILT3 antibody and at least one drug(s), whereby the antibody and the at least one drug are conjugated by a linker The term “linker,” as used herein, refers to a chemical moiety that may be bifunctional or multifunctional, and is used to attach an antibody to a drug moiety. A linker may include one conjugating component or may include multiple components.
[0376] For example, the linker may include a spacer, which is a moiety that extends the drug linkage to avoid, for example, shielding the active site of the antibody or improving the solubility of the ADC. Other examples of components of linkers include a stretcher unit and an amino acid unit.
[0377] Two methods are commonly used for conjugating drugs to antibodies: alkylation of reduced interchain cysteine disulfides through an enzymatically non-cleavable maleimido or simple and cleavable disulfide linker, and acylation of lysines by cleavable linear amino acids.
[0378] In one aspect, a linker covalently attaches an antibody to a drug moiety. An ADC is prepared using a linker having reactive functionality for binding to the antibody and the drug. For example, a cysteine thiol, or an amine, e.g., N-terminus or amino acid side chain such as lysine, of the antibody may form a bond with a functional group of the linker
[0379] In one aspect, a linker has a functionality that is capable of reacting with a free cysteine present on an antibody to form a covalent bond. Nonlimiting exemplary such reactive functionalities include maleimide, haloacetamides, α-haloacetyl, activated esters such as succinimide esters, 4-nitrophenyl esters, pentafluorophenyl esters, tetrafluorophenyl esters, anhydrides, acid chlorides, sulfonyl chlorides, isocyanates, and isothiocyanates. See, e.g., the conjugation method at page 766 of Klussman, et al (2004), Bioconjugate Chemistry 15(4):765-773.
[0380] In some embodiments, a linker has a functionality that is capable of reacting with an electrophilic group present on an antibody. Exemplary such electrophilic groups include, but are not limited to, aldehyde and ketone carbonyl groups. In some embodiments, a heteroatom of the reactive functionality of the linker can react with an electrophilic group on an antibody and form a covalent bond to an antibody unit. Nonlimiting exemplary such reactive functionalities include, but are not limited to, hydrazide, oxime, amino, hydrazine, thiosemicarbazone, hydrazine carboxylate, and arylhydrazide.
[0381] Suitable linkers include, for example, cleavable and non-cleavable linkers. A linker may be a “cleavable linker,” facilitating release of a drug. Nonlimiting exemplary cleavable linkers include acid-labile linkers (e.g., comprising hydrazone), protease-sensitive (e.g., peptidase-sensitive) linkers, photolabile linkers, or disulfide-containing linkers (Chari et al., Cancer Research 52:127-131 (1992); U.S. Pat. No. 5,208,020). A cleavable linker is typically susceptible to cleavage under intracellular conditions. Suitable cleavable linkers include, for example, a peptide linker cleavable by an intracellular protease, such as lysosomal protease or an endosomal protease. In exemplary embodiments, the linker can be a dipeptide linker, such as a valine-citrulline (val-cit) or a phenylalanine-lysine (phe-lys) linker
[0382] Linkers are preferably stable extracellularly in a sufficient manner to be therapeutically effective. Before transport or delivery into a cell, the ADC is preferably stable and remains intact, i.e. the antibody remains conjugated to the drug moiety. Linkers that are stable outside the target cell may be cleaved at some efficacious rate once inside the cell. Thus, an effective linker will: (i) maintain the specific binding properties of the antibody; (ii) allow delivery, e.g., intracellular delivery, of the drug moiety; and (iii) maintain the therapeutic effect, e.g., cytotoxic effect, of a drug moiety.
[0383] In one embodiment, the linker is cleavable under intracellular conditions, such that cleavage of the linker sufficiently releases the drug from the antibody in the intracellular environment to be therapeutically effective. In some embodiments, the cleavable linker is pH-sensitive, i.e., sensitive to hydrolysis at certain pH values. Typically, the pH-sensitive linker is hydrolyzable under acidic conditions. For example, an acid-labile linker that is hydrolyzable in the lysosome (e.g., a hydrazone, semicarbazone, thiosemicarbazone, cis-aconitic amide, orthoester, acetal, ketal, or the like) can be used. (See, e.g., U.S. Pat. Nos. 5,122,368; 5,824,805; 5,622,929; Dubowchik and Walker, 1999, Pharm. Therapeutics 83:67-123; Neville et al., 1989, Biol. Chem. 264:14653-14661.) Such linkers are relatively stable under neutral pH conditions, such as those in the blood, but are unstable at below pH 5.5 or 5.0, the approximate pH of the lysosome. In certain embodiments, the hydrolyzable linker is a thioether linker (such as, e.g., a thioether attached to the therapeutic agent via an acylhydrazone bond (see, e.g., U.S. Pat. No. 5,622,929).
[0384] In other embodiments, the linker is cleavable under reducing conditions (e.g., a disulfide linker). A variety of disulfide linkers are known in the art, including, for example, those that can be formed using SATA (N-succinimidyl-5-acetylthioacetate), SPDP (N-succinimidyl-3-(2-pyridyldithio)propionate), SPDB (N-succinimidyl-3-(2-pyridyldithio)butyrate) and SMPT (N-succinimidyloxycarbonyl-alpha-methyl-alpha-(2-pyridyl-dithio)toluene), SPDB and SMPT. (See, e.g., Thorpe et al., 1987, Cancer Res. 47:5924-5931; Wawrzynczak et al., In Immunoconjugates: Antibody Conjugates in Radioimagery and Therapy of Cancer (C. W. Vogel ed., Oxford U. Press, 1987. See also U.S. Pat. No. 4,880,935.).
[0385] In some embodiments, the linker is cleavable by a cleaving agent, e.g., an enzyme, that is present in the intracellular environment (e.g., within a lysosome or endosome or caveolea). The linker can be, e.g., a peptidyl linker that is cleaved by an intracellular peptidase or protease enzyme, including, but not limited to, a lysosomal or endosomal protease. In some embodiments, the peptidyl linker is at least two amino acids long or at least three amino acids long. Cleaving agents can include cathepsins B and D and plasmin, all of which are known to hydrolyze dipeptide drug derivatives resulting in the release of active drug inside target cells (see, e.g., Dubowchik and Walker, 1999, Pharm. Therapeutics 83:67-123). Most typical are peptidyl linkers that are cleavable by enzymes that are present in ILT3-expressing cells. Examples of such linkers are described, e.g., in U.S. Pat. No. 6,214,345, incorporated herein by reference in its entirety and for all purposes. In a specific embodiment, the peptidyl linker cleavable by an intracellular protease is a Val-Cit linker or a Phe-Lys linker (see, e.g., U.S. Pat. No. 6,214,345, which describes the synthesis of doxorubicin with the val-cit linker). One advantage of using intracellular proteolytic release of the therapeutic agent is that the agent is typically attenuated when conjugated and the serum stabilities of the conjugates are typically high.
[0386] In other embodiments, the linker is a malonate linker (Johnson et al., 1995, Anticancer Res. 15:1387-93), a maleimidobenzoyl linker (Lau et al., 1995, Bioorg-Med-Chem. 3(10):1299-1304), or a 3′-N-amide analog (Lau et al., 1995, Bioorg-Med-Chem. 3(10): 1305-12).
[0387] In yet other embodiments, the linker unit is not cleavable and the drug is released, for example, by antibody degradation. See U.S. Publication No. 20050238649 incorporated by reference herein in its entirety. An ADC comprising a non-cleavable linker may be designed such that the ADC remains substantially outside the cell and interacts with certain receptors on a target cell surface such that the binding of the ADC initiates (or prevents) a particular cellular signaling pathway.
[0388] In some embodiments, the linker is substantially hydrophilic linker (e.g., PEG4Mal and sulfo-SPDB). A hydrophilic linker may be used to reduce the extent to which the drug may be pumped out of resistant cancer cells through MDR (multiple drug resistance) or functionally similar transporters.
[0389] In other embodiments, upon cleavage, the linker functions to directly or indirectly inhibit cell growth and/or cell proliferation. For example, in some embodiments, the linker, upon cleavage, can function as an intercalating agent, thereby inhibiting macromolecular biosynthesis (e.g. DNA replication, RNA transcription, and/or protein synthesis).
[0390] In other embodiments, the linker is designed to facilitate bystander killing (the killing of neighboring cells) through diffusion of the linker-drug and/or the drug alone to neighboring cells. In other, embodiments, the linker promotes cellular internalization.
[0391] The presence of a sterically hindered disulfide can increase the stability of a particular disulfide bond, enhancing the potency of the ADC. Thus, in one embodiment, the linker includes a sterically hindered disulfide linkage. A sterically hindered disulfide refers to a disulfide bond present within a particular molecular environment, wherein the environment is characterized by a particular spatial arrangement or orientation of atoms, typically within the same molecule or compound, which prevents or at least partially inhibits the reduction of the disulfide bond. Thus, the presence of bulky (or sterically hindering) chemical moieties and/or bulky amino acid side chains proximal to the disulfide bond prevents or at least partially inhibits the disulfide bond from potential interactions that would result in the reduction of the disulfide bond.
[0392] Notably, the aforementioned linker types are not mutually exclusive. For example, in one embodiment, the linker used in the anti-ILT3 ADCs described herein is a non-cleavable linker that promotes cellular internalization.
[0393] In some embodiments, the ADC has the following formula (formula I):
Ab-(L-D).sub.n (I)
or a pharmaceutically acceptable salt or solvate thereof; wherein Ab is the antibody, e.g., anti-ILT3 antibody, and (L-D) is a Linker-Drug moiety. The Linker-Drug moiety is made of L- which is a Linker, and -D, which is a drug moiety having, for example, cytostatic, cytotoxic, or otherwise therapeutic activity against a target cell, e.g., a cell expressing ILT3; and n is an integer from 1 to 20.
[0394] In some embodiments, n ranges from 1 to 8, 1 to 7, 1 to 6, 1 to 5, 1 to 4, 1 to 3, 1 to 2, or is 1.
[0395] In some embodiments, the -D moieties are the same. In yet another embodiment, the -D moieties are different.
[0396] In some embodiments, a linker component comprises an “amino acid unit.” In some such embodiments, the amino acid unit allows for cleavage of the linker by a protease, thereby facilitating release of the drug from the immunoconjugate upon exposure to intracellular proteases, such as lysosomal enzymes (Doronina et al. (2003) Nat. Biotechnol. 21:778-784). Exemplary amino acid units include, but are not limited to, dipeptides, tripeptides, tetrapeptides, and pentapeptides. Exemplary dipeptides include, but are not limited to, valine-citrulline (vc or val-cit), alanine-phenylalanine (af or ala-phe); phenylalanine-lysine (fk or phe-lys); phenylalanine-homolysine (phe-homolys); and N-methyl-valine-citrulline (Me-val-cit). Exemplary tripeptides include, but are not limited to, glycine-valine-citrulline (gly-val-cit) and glycine-glycine-glycine (gly-gly-gly). An amino acid unit may comprise amino acid residues that occur naturally and/or minor amino acids and/or non-naturally occurring amino acid analogs, such as citrulline Amino acid units can be designed and optimized for enzymatic cleavage by a particular enzyme, for example, a tumor-associated protease, cathepsin B, C and D, or a plasmin protease.
[0397] In one embodiment, the amino acid unit is valine-citrulline (vc or val-cit). In another aspect, the amino acid unit is phenylalanine-lysine (i.e., fk). In yet another aspect of the amino acid unit, the amino acid unit is N-methylvaline-citrulline. In yet another aspect, the amino acid unit is 5-aminovaleric acid, homo phenylalanine lysine, tetraisoquinolinecarboxylate lysine, cyclohexylalanine lysine, isonepecotic acid lysine, beta-alanine lysine, glycine serine valine glutamine and isonepecotic acid.
[0398] Another approach for the generation of ADCs involves the use of heterobifunctional cross-linkers which link the anti-ILT3 antibody to the drug moiety. Examples of cross-linkers that may be used include N-succinimidyl 4-(5-nitro-2-pyridyldithio)-pentanoate or the highly water-soluble analog N-sulfosuccinimidyl 4-(5-nitro-2-pyridyldithio)-pentanoate, N-succinimidyl-4-(2-pyridyldithio) butyrate (SPDB), N-succinimidyl-4-(5-nitro-2-pyridyldithio) butyrate (SNPB), and N-sulfosuccinimidyl-4-(5-nitro-2-pyridyldithio) butyrate (SSNPB), N-succinimidyl-4-methyl-4-(5-nitro-2-pyridyldithio)pentanoate (SMNP), N-succinimidyl-4-(5-N,N-dimethylcarboxamido-2-pyridyldithio) butyrate (SCPB) or N-sulfosuccinimidyl4-(5-N,N-dimethylcarboxamido-2-pyridyldithio) butyrate (SSCPB)). The antibodies may be modified with the cross-linkers N-succinimidyl 4-(5-nitro-2-pyridyldithio)-pentanoate, N-sulfosuccinimidyl 4-(5-nitro-2-pyridyldithio)-pentanoate, SPDB, SNPB, SSNPB, SMNP, SCPB, or SSCPB can then react with a small excess of a particular drug that contains a thiol moiety to give excellent yields of an ADC (see also U.S. Pat. No. 6,913,748, incorporated by reference herein).
[0399] In one embodiment, charged linkers (also referred to as pro-charged linkers) are used to conjugate anti-ILT3 antibodies to drugs to form ADCs. Charged linkers include linkers that become charged after cell processing. The presence of a charged group(s) in the linker of a particular ADC or on the drug after cellular processing provides several advantages, such as (i) greater water solubility of the ADC, (ii) ability to operate at a higher concentration in aqueous solutions, (iii) ability to link a greater number of drug molecules per antibody, potentially resulting in higher potency, (iv) potential for the charged conjugate species to be retained inside the target cell, resulting in higher potency, and (v) improved sensitivity of multidrug resistant cells, which would be unable to export the charged drug species from the cell. Examples of some suitable charged or pro-charged cross-linkers and their synthesis are shown in FIGS. 1 to 10 of U.S. Pat. No. 8,236,319, and are incorporated by reference herein. Preferably, the charged or pro-charged cross-linkers are those containing sulfonate, phosphate, carboxyl or quaternary amine substituents that significantly increase the solubility of the ADCs, especially for ADCs with 2 to 20 conjugated drugs. Conjugates prepared from linkers containing a pro-charged moiety would produce one or more charged moieties after the conjugate is metabolized in a cell.
[0400] Additional examples of linkers that can be used with the compositions and methods include valine-citrulline; maleimidocaproyl; amino benzoic acids; p-aminobenzylcarbamoyl (PAB); lysosomal enzyme-cleavable linkers; maleimidocaproyl-polyethylene glycol (MC(PEG)6-OH); N-methyl-valine citrulline; N-succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC); N-Succinimidyl 4-(2-pyridyldithio)butanoate (SPDB); and N-Succinimidyl 4-(2-pyridylthio)pentanoate (SPP) (See also US 2011/0076232). Another linker for use includes an avidin-biotin linkage to provide an avidin-biotin-containing ADC (See also U.S. Pat. No. 4,676,980, PCT publication Nos. WO1992/022332A2, WO1994/016729A1, WO1995/015770A1, WO1997/031655A2, WO1998/035704A1, WO1999/019500A1, WO2001/09785A2, WO2001/090198A1, WO2003/093793A2, WO2004/050016A2, WO2005/081898A2, WO2006/083562A2, WO2006/089668A1, WO2007/150020A1, WO2008/135237A1, WO2010/111198A1, WO2011/057216A1, WO2011/058321A1, WO2012/027494A1, and EP77671B1), wherein some such linkers are resistant to biotinidase cleavage. Additional linkers that may be used include a cohesin/dockerin pair to provide a cohesion-dockerin-containing ADC (See PCT publication Nos. WO2008/097866A2, WO2008/097870A2, WO2008/103947A2, and WO2008/103953A2).
[0401] Additional linkers may contain non-peptide polymers (examples include, but are not limited to, polyethylene glycol, polypropylene glycol, polyoxyethylated polyols, polyvinyl alcohol, polysaccharides, dextran, polyvinyl ethyl ether, PLA (poly(lactic acid)), PLGA (poly(lactic acid-glycolic acid)), and combinations thereof, wherein a preferred polymer is polyethylene glycol) (See also PCT publication No. WO2011/000370). Additional linkers are also described in WO 2004-010957, U.S. Publication No. 20060074008, U.S. Publication No. 20050238649, and U.S. Publication No. 20060024317, each of which is incorporated by reference herein in its entirety).
[0402] For an ADC comprising a maytansinoid, many positions on maytansinoids can serve as the position to chemically link the linking moiety. In one embodiment, maytansinoids comprise a linking moiety that contains a reactive chemical group are C-3 esters of maytansinol and its analogs where the linking moiety contains a disulfide bond and the chemical reactive group comprises a N-succinimidyl or N-sulfosuccinimidyl ester. For example, the C-3 position having a hydroxyl group, the C-14 position modified with hydroxymethyl, the C-15 position modified with hydroxy and the C-20 position having a hydroxy group are all useful. The linking moiety most preferably is linked to the C-3 position of maytansinol.
[0403] The conjugation of the drug to the antibody via a linker can be accomplished by any technique known in the art. A number of different reactions are available for covalent attachment of drugs and linkers to antibodies. This may be accomplished by reaction of the amino acid residues of the antibody, including the amine groups of lysine, the free carboxylic acid groups of glutamic and aspartic acid, the sulfhydryl groups of cysteine and the various moieties of the aromatic amino acids. One of the most commonly used non-specific methods of covalent attachment is the carbodiimide reaction to link a carboxy (or amino) group of a compound to amino (or carboxy) groups of the antibody. Additionally, bifunctional agents such as dialdehydes or imidoesters have been used to link the amino group of a compound to amino groups of an antibody. Also available for attachment of drugs to antibodies is the Schiff base reaction. This method involves the periodate oxidation of a drug that contains glycol or hydroxy groups, thus forming an aldehyde which is then reacted with the binding agent. Attachment occurs via formation of a Schiff base with amino groups of the antibody. Isothiocyanates can also be used as coupling agents for covalently attaching drugs to antibodies. Other techniques are known to the skilled artisan and within the scope of the disclosure.
[0404] In certain embodiments, an intermediate, which is the precursor of the linker, is reacted with the drug under appropriate conditions. In certain embodiments, reactive groups are used on the drug or the intermediate. The product of the reaction between the drug and the intermediate, or the derivatized drug, is subsequently reacted with the anti-ILT3 antibody under appropriate conditions. The synthesis and structure of exemplary linkers, stretcher units, amino acid units, self-immolative spacer units are described in U.S. Patent Application Publication Nos. 20030083263, 20050238649 and 20050009751, each if which is incorporated herein by reference.
[0405] Stability of the ADC may be measured by standard analytical techniques such as mass spectroscopy, HPLC, and the separation/analysis technique LC/MS.
IV. Uses of Anti-ILT3 Antibodies and Anti-ILT3 ADCs
[0406] The antibodies and antibody portions (and ADCs) preferably are capable of neutralizing human ILT3 activity both in vivo and in vitro. Accordingly, such antibodies and antibody portions can be used to inhibit hILT3 activity, e.g., in a cell culture containing hILT3, in human subjects or in other mammalian subjects having ILT3 with which an antibody disclosed herein cross-reacts. In one embodiment, the disclosure provides a method for inhibiting hILT3 activity comprising contacting hILT3 with an antibody or antibody portion such that hILT3 activity is inhibited. For example, in a cell culture containing, or suspected of containing hILT3, an antibody or antibody portion can be added to the culture medium to inhibit hILT3 activity in the culture.
[0407] In another embodiment, disclosed herein is a method for reducing hILT3 activity in a subject, advantageously from a subject suffering from a “ILT3 associated disorder”, e.g., cancer such as TNBC, or an inflammatory disorder such as PVNS, or a disorder in which ILT3 activity is detrimental. An “ILT3 associated disorder,” as used herein, also includes a disorder characterized by infiltration of cells expressing ILT3, e.g., tumor infiltrating immune cells or myeloid derived suppressor cells (MDSCs).
[0408] The disclosure provides methods for reducing ILT3 activity in a subject suffering from such a disease or disorder, which method comprises administering to the subject an antibody or antibody portion of the disclosure such that ILT3 activity in the subject is reduced. Preferably, the ILT3 is human ILT3, and the subject is a human subject. Alternatively, the subject can be a mammal expressing a ILT3 to which antibodies of the disclosure are capable of binding. Still further the subject can be a mammal into which ILT3 has been introduced (e.g., by administration of ILT3 or by expression of a ILT3 transgene). Antibodies of the disclosure can be administered to a human subject for therapeutic purposes. Moreover, antibodies of the disclosure can be administered to a non-human mammal expressing a ILT3 with which the antibody is capable of binding for veterinary purposes or as an animal model of human disease. Regarding the latter, such animal models may be useful for evaluating the therapeutic efficacy of antibodies of the disclosure (e.g., testing of dosages and time courses of administration).
[0409] As used herein, the term “a disorder in which ILT3 activity is detrimental” is intended to include diseases and other disorders in which the presence of ILT3 in a subject suffering from the disorder has been shown to be or is suspected of being either responsible for the pathophysiology of the disorder or a factor that contributes to a worsening of the disorder. Accordingly, a disorder in which ILT3 activity is detrimental is a disorder in which reduction of ILT3 activity is expected to alleviate the symptoms and/or progression of the disorder. Such disorders may be evidenced, for example, by an increase in the concentration of ILT3 in a biological cell, fluid or tissue of a subject suffering from the disorder (e.g., an increase in the concentration of ILT3 in a tumor, serum, plasma, synovial fluid, etc. of the subject), or by infiltration of cells expressing ILT3, e.g., tumor infiltrating immune cells or myeloid derived suppressor cells (MDSCs), which can be detected, for example, using an anti-ILT3 antibody as described above.
[0410] Non-limiting examples of disorders that can be treated with the antibodies, or antigen binding fragments thereof, include those disorders discussed below. For example, suitable disorders include, but are not limited to, a variety of cancers including, but not limited to, triple negative breast cancer (TNBC) and acute myeloid leukemia (AML), and inflammatory disorders such as PVNS.
[0411] Other examples of cancers that may be treated using the compositions and methods disclosed herein include, but are not limited to carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies. More particular examples of such cancers include but are not limited to breast cancer (Luminal A, TNBC, Ductal), prostate cancer, squamous cell tumors, squamous cell carcinoma (e.g., squamous cell lung cancer or squamous cell head and neck cancer), neuroendocrine tumors, urothelial cancer, vulvar cancer, mesothelioma, liver cancer, bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, lung cancer, small cell lung cancer, non-small cell lung cancer, cutaneous or intraocular malignant melanoma, renal cancer, uterine cancer, ovarian cancer, colorectal cancer, colon cancer, rectal cancer, cancer of the anal region, stomach cancer, testicular cancer, uterine cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, non-Hodgkin's lymphoma, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, solid tumors of childhood, lymphocytic lymphoma, cancer of the bladder, cancer of the kidney or ureter, carcinoma of the renal pelvis, neoplasm of the central nervous system (CNS), primary CNS lymphoma, tumor angiogenesis, spinal axis tumor, brain stem glioma, pituitary adenoma, Kaposi's sarcoma, epidermoid cancer, environmentally induced cancers including those induced by asbestos, hematologic malignancies including, for example, multiple myeloma, B-cell lymphoma, Hodgkin lymphoma/primary mediastinal B-cell lymphoma, non-Hodgkin's lymphomas, acute myeloid lymphoma, chronic myelogenous leukemia, chronic lymphoid leukemia, follicular lymphoma, diffuse large B-cell lymphoma, Burkitt's lymphoma, immunoblastic large cell lymphoma, precursor,-lymphoblastic lymphoma, mantle cell lymphoma, acute lymphoblastic leukemia, mycosis fungoides, anaplastic large cell lymphoma, T-cell lymphoma, and precursor T-lymphoblastic lymphoma, and any combinations of said cancers. Acute myeloid leukemia, adrenocortico carcinoma, ladder urothelial carcinoma, cervical squamous cell carcinoma, endocervical adenocarcinoma, diffuse large B cell lymphoma, glioblastoma multiforme, chronic lymphocytic leukemia, brain lower grade glioma, head and neck squamous cell carcinoma, hepatocellular carcinoma, lung adenocarcinoma, large squamous cell carcinoma, cutaneous melanoma, ovarial serous cystadenocarcinoma, gastric cancer, soft tissue sarcoma, testicular germ cell cancer, thymoma, thyroid carcinoma, uterine corpus endometrial carcinoma, uterine carcinosarcoma, kidney renal clear cell carcinoma, and kidney renal papillary cell carcinoma. The present invention is also applicable to treatment of metastatic cancers.
[0412] In one embodiment, an anti-ILT3 ADC of the present invention can be used to treat a cancer in a subject including, but not limited to Hodgkin's lymphoma, acute myeloid leukemia, adrenocortico carcinoma, ladder urothelial carcinoma, breast cancer (Luminal A, TNBC, Ductal), cervical squamous cell carcinoma, endocervical adenocarcinoma, colorectal adenocarcinoma, diffuse large B cell lymphoma, non-hodgkin's lymphoma, glioblastoma multiforme, chronic lymphocytic leukemia, brain lower grade glioma, head and neck squamous cell carcinoma, hepatocellular carcinoma, lung adenocarcinoma, small cell lung cancer, large squamous cell carcinoma, cutaneous melanoma, ovarial serous cystadenocarcinoma, gastric cancer, soft tissue sarcoma, mesothelioma, pancreatic adenocarcinoma, testicular germ cell cancer, thymoma, thyroid carcinoma, uterine corpus endometrial carcinoma, uterine carcinosarcoma, kidney renal clear cell carcinoma, and kidney renal papillary cell carcinoma.
[0413] In one embodiment, the antibodies and ADCs disclosed herein are used to treat a solid tumor, e.g., inhibit growth of or decrease size of a solid tumor, overexpressing ILT3 or which is ILT3 positive. In one embodiment, the antibodies and ADCs disclosed herein are used to treat triple negative breast cancer (TNBC). Diseases and disorders described herein may be treated by anti-ILT3 antibodies or ADCs, as well as pharmaceutical compositions comprising such anti-ILT3 antibodies or ADCs.
[0414] In certain embodiments, the antibodies and ADCs disclosed herein are administered to a subject in need thereof in order to treat advanced solid tumor types likely to exhibit elevated levels of ILT3. In certain embodiments, the disclosure includes a method for inhibiting or decreasing solid tumor growth in a subject having a solid tumor, said method comprising administering an anti-ILT3 antibody or ADC described herein, to the subject having the solid tumor, such that the solid tumor growth is inhibited or decreased. In certain embodiments, the solid tumor is a triple negative breast cancer (TNBC) tumor. In further embodiments, the solid tumor is an ILT3 expressing solid tumor. In certain embodiments the anti-ILT3 antibodies or ADCs described herein are administered to a subject having triple negative breast cancer (TNBC) or acute myeloid leukemia (AML), alone or in combination with one or more additional agent, e.g., radiation and/or chemotherapy, or one or more immune checkpoint inhibitor.
[0415] In certain embodiments, the disclosure includes a method for inhibiting or decreasing solid tumor growth in a subject having a solid tumor which was identified as an ILT3 expressing or ILT3 expressing tumor, said method comprising administering an anti-ILT3 antibody or ADC described herein, to the subject having the solid tumor, such that the solid tumor growth is inhibited or decreased. Methods for identifying ILT3 expressing tumors are known in the art, and include FDA-approved tests and validation assays. For example, these assays may use primers that are specific for the ILT3 gene and/or cDNA and result in the amplification of the ILT3 gene/cDNA, or a portion thereof. The amplified PCR products may be subsequently analyzed, for example, by gel electrophoresis using standard methods known in the art to determine the size of the PCR products.
[0416] Such tests may be used to identify tumors that may be treated with the methods and compositions described herein.
[0417] In another aspect, this application features a method of treating (e.g., curing, suppressing, ameliorating, delaying or preventing the onset of, or preventing recurrence or relapse of) or preventing a ILT3-associated disorder, in a subject. The method includes: administering to the subject an ILT3 binding agent (particularly an antagonist), e.g., an anti-ILT3 antibody or fragment thereof as described herein, in an amount sufficient to treat or prevent the ILT3-associated disorder. The ILT3 antagonist, e.g., the anti-ILT3 antibody or fragment thereof, can be administered to the subject, alone or in combination with other therapeutic modalities as described herein.
[0418] Antibodies or ADCs, or antigen binding portions thereof, can be used alone or in combination to treat such diseases. It should be understood that the antibodies or antigen binding portion thereof can be used alone or in combination with an additional agent, e.g., a therapeutic agent, said additional agent being selected by the skilled artisan for its intended purpose. For example, the additional agent can be a therapeutic agent art-recognized as being useful to treat the disease or condition being treated by the antibody. The additional agent also can be an agent that imparts a beneficial attribute to the therapeutic composition, e.g., an agent which affects the viscosity of the composition.
[0419] It should further be understood that the combinations which are to be included within this disclosure are those combinations useful for their intended purpose. The agents set forth below are illustrative for purposes and not intended to be limited. The combinations, which are part of this disclosure, can be the antibodies of the disclosure and at least one additional agent selected from the lists below. The combination can also include more than one additional agent, e.g., two or three additional agents if the combination is such that the formed composition can perform its intended function.
[0420] The combination therapy can include one or more ILT3 antagonists, e.g., anti-ILT3 antibodies or fragments thereof, formulated with, and/or co-administered with, one or more additional therapeutic agents, e.g., one or more cytokine and growth factor inhibitors, immunosuppressants, anti-inflammatory agents (e.g., systemic anti-inflammatory agents), anti-fibrotic agents, metabolic inhibitors, enzyme inhibitors, and/or cytotoxic or cytostatic agents, mitotic inhibitors, antitumor antibiotics, immunomodulating agents, vectors for gene therapy, alkylating agents, antiangiogenic agents, antimetabolites, boron-containing agents, chemoprotective agents, hormones, antihormone agents, corticosteroids, photoactive therapeutic agents, oligonucleotides, radionuclide agents, topoisomerase inhibitors, tyrosine kinase inhibitors, or radiosensitizers, as described in more herein.
[0421] In a particular embodiment, the anti-ILT3 antibodies disclosed herein are used in combination with an anti-cancer agent or an antineoplastic agent. The terms “anti-cancer agent” and “antineoplastic agent” refer to drugs used to treat malignancies, such as cancerous growths.
[0422] In one embodiment, the anti-ILT3 antibodies or ADCs of the invention are administered in combination with one or more immune checkpoint inhibitors (e.g., antibody or small molecule immune checkpoint inhibitors) for the treatment of a cancer. In some embodiments, the immune checkpoint inhibitor is an inhibitor (e.g, an antibody) of Programmed Death-Ligand 1 (PD-L1, also known as B7-H1, CD274), Programmed Death 1 (PD-1), CTLA-4, PD-L2 (B7-DC, CD273), LAG3, TIM3, 2B4, 4-1BB, A2aR, B7H1, B7H3, B7H4, BTLA, CD2, CD6 (itolizumab), CD27, CD28, CD30, CD38, CD39, CD40, CD47, CD70, CD73, CD80, CD86, CD166, CD137, CD160, CD166, CD200, CD200R1, CD226, CD276, CSF1R, DR3, GALS, GITR, HVEM, IDO1, IDO2, ICOS (inducible T cell costimulator), PSGL1, CLEC4A, KIR, LAG3, LAIR1, TREM2, LILRB1, LILRB2, LILRB3, LIGHT, MARCO (macrophage receptor with collageneous structure), PS (phosphatidylserine), OX-40, SLAM, SIRPA, CSF1R, CD47, SIRPA, TIGHT, TIM3, TGFβ, VISTA, VTCN1, or any combinations thereof.
[0423] In some embodiments, the immune checkpoint inhibitor is an anti-CTLA-4, PD-L1, or PD-1 antibody therapy such as, but not limited to Yervoy® (ipilimumab Bristol-Myers Squibb), Opdivo® (nivolumab; Bristol-Myers Squibb), Keytrada® (pembrolizumab; Merck), and Tecentriq® (atezolizumab; Roche).
[0424] In other embodiments, the immune checkpoint inhibitor is an anti-CD38 antibody therapy such as isatuximab (Sanofi), Darzalex® (daratumumab; Genmab A/S and Janssen Biotech), MOR202 (MorphoSys AG), and Tusk Therapeutics Ltd.'s anti-CD38 monoclonal antibody.
[0425] In one embodiment, the anti-ILT3 antibodies or ADCs of the invention are administered in combination with one checkpoint inhibitor, e.g., an anti-CTLA-4, CD38, PD-L1, or PD-1 antibody. In other embodiments, the anti-ILT3 antibodies or ADCs of the invention are administered in combination with more than one checkpoint inhibitor, e.g., an an anti-ILT3 antibody or ADC of the invention in combination with an anti-CD38 antibody and an anti-PD-L1 antibody, or an anti-ILT3 antibody or ADC of the invention in combination with an anti-CD38 antibody and an anti-PD-1 antibody.
[0426] In some embodiments, the checkpoint inhibitor is an antibody currently undergoing clinical testing, including, for example, IDO (Epacadostat and Indoximod and BMS-986205), 4-1BB/CD137 (Utomilumab and Urelumab), KIR (Lirilulmab), CD40 (CP-870,893), CD27 (Varlilumab), LAG-3 (Relatilimab), MHCII (Eftilagimod Alpha).
[0427] In one embodiment, the anti-ILT3 antibodies or ADCs of the invention are administered in combination with one checkpoint inhibitor, e.g., an anti-CTLA-4, CD38, PD-L1, or PD-1 antibody. In other embodiments, the anti-ILT3 antibodies or ADCs of the invention are administered in combination with more than one checkpoint inhibitor, e.g., an an anti-ILT3 antibody or ADC of the invention in combination with an anti-CD38 antibody and an anti-PD-L1 antibody, or an anti-ILT3 antibody or ADC of the invention in combination with an anti-CD38 antibody and an anti-PD-1 antibody.
[0428] Drug therapy may be used alone, or in combination with other treatments such as surgery or radiation therapy. Several classes of drugs may be used in cancer treatment, depending on the nature of the organ involved. For example, breast cancers are commonly stimulated by estrogens, and may be treated with drugs which inactive the sex hormones. Similarly, prostate cancer may be treated with drugs that inactivate androgens, the male sex hormone.
[0429] In particular embodiments, the anti-ILT3 antibodies or ADCs can be administered alone or with another anti-cancer agent which acts in conjunction with or synergistically with the antibody to treat the disease associated with ILT3 activity. Such anti-cancer agents include, for example, agents well known in the art (e.g., cytotoxins, chemotherapeutic agents, small molecules and radiation). Examples of anti-cancer agents include, but are not limited to, Panorex (Glaxo-Welcome), Rituxan (IDEC/Genentech/Hoffman la Roche), Mylotarg (Wyeth), Campath (Millennium), Zevalin (IDEC and Schering AG), Bexxar (Corixa/GSK), Erbitux (Imclone/BMS), Avastin (Genentech) and Herceptin (Genentech/Hoffman la Roche). Other anti-cancer agents include, but are not limited to, those disclosed in U.S. Pat. No. 7,598,028 and International Publication No. WO2008/100624, the contents of which are hereby incorporated by reference. One or more anti-cancer agents may be administered either simultaneously or before or after administration of an antibody or antigen binding portion thereof.
[0430] In particular embodiments of the invention, the anti-ILT3 antibodies or ADCs described herein can be used in a combination therapy with an inhibitor of NAMPT (see examples of inhibitors in US 2013/0303509; AbbVie, Inc., incorporated by reference herein) to treat a subject in need thereof. NAMPT (also known as pre-B-cell-colony-enhancing factor (PBEF) and visfatin) is an enzyme that catalyzes the phosphoribosylation of nicotinamide and is the rate-limiting enzyme in one of two pathways that salvage NAD. In one embodiment, anti-ILT3 antibodies and ADCs described herein are administered in combination with a NAMPT inhibitor for the treatment of cancer in a subject.
[0431] In particular embodiments, the anti-ILT3 antibodies or ADCs described herein can be used in a combination therapy with SN-38, which is the active metabolite of the topoisomerase inhibitor irinotecan.
[0432] The pharmaceutical compositions may include a “therapeutically effective amount” or a “prophylactically effective amount” of an antibody or antibody portion. A “therapeutically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic result. A therapeutically effective amount of the antibody or antibody portion may be determined by a person skilled in the art and may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the antibody or antibody portion to elicit a desired response in the individual. A therapeutically effective amount is also one in which any toxic or detrimental effects of the antibody, or antibody portion, are outweighed by the therapeutically beneficial effects. A “prophylactically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
[0433] Dosage regimens may be adjusted to provide the optimum desired response (e.g., a therapeutic or prophylactic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the mammalian subjects to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic or prophylactic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
[0434] An exemplary, non-limiting range for a therapeutically or prophylactically effective amount of an ADC, an antibody or antibody portion is 0.1-20 mg/kg, more preferably 1-10 mg/kg. It is to be noted that dosage values may vary with the type and severity of the condition to be alleviated. It is to be further understood that for any particular subject, specific dosage regimens should be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions, and that dosage ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed composition.
[0435] In another aspect, this application provides a method for detecting the presence of ILT3 in a sample in vitro (e.g., a biological sample, such as serum, plasma, tissue, biopsy). The subject method can be used to diagnose a disorder, e.g., a cancer. The method includes: (i) contacting the sample or a control sample with the anti-ILT3 antibody or fragment thereof as described herein; and (ii) detecting formation of a complex between the anti-ILT3 antibody or fragment thereof, and the sample or the control sample, wherein a statistically significant change in the formation of the complex in the sample relative to the control sample is indicative of the presence of ILT3 in the sample.
[0436] Given their ability to bind to human ILT3, the anti-human ILT3 antibodies, or portions thereof, (as well as ADCs thereof) can be used to detect human ILT3 (e.g., in a biological sample, such as serum or plasma), using a conventional immunoassay, such as an enzyme linked immunosorbent assays (ELISA), an radioimmunoassay (RIA) or tissue immunohistochemistry. In one aspect, the disclosure provides a method for detecting human ILT3 in a biological sample comprising contacting a biological sample with an antibody, or antibody portion, and detecting either the antibody (or antibody portion) bound to human ILT3 or unbound antibody (or antibody portion), to thereby detect human ILT3 in the biological sample. The antibody is directly or indirectly labeled with a detectable substance to facilitate detection of the bound or unbound antibody. Suitable detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials and radioactive materials. Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, β-galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; and examples of suitable radioactive material include .sup.3H .sup.14C, S, .sup.90Y .sup.99Tc, .sup.111In, .sup.125I, .sup.131, .sup.177Lu, .sup.166Ho, or .sup.153Sm.
[0437] Alternative to labeling the antibody, human ILT3 can be assayed in biological fluids by a competition immunoassay utilizing rhILT3 standards labeled with a detectable substance and an unlabeled anti-human ILT3 antibody. In this assay, the biological sample, the labeled rhILT3 standards and the anti-human ILT3 antibody are combined and the amount of labeled rhILT3 standard bound to the unlabeled antibody is determined. The amount of human ILT3 in the biological sample is inversely proportional to the amount of labeled rhILT3 standard bound to the anti-ILT3 antibody. Similarly, human ILT3 can also be assayed in biological fluids by a competition immunoassay utilizing rhILT3 standards labeled with a detectable substance and an unlabeled anti-human ILT3 antibody.
[0438] In yet another aspect, this application provides a method for detecting the presence of ILT3 in vivo (e.g., in vivo imaging in a subject). The subject method can be used to diagnose a disorder, e.g., a ILT3-associated disorder. The method includes: (i) administering the anti-ILT3 antibody or fragment thereof as described herein to a subject or a control subject under conditions that allow binding of the antibody or fragment to ILT3; and (ii) detecting formation of a complex between the antibody or fragment and ILT3, wherein a statistically significant change in the formation of the complex in the subject relative to the control subject is indicative of the presence of ILT3.
V. Pharmaceutical Compositions
[0439] The disclosure also provides pharmaceutical compositions comprising an antibody, or antigen binding portion thereof, or ADC and a pharmaceutically acceptable carrier. The pharmaceutical compositions comprising antibodies or ADCs are for use in, but not limited to, diagnosing, detecting, or monitoring a disorder, in preventing, treating, managing, or ameliorating of a disorder or one or more symptoms thereof, and/or in research. In a specific embodiment, a composition comprises one or more antibodies. In another embodiment, the pharmaceutical composition comprises one or more antibodies or ADCs and one or more prophylactic or therapeutic agents other than antibodies or ADCs for treating a disorder in which ILT3 activity is detrimental. Preferably, the prophylactic or therapeutic agents known to be useful for or having been or currently being used in the prevention, treatment, management, or amelioration of a disorder or one or more symptoms thereof. In accordance with these embodiments, the composition may further comprise of a carrier, diluent or excipient.
[0440] The antibodies and antibody-portions or ADCs can be incorporated into pharmaceutical compositions suitable for administration to a subject. Typically, the pharmaceutical composition comprises an antibody or antibody portion and a pharmaceutically acceptable carrier. As used herein, “pharmaceutically acceptable carrier” includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible. Examples of pharmaceutically acceptable carriers include one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and the like, as well as combinations thereof. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition. Pharmaceutically acceptable carriers may further comprise minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers, which enhance the shelf life or effectiveness of the antibody or antibody portion or ADC.
[0441] Various delivery systems are known and can be used to administer one or more antibodies or ADCs or the combination of one or more antibodies and a prophylactic agent or therapeutic agent useful for preventing, managing, treating, or ameliorating a disorder or one or more symptoms thereof, e.g., encapsulation in liposomes, microparticles, microcapsules, recombinant cells capable of expressing the antibody or antibody fragment, receptor-mediated endocytosis (see, e.g., Wu and Wu, J. Biol. Chem. 262:4429-4432 (1987)), construction of a nucleic acid as part of a retroviral or other vector, etc. Methods of administering a prophylactic or therapeutic agent include, but are not limited to, parenteral administration (e.g., intradermal, intramuscular, intraperitoneal, intravenous and subcutaneous), epidural administration, intratumoral administration, and mucosal administration (e.g., intranasal and oral routes). In addition, pulmonary administration can be employed, e.g., by use of an inhaler or nebulizer, and formulation with an aerosolizing agent. See, e.g., U.S. Pat. Nos. 6,019,968, 5,985,320, 5,985,309, 5,934, 272, 5,874,064, 5,855,913, 5,290, 540, and 4,880,078; and PCT Publication Nos. WO 92/19244, WO 97/32572, WO 97/44013, WO 98/31346, and WO 99/66903, each of which is incorporated herein by reference their entireties. In one embodiment, an antibody, combination therapy, or a composition is administered using Alkermes AIR® pulmonary drug delivery technology (Alkermes, Inc., Cambridge, Mass.). In a specific embodiment, prophylactic or therapeutic agents are administered intramuscularly, intravenously, intratumorally, orally, intranasally, pulmonary, or subcutaneously. The prophylactic or therapeutic agents may be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents. Administration can be systemic or local.
[0442] In a specific embodiment, it may be desirable to administer the prophylactic or therapeutic agents locally to the area in need of treatment; this may be achieved by, for example, and not by way of limitation, local infusion, by injection, or by means of an implant, said implant being of a porous or non-porous material, including membranes and matrices, such as sialastic membranes, polymers, fibrous matrices (e.g., Tissuel®), or collagen matrices. In one embodiment, an effective amount of one or more antibodies antagonists is administered locally to the affected area to a subject to prevent, treat, manage, and/or ameliorate a disorder or a symptom thereof. In another embodiment, an effective amount of one or more antibodies is administered locally to the affected area in combination with an effective amount of one or more therapies (e.g., one or more prophylactic or therapeutic agents) other than an antibody of a subject to prevent, treat, manage, and/or ameliorate a disorder or one or more symptoms thereof.
[0443] A pharmaceutical composition is formulated to be compatible with its intended route of administration. Examples of routes of administration include, but are not limited to, parenteral, e.g., intravenous, intradermal, subcutaneous, oral, intranasal (e.g., inhalation), transdermal (e.g., topical), transmucosal, and rectal administration. In a specific embodiment, the composition is formulated in accordance with routine procedures as a pharmaceutical composition adapted for intravenous, subcutaneous, intramuscular, oral, intranasal, or topical administration to human beings. Typically, compositions for intravenous administration are solutions in sterile isotonic aqueous buffer. Where necessary, the composition may also include a solubilizing agent and a local anesthetic such as lignocaine to ease pain at the site of the injection.
[0444] If the method of the disclosure comprises oral administration, compositions can be formulated orally in the form of tablets, capsules, cachets, gel caps, solutions, suspensions, and the like. Tablets or capsules can be prepared by conventional means with pharmaceutically acceptable excipients such as binding agents (e.g., pregelatinised maize starch, polyvinylpyrrolidone, or hydroxypropyl methylcellulose); fillers (e.g., lactose, microcrystalline cellulose, or calcium hydrogen phosphate); lubricants (e.g., magnesium stearate, talc, or silica); disintegrants (e.g., potato starch or sodium starch glycolate); or wetting agents (e.g., sodium lauryl sulphate). The tablets may be coated by methods well-known in the art. Liquid preparations for oral administration may take the form of, but not limited to, solutions, syrups or suspensions, or they may be presented as a dry product for constitution with water or other suitable vehicle before use. Such liquid preparations may be prepared by conventional means with pharmaceutically acceptable additives such as suspending agents (e.g., sorbitol syrup, cellulose derivatives, or hydrogenated edible fats); emulsifying agents (e.g., lecithin or acacia); non-aqueous vehicles (e.g., almond oil, oily esters, ethyl alcohol, or fractionated vegetable oils); and preservatives (e.g., methyl or propyl-p-hydroxybenzoates or sorbic acid). The preparations may also contain buffer salts, flavoring, coloring, and sweetening agents as appropriate. Preparations for oral administration may be suitably formulated for slow release, controlled release, or sustained release of a prophylactic or therapeutic agent(s).
[0445] The method may comprise administration of a composition formulated for parenteral administration by injection (e.g., by bolus injection or continuous infusion). Formulations for injection may be presented in unit dosage form (e.g., in ampoules or in multi-dose containers) with an added preservative. The compositions may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents. Alternatively, the active ingredient may be in powder form for constitution with a suitable vehicle (e.g., sterile pyrogen-free water) before use.
[0446] Generally, the ingredients of compositions are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent. Where the mode of administration is infusion, composition can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline. Where the mode of administration is by injection, an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
[0447] In particular, the disclosure also provides that one or more of the prophylactic or therapeutic agents, or pharmaceutical compositions is packaged in a hermetically sealed container such as an ampoule or sachette indicating the quantity of the agent. In one embodiment, one or more of the prophylactic or therapeutic agents, or pharmaceutical compositions is supplied as a dry sterilized lyophilized powder or water free concentrate in a hermetically sealed container and can be reconstituted (e.g., with water or saline) to the appropriate concentration for administration to a subject. The antibodies and antibody-portions or ADCs can be administered by a variety of methods known in the art, although for many therapeutic applications, the preferred route/mode of administration is subcutaneous injection, intravenous injection or infusion. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results. In certain embodiments, the active compound may be prepared with a carrier that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978.
[0448] It will be readily apparent to those skilled in the art that other suitable modifications and adaptations of the methods of the invention described herein are obvious and may be made using suitable equivalents without departing from the scope of the invention or the embodiments disclosed herein. Having now described the invention in detail, the same will be more clearly understood by reference to the following examples, which are included for purposes of illustration only and are not intended to be limiting.
EXAMPLES
Example 1. Immunohistochemical Analysis of ILT3 in TNBC Tissues
[0449] Triple-negative breast cancer (TNBC) tumors, formalin fixed and embedded in paraffin, were sectioned and mounted on microscope slides. Expression and cellular localization of ILT3 was evaluated using standard immunohistochemistry methodology.
[0450] Methods
[0451] Immunohistochemistry (IHC) TNBC tumor sections were stained with antibodies against ILT3 (R&D Systems, Minneapolis, Minn.) and the myeloid marker CD68 (Dako, Santa Clara, Calif.), using standard IHC procedure. Briefly, paraffin embedded tissues were mounted on slides and were deparrafinized by incubating with xylene, 100% ethanol and 95% ethanol, followed by rehydration with deionized water. Antigen unmasking was achieved by heating slides in a microwave submersed in 1× citrate unmasking solution until boiling was initiated, followed by cooling at room temperature for 30 minutes. Sections were blocked in 1×TBST/5% normal goat serum for 1 hour and then subsequently incubated with the anti-ILT3 or anti-CD68 primary antibody overnight at 4° C. A secondary reagent conjugated with horseradish peroxidase (HRP) recognizing goat immunoglobulins or mouse immunoglobulins was used to visualize ILT3 or CD68 staining, respectively. Counterstain using hematoxylin was done using manufacturer's instructions (Cell Signaling Technology, Danvers, Mass.).
[0452] Results
[0453] Expression of ILT3 was confirmed in TNBC tissue sections. The IHC staining revealed that ILT3 was predominantly expressed by the tumor infiltrating immune cells, which also expressed CD68 in serial section stains. These data are in line with previous published observations that ILT3 is expressed by infiltrating CD68+ myeloid cells in solid tumors (Suciu-Foca, N. et al., J. Immunol., 2007, 178, 7432-7441).
Example 2. Generation of Fully Human Antibodies Against Human ILT3
[0454] Experiments were performed to generate fully human antibodies against human ILT3 using the following methods.
[0455] Methods
[0456] DNA Immunizations in Humanized Mice
[0457] Humanized mice were immunized using a standard DNA prime with recombinant protein boost method. Human ILT3 cDNA construct was purchased from Origene™ (Rockville, Md.). Large scale DNA preparation of the ILT3 construct was performed using standard plasmid expansion methods. Twelve week old H2L2 mice were anesthetized and then received an intramuscular injection in the tibialis anterior muscle, containing 50 μg of ILT3 plasmid DNA in a 50 μL volume. Immediately following, the injected area was subjected to in vivo electroporation using a BTX 830™ generator and a BTX™ 7 mm diameter tweezertrode electrode (BTX Harvard Apparatus, Holliston, Mass.) under the following conditions: 100 V/cm, 20 ms, 460 ms between pulses. Mice received a total of 3 DNA immunizations spaced by 1 week. Mice that showed anti-ILT3 serum activity after the 3.sup.rd DNA immunization were rested for one month and boosted twice with 50 μg of ILT3 recombinant protein (#16742-H08-H-20, Sino Biological Inc, Beijing, China) intravenously. Protein boosts were spaced by 2 weeks. A final recombinant protein boost was given 3-5 days prior to sacrificing the animals. Spleens were taken immediately for fusions.
[0458] Cell Fusion
[0459] Cell fusion was done following a standard hybridoma procedure. Briefly, one week before the cell fusion, the fusion partner mouse myeloma cell line X63-Ag8.653 (#85011420, non-Ig-secreting; Sigma-Aldrich, St. Louis, Mo.) was cultured in complete RPMI 1640 medium (2 mM Glutamine and 20% Fetal Bovine Serum, FBS). Spleens from the immunized mice were mechanically processed and made into single-cell suspensions. The cell suspension was passed through a fine mesh 100 μm nylon filter and transferred to a sterile 50 mL conical tube full of serum-free RPMI 1640 medium. The splenocytes were pelleted by centrifuging for 5 min at 1500 rpm (500×g) at room temperature. Supernatant was discarded and the cell pellet was resuspended with 5 mL of ammonium chloride solution for 5 minutes at room temperature to lyse red blood cells (RBC). Cell suspension was washed twice with serum-free RPMI and then cell number and viability was determined using a hemocytometer. Concurrently, X63-Ag8.653 myeloma cells were harvested by transferring the cells from their culture vessels to a 50 mL conical tube and washed two times with serum free RPMI followed by cell count and viability assessment. The X63-Ag8.653 myeloma cells and the mouse splenocytes were mixed at a 1:10 ratio, respectively, in a 50 mL conical tube and then spun down for 5 min at 1500 rpm (500×g).
[0460] The cell fusion was performed by placing the tube containing the mixed cell pellet in a 37° C. water bath under sterile conditions. The mixed cell pellet received 1 mL of pre-warmed 50% PEG solution (Sigma-Aldrich, St. Louis, Mo.) in dropwise fashion over a 1-minute time period, with constant stirring after every drop. The cell mixture then received 1 mL of pre-warmed serum free RPMI, added dropwise for 1 minute, followed by 1 mL of complete RPMI added in a similar fashion. Cells were constantly stirred after every drop of serum free or complete RPMI media. In similar dropwise fashion, 7 mL of pre-warmed serum-free RPMI was added to the cells over a period of 3 minutes. The cells were then centrifuged for 5 min at 1500 rpm at room temperature and the cell pellet was thoroughly resuspended with 20 mL of pre-warmed complete RPMI. The cell suspension was then transferred to a sterile reservoir container and 200 μL of cell suspension was collected with a multi-channel pipet and transferred to 96-well flat bottom plates until the entire cell suspension was plated (yielded about 10 plates). The fused cells were kept in a humidified incubator at 37° C. with 5% CO.sub.2. On the second day, complete RPMI media was supplemented with 1×HAT (Sigma-Aldrich, St. Louis, Mo.) reagent and distributed to the 10 fusion plates. The fused cells were fed by removing 50% of the original culture media and replacing it with new HAT+ media on culture days 6, 7, and 10. After 12 days in culture, fusion supernatants were evaluated for anti-ILT3 activity using high-throughput assays.
[0461] Immunofluorescence (IF) Based High Content Screening (HCS)
[0462] High content immunofluorescence was used to identify wells that contain immunoglobulin that preferentially bound ILT3. Briefly, ILT3 was ectopically expressed in the Human Embryonic Kidney 293 (HEK293) cell line, which were then used to identify wells containing anti-ILT3 immunoglobulins. Parental HEK293 cells, transfected with an empty DNA vector, were used to identify non-specific antibodies. These cells were seeded 24 hours before the assay and then were incubated for 45 minutes at 37° C. with hybridoma supernatant diluted 2-fold in DMEM+10% fetal bovine serum (FBS). After incubation, cells were fixed in 4% formaldehyde, washed with PBS, permeabilized with 0.3% Triton-X-100, and labeled with anti-rat Alexa 488 secondary antibodies for 1 hour at room temperature. Unbound secondary antibody was removed with PBS washes, and cells were stained with propidium iodide (PI) and Hoechst 33342 to identify cell nucleus.
[0463] Potential hits were initially identified via low-resolution, high-throughput screening using a TTP Labtech Acumen eX3™ (TTP Labtech, Cambridge, Mass.), quantifying the fluorescence differential for each sample on both positive and negative cell lines. Those hits were subsequently verified and the subcellular localization of each sample was characterized using a Thermo ArrayScan VTi™ (Thermo Fisher Scientific, Waltham, Mass.) to obtain high-resolution images of both cell lines. Wells containing immunoglobulin that preferentially bound human ILT3 were subsequently evaluated, using a flow cytometry based method, for their recognition of endogenous human ILT3 and the Macaca fascicularis ILT3 homologue, which was over-expressed on HEK293 cells.
[0464] Flow Cytometry
[0465] Supernatant from hybridoma wells, containing ILT3 specific antibodies, were re-tested on human acute myeloid leukemia cell lines KG1 (ILT3.sup.−) and MV4-11 (ILT3.sup.+), which have been described as lacking or expresing endogenous ILT3 on their cell surface (Dobrowolska, H. et al. Cytometry Part B: Clinical Cytometry. 2013; 84B, 21-29). KG1 and MV4-11 cell lines were collected from their respective culture vessels and transferred to 50 mL conical tubes. The cells were pelleted by centrifuging them for 5 minutes at 1250 rpm at room temperature. The cell pellets were washed 2 times with flow buffer (1×PBS, 0.5% BSA, 2 mM EDTA). After the second wash, the cells were counted and the concentration was adjusted to 1×10.sup.6 cells per 1 mL. The KG1 and MV4-11 cell suspensions were mixed and transferred to a sterile reservoir container. Using a multichannel pipette, 200 μL was collected and transferred to 96-V bottom polypropylene plates and spun at 1250 rpm for 5 min at 4° C. to pellet the cells. The cell pellets were resuspended with hybridoma supernatant diluted 2-fold with cold flow buffer and incubated at 4° C. for 30 min. After incubation, cells were washed 2× with flow buffer and then labeled with anti-rat Alexa 647 secondary antibodies for 30 min at 4° C. Unbound secondary antibodies were removed by washing the cells 2× with flow buffer. Cells were then resuspended in 200 μL of flow buffer containing PI to identify dead cells and remove from analysis. This procedure was replicated when evaluating anti-macaque ILT3 reactivity with the HEK293 system. Cells were run on a MACSQuant Analyzer 10™ flow cytometer (Miltenyi Biotec, Bergisch Gladbach, Germany) and analysis was performed with FlowJo™ software (FlowJo, Ashland, Oreg.).
[0466] Recombinant ILT3 Cloning
[0467] Ectodomains of human and cynomolgus monkey were cloned by synthetic genes. The synthetic genes were based on GenBank sequences: human (AAH26309.1) (SEQ ID NO: 149) and monkey (XP_015297200). All DNA sequences were cloned into appropriate CMV-based expression vectors with non-native signal peptides and C-terminal histidine tags for purification.
[0468] Cloning VH and VL Sequences from Hybridomas
[0469] For determination of CDR sequences, total RNA was isolated from hybridoma cells using an RNeasy® kit (Qiagen, Hilden, Germany). First and second-strand cDNA synthesis was performed using a One Taq® One-Step RT-PCR kit (New England BioLabs, Ipswich, Mass.). Several primer sets were used (see Table 1). PCR products were separated by agarose electrophoresis and fragments were excised and purified by a QIAquick® gel extraction kit (Qiagen, Hilden, Germany). Fragments were cloned directly into expression vectors with BspQI (New England BioLabs, Ipswich, Mass.) by Golden Gate cloning techniques. Four colonies from each reaction were scaled up for miniprep-scale plasmid purification by SequeMid® DNA Purification Kit (Aline Biosciences, Woburn, Mass.).
TABLE-US-00002 TABLE 1 Oligonucleotide Sequences SEQ ID NO Oligonucleotide Sequence Oligonucleotide Purpose 150 ATAGCTCTTCAGGGaccATGAARCAYCTGTGGTTCTTCCT IGHV4 leader 151 ATAGCTCTTCAGGGaccATGGACATACTTTGTTCCACGC IGHV2 leader 152 ATAGCTCTTCAGGGaccATGGACACACTTTGCTACACAC IGHV2-26 leader 153 ATAGCTCTTCAGGGaccATGTCTGTCTCCTTCCTCATCT IGHV6 leader 154 ATAGCTCTTCAGGGaccATGGACTGGACCTGGAGVATC IGHV1 leader 155 ATAGCTCTTCAGGGaccATGGACTGGATTTGGAGGRTC IGHV1-58 leader 156 ATAGCTCTTCAGGGaccATGGACTGCACCTGGAGGATC IGHV1-24 leader 157 ATAGCTCTTCAGGGaccATGGACTGGACCTGGAGGKTC IGHV1-69/1-46/7-4-1 leader 158 ATAGCTCTTCAGGGaccATGGAGTTKGGRCTGAGCTGG IGHV3 leader 159 ATAGCTCTTCAGGGaccATGGAGTTTKGGCTKAGCTGG IGHV3-53/3-49 leader 160 ATAGCTCTTCAGGGaccATGGAACTGGGGCTCCGCTGG IGHV3-21 leader 161 ATAGCTCTTCAGGGaccATGGARTTGGGGCTGWGCTGG IGHV3-48/3-7 leader 162 ATAGCTCTTCAGGGaccATGGGGTCAACCGCCATCCTC IGHV5 leader 163 ATAGCTCTTCAGGGaccATGGACATGAGGGTSCCYGCTCAGCTC IgkV1a leader 164 ATAGCTCTTCAGGGaccATGGACATGAGRGTCCTCGCTCAGCTC IgkV1b leader 165 ATAGCTCTTCAGGGaccATGGAAGCCCCAGCDCAGCTTCTC IgkV3 leader 166 ATAGCTCTTCAGGGaccATGGAAACCCCAGCGCAGCTTCTC IgkV3-20 leader 167 ATAGCTCTTCAGGGaccATGGTGTTGCAGACCCAGGTCTTC IgkV4 leader 168 ATAGCTCTTCAGGGaccATGGGGTCCCAGGTTCACCTCCTC IgkV5 leader 169 ATAGCTCTTCAGGGaccATGAGGCTCCYTGCTCAGCTCCTG IgkV2 leader 170 ATAGCTCTTCTTCGTTTGATCTCCASCTTGGTC Kappa FW4 171 ATAGCTCTTCTTCGTTTAATCTCCAGTCGTGTC Kappa FW4 172 ATAGCTCTTCTGGCTGAGGAGACGGTGACC Heavy FW4 173 ATAGCTCTTCATGTGACGCTGTTGTGACTCAGGA VL-FOR L1 174 ATAGCTCTTCATGTGACCYTGTGCTCACTCAGTC VL-FOR L2 175 GATGCTCTTCTGGGCTGGCCTAGGACAGTCAMCYTGG VL-REV L
[0470] Identification of Functional, Recombinant VH and VL Sequences
[0471] For each hybridoma, each plasmid was sent for Sanger Sequencing. These plasmids were subjected to DNA sequence determination and analysis.
[0472] For each hybridoma, unique recombinant heavy chains were paired with unique recombinant light chains. These plasmid pairs were transfected into CHO cells in 24-well plates. Ten days later conditioned medium from each pairing was screened by Flow cytometric analysis or Octet for binding to the target.
[0473] Transient Expression System
[0474] The ILT3 recombinant proteins and anti-ILT3 antibodies were expressed in Chinese hamster ovary (CHO) cells using recommended transfection and media components of the ExpiCHO™ system (Invitrogen, Carlsbad, Calif.). Cell culture supernatants were harvested 14 days post-transfection, centrifuged, and filtered (0.22 um).
[0475] Purification of Recombinant His-Tagged Proteins
[0476] Conditioned medium from CHO cell cultures was clarified, filtered, and loaded onto an ÅKTAprime Plus™ system with a 5 mL HisTrap™ FF column (GE Healthcare). Fractions were collected, analyzed by SDS-PAGE, pooled, and dialyzed against PBS.
[0477] Antibody Purification
[0478] Conditioned medium from CHO cell cultures was clarified, filtered, and purified by loading onto an AKTA pure system with a 5 mL MabSelect SuRe® column (GE Healthcare). Antibodies were eluted with 100 mM glycine, pH 3.5 and neutralized with 1 M Tris-C1, pH 8.5.
[0479] Recombinant Antibody Analyses
[0480] Concentration: Concentration of recombinant antibodies was determined on a Fortebio Octet using Protein A tips and a human IgG1 antibody for the standard curve.
[0481] Purity testing by SDS-PAGE: Purity testing was performed by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) of reduced and non-reduced samples. Samples (10 μg) were mixed with loading buffer (+/−β-mercaptoethanol), heated, and electrophoresed on a 4-20% gel (Invitrogen). Bands were visualized by Coomassie InstantBlue™ (Expedeon) staining.
[0482] Purity testing by Endotoxin: Endotoxin concentrations were measured by the Limulus amoebocyte lysate (LAL) kinetic turbidometric method using the Endosafe-PTS™ system (Charles River Laboratories).
[0483] Purity testing by HPLC-SEC: Samples were screened for aggregation or other forms of antibody on a 1260 Infinity System™ (Agilent) with a TSKgel UltraSW Aggregate Guard™ column and HPLC column (Tosoh Bioscience). Samples and standards were detected by absorbance at 280 nm. Comparison against the standard curve provided the molar mass of sample components.
[0484] Affinity: The affinity of antibodies to recombinant ILT3 was determined on an Octet Red™ (Pall, ForteBio) instrument. After loading reagents into a 96-well plate, the Octet Red™ with Protein A-conjugated biosensors was programmed as follows: 30 seconds for baseline #1; 45 seconds to immobilize the antibody; 30 seconds for baseline #2; 300 seconds for association of antibody to recombinant ILT3; and 300 seconds for dissociation of recombinant ILT3 from the antibody. In some cases, the antibody affinity was estimated against cynomolgus ILT3 using a flow based method. Briefly, the assay uses 3-5 fold dilutions from 100 nM to 0.1 nM of a stock antibody concentration (100 nM) diluted in flow buffer. Serial diluted antibodies were incubated with live cells on ice for 30 minutes, after 2 washes, cells were incubated with Alexa Fluro® 647-conjugated anti-human IgG secondary antibodies diluted 1:100, or 15 ug/ml (cat #709-606-149, Jackson ImmunoResearch). Acquisition of the MFI (Median Fluorescent Intensity) was performed on a MACSQuant® Flow Cytometers (Miltenyi Biotec).
[0485] EC50 was calculated using Dose-response EC50 shift by global fitting from GraphPad Prism.
[0486] Binding competition: Binding competition among different antibodies was determined using a real-time, interferometry assay on an Octet Red™ (Pall, ForteBio) instrument with Protein A-conjugated biosensors. To assess whether two antibodies competed for binding to a recombinant ILT3 protein, the assay was performed as follows. Protein A biosensors were first submerged into wells containing 20 μg/mL of individual monoclonal antibodies for 1 minute. Following the capture step, the biosensors were dipped briefly (30 seconds) into buffer and then any unoccupied sites on the biosensor were saturated by submerging them for 5 minutes into wells containing 200 μg/mL of an irrelevant polyclonal antibody. The Octet™ biosensors were then dipped briefly (30 seconds) in buffer before immersion for 1 minute into wells containing recombinant ILT3. The biosensors were dipped briefly (30 seconds) in buffer before immersion for 1 minute into wells containing a second recombinant antibody.
[0487] For the control case where the second antibody was the same as the first, there was no increase in signal, because there was no additional binding to the recombinant target.
[0488] For the control case where buffer was used instead of the first antibody, no recombinant target bound the non-quenching antibody on the biosensor and no second antibody bound the biosensor. For cases where a boost in signal was seen with the second antibody, the two antibodies were determined not to compete. For cases where no boost in signal was seen with the second antibody, the two antibodies were determined to compete for binding.
[0489] Results
[0490] Fully human antibodies against the extracellular domain (ECD) of ILT3 were generated by standard hybridoma procedures as described above. Primary screens of hybridoma supernatants revealed wells that contained antibodies specifically recognizing human ILT3 and the macaque ILT3 homologue. Fused cells in these wells were subcloned to yield monoclonal antibodies that were then sequenced and cloned into heavy and light chain expression plasmids.
[0491] Twenty-one human antibodies were identified. Complete amino acid sequences of the variable heavy and light chains from these twenty-one antibodies are set forth in Table 2, below. Nucleic acid sequences of the variable heavy and light chains are set forth below in Table 3. Note that antibodies 3D8D11, 3H3_24B2, 6B6_24B5, 8C7_24B1 and 4F4_27D3 share the same variable light chain sequence (the amino acid sequence set forth in SEQ ID NO:100).
TABLE-US-00003 TABLE 2 Variable Region Amino Acid Sequences of Human Antibodies SEQ ID Clone Protein NO: Name Domain Protein Sequence 1 1E2F12H8_3D2 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLE WVSIISGSGGDTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTA VYYCAKTDDHGDFFDYWGQGTLVTVSS 2 1E2F12H8_3D2 CDR-H1 GFTFSSYAMS 3 1E2F12H8_3D2 CDR-H2 IISGSGGDTYYADSVKG 4 1E2F12H8_3D2 CDR-H3 TDDHGDFFDY 5 1E2F12H8_3D2 VL DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKL LIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYN SYWTFGQGTKVEIK 6 1E2F12H8_3D2 CDR-L1 RASQSISSWLA 7 1E2F12H8_3D2 CDR-L2 KASSLES 8 1E2F12H8_3D2 CDR-L3 QQYNSYWT 9 1E12H10_7A1 VH QVQLVESGGGVVQPGRSLRLSCATSGFTFSSYGMHWVRQAPGKGLE WVALIWFDGGNQYYADSVKGRFTISRDNSKNTLYLQLNSLRAEDTA VYFCARDVISMVRGVPFDYWGQGTLVTVSS 10 1E12H10_7A1 CDR-H1 GFTFSSYGMH 11 1E12H10_7A1 CDR-H2 LIWFDGGNQYYADSVKG 12 1E12H10_7A1 CDR-H3 DVISMVRGVPFDY 13 1E12H10_7A1 VL DAVVTQESALTTSPGETVTLTCRSSTGAVTTGNYANWVQEKPDHLF TGLIGGIKNRVPGVPARFSGSLIGDRAALTITGAQTEDEAIYFCAL WYSNHWVFGGGTKLTVLG 14 1E12H10_7A1 CDR-L1 RSSTGAVTTGNYAN 15 1E12H10_7A1 CDR-L2 GIKNRVP 16 1E12H10_7A1 CDR-L3 ALWYSNHWV 17 3C4A3_7C5 VH EVQLLESGGGLVQPGGSLRLSCAASGFTESSYAMSWVRQAPGKGLE WVSVISGSGGSTYYADSVKGRFTISRDNSKNTLDLQMNSLRAEDTA VYYCAKLGDYYYGMDVWGQGTTVTVSS 2 3C4A3_7C5 CDR-H1 GFTFSSYAMS 18 3C4A3_7C5 CDR-H2 VISGSGGSTYYADSVKG 19 3C4A3_7C5 CDR-H3 LGDYYYGMDV 20 3C4A3_7C5 VL DIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPG QSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYY CMQALQAPWTFGQGTKLEIK 21 3C4A3_7C5 CDR-L1 RSSQSLLHSNGYNYLD 22 3C4A3_7C5 CDR-L2 LGSNRAS 23 3C4A3_7C5 CDR-L3 MQALQAPWT 24 8E11B6 VH QVQLEESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLE WVAVIWYDGSNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTA VYYCARERETFFYVMDAWGQGASVTVSS 10 8E11B6 CDR-H1 GFTFSSYGMH 25 8E11B6 CDR-H2 VIWYDGSNTYYADSVKG 26 8E11B6 CDR-H3 ERETFFYVMDA 27 8E11B6 VL DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKL LIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFAIYYCQQFN RFITFGQGTRLEIK 6 8E11B6 CDR-L1 RASQSISSWLA 7 8E11B6 CDR-L2 KASSLES 28 8E11B6 CDR-L3 QQFNRFIT 29 17E8_27C5 VH QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYGMHWVRQAPGKGLE WMAGIWFDGTNKYYIDSVKGRFTISRDNSKNTLYLQMNNLRAEDTA VYYCARDVISMVRGVPFDYWGQGTLVTVSS 30 17E8_27C5 CDR-H1 GFTFSNYGMH 31 17E8_27C5 CDR-H2 GIWFDGTNKYYIDSVKG 12 17E8_27C5 CDR-H3 DVISMVRGVPFDY 32 17E8_27C5 VL DAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLF TGLIGGINNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCAL WYSNHWVFGGGTKLTVLGQPKA 33 17E8_27C5 CDR-L1 RSSTGAVTTSNYAN 34 17E8_27C5 CDR-L2 GINNRAP 16 17E8_27C5 CDR-L3 ALWYSNHWV 35 17E8_27C5 VH QVQLVESGGGVVQPGRSLRLSCAASGFTFSTYGIHWVRQAPGKGLE WVAVIWFDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTA VYYCARDVISMVRGVPFDYWGQGTLVTVSS 36 17F4_27C6 CDR-H1 GFTFSTYGIH 37 17F4_27C6 CDR-H2 VIWFDGSNKYYADSVKG 12 17F4_27C6 CDR-H3 DVISMVRGVPFDY 38 17F4_27C6 VL DAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLF TGLIGGINNRVPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCAL WYSNHWVFGGGTKVTVLGQPKA 33 17F4_27C6 CDR-L1 RSSTGAVTTSNYAN 39 17F4_27C6 CDR-L2 GINNRVP 16 17F4_27C6 CDR-L3 ALWYSNHWV 40 11H10_27D4 VH QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYGIHWVRQAPGKGLE WVAVIWFDGNNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTA VYYCARDVITLVRGVPFDYWGQGTLVTVSS 41 11H10_27D4 CDR-H1 GFTFSNYGIH 42 11H10_27D4 CDR-H2 VIWFDGNNKYYADSVKG 43 11H10_27D4 CDR-H3 DVITLVRGVPFDY 44 11H10_27D4 VL DAVVTQESALTTSPGETVTVTCRSSTGAVTTSNYANWVQEKPDHLF TGLIGGINNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCAL WYSNHWVFGGGTKLTVLGQPK 33 11H10_27D4 CDR-L1 RSSTGAVTTSNYAN 34 11H10_27D4 CDR-L2 GINNRAP 16 11H10_27D4 CDR-L3 ALWYSNHWV 45 1C4_24B3 VH QVQLQEAGPGLVNPSKTLSLTCTVSGGSISSYFWSWIRQPPGKGLE WIGYIYNSGSTNYNPSLQSRVTISVDMSKNHFSLKLSSVTAADTAV YYCARRGGYYGSGNYGGMDVWGQGTTVTVSS 46 1C4_24B3 CDR-H1 GGSISSYFWS 47 1C4_24B3 CDR-H2 YIYNSGSTNYNPSLQS 48 1C4_24B3 CDR-H3 RGGYYGSGNYGGMDV 49 1C4_24B3 VL DIQMTQSPSSLSASAGDRVTITCRASQGISNYLAWYQQKPGKVPKL LMYAASALQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYD SAPWTFGQGTKVEIK 50 1C4_24B3 CDR-L1 RASQGISNYLA 51 1C4_24B3 CDR-L2 AASALQS 52 1C4_24B3 CDR-L3 QKYDSAPWT 53 20H6_24C3 VH QVQLQESGPGLLKPSETLSLTCTVSGGSISPYYWSWIRQPPGKGLE WIGYIYYSGNTNYNPSLQSRLTISVDTSKNQFSLKLSSVTAADTAV YYCARRGYSFGFYYGLDVWGQGTTVTVSS 54 20H6_24C3 CDR-H1 GGSISPYYWS 55 20H6_24C3 CDR-H2 YIYYSGNTNYNPSLQS 56 20H6_24C3 CDR-H3 RGYSFGFYYGLDV 57 20H6_24C3 VL DIQMTQSPSSLSASVGDRVTITCRASQDISIYLAWYQQKPGKVPNL LIYLASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYN SAPWTFGQGTKLEIK 58 20H6_24C3 CDR-L1 RASQDISIYLA 59 20H6_24C3 CDR-L2 LASTLQS 60 20H6_24C3 CDR-L3 QKYNSAPWT 61 14E7_27C1 VH QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLE WIGYIYYSGSTNYNPSLKSRLTISVDTSKNQFSLKLSSVTAADTAV YYCARRGYSYGYYYGMDVWGQGTTVTVSS 62 14E7_27C1 CDR-H1 GGSISSYYWS 63 14E7_27C1 CDR-H2 YIYYSGSTNYNPSLKS 64 14E7_27C1 CDR-H3 RGYSYGYYYGMDV 65 14E7_27C1 VL DIQMTQSPSSLSASVGDRVTITCRASQDISNYLAWYQQKPGKVPKL LISPASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYN SAPWTFGQGTKLEIK 66 14E7_27C1 CDR-L1 RASQDISNYLA 67 14E7_27C1 CDR-L2 PASTLQS 60 14E7_27C1 CDR-L3 QKYNSAPWT 68 5A2_24A1 VH QVQLQESGPGLVNPSKTLSLTCTVSGGSISRYFWSWIRQPPGKGLE WIGYIYDSGSTNYNPSLKSRVTISVDTSKNHFSLKLSSVTAADTAV YYCARRGGYYGSGSYGGMDVWGQGTTVTVSS 69 5A2_24A1 CDR-H1 GGSISRYFWS 70 5A2_24A1 CDR-H2 YIYDSGSTNYNPSLKS 71 5A2_24A1 CDR-H3 RGGYYGSGSYGGMDV 72 5A2_24A1 VL DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKIPKL LISAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYD SAPWTFGQGTKVEIK 50 5A2_24A1 CDR-L1 RASQGISNYLA 73 5A2_24A1 CDR-L2 AASTLQS 52 5A2_24A1 CDR-L3 QKYDSAPWT 74 5E3-24B4 VH QVQLQESGPGLVKPSETLSLTCTVSGGSISSHYWNWIRQPPGKGLE WIGYIHYSGGTNYNPSQKSRVTISVDTSKNQFSLKLSSVTAADTAV YYCAGRRYYFDSSGYLDYWGQGTLVTVSS 75 5E3-24B4 CDR-H1 GGSISSHYWN 76 5E3-24B4 CDR-H2 YIHYSGGTNYNPSQKS 77 5E3-24B4 CDR-H3 RRYYFDSSGYLDY 78 5E3-24B4 VL DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKIPKL LIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYN SAPWTFGQGTKLEIK 50 5E3-24B4 CDR-L1 RASQGISNYLA 73 5E3-24B4 CDR-L2 AASTLQS 60 5E3-24B4 CDR-L3 QKYNSAPWT 79 7C12_24A6 VH QVQLQESGPGLVNPSKTLSLTCTVSGGSISSYFWSWIRQPPGKGLE WIGYIYDSGSTNYNPSLKSRVTISVDTSKNHFSLKLSSVTAADTAV YYCARRGGYYGSGSYGGMDVWGQGTTVTVSS 46 7C12_24A6 CDR-H1 GGSISSYFWS 70 7C12_24A6 CDR-H2 YIYDSGSTNYNPSLKS 71 7C12_24A6 CDR-H3 RGGYYGSGSYGGMDV 80 7C12_24A6 VL DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKVPKL LISAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYN SAPWTFGQGTKLEIK 50 7C12_24A6 CDR-L1 RASQGISNYLA 73 7C12_24A6 CDR-L2 AASTLQS 60 7C12_24A6 CDR-L3 QKYNSAPWT 81 6H9_27D5 VH QVELQQSGPGLVKPSETLSLTCTVSGGSISTYFWSWTRQPPGKGLE WIGYTNYRGNTNYNPSLESRVTISVDTSKNQFSLKLSSVTAADTAV YYCARRGGYYGSGNYGGMDVWGQGTTVTVSS 82 6H9_27D5 CDR-H1 GGSISTYFWS 83 6H9_27D5 CDR-H2 YTNYRGNTNYNPSLES 48 6H9_27D5 CDR-H3 RGGYYGSGNYGGMDV 84 6H9_27D5 VL DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKVPKL LIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDLATYYCQKYD SAPWTFGQGTKLEIK 50 6H9_27D5 CDR-L1 RASQGISNYLA 73 6H9_27D5 CDR-L2 AASTLQS 52 6H9_27D5 CDR-L3 QKYDSAPWT 85 10A5_24A2 VH QLQLQESGPGLVNPSKTLSLTCNVSGGSMSNYFWSWIRQPPGKGLE WIGYIYNSGNTNYHPSLQSRVTISVDTSKNLFSLKLTSVTAADTAV YYCARRGGYYGSGNYGGLDVWGHGTTVTVSS 86 10A5_24A2 CDR-H1 GGSMSNYFWS 87 10A5_24A2 CDR-H2 YIYNSGNTNYHPSLQS 88 10A5_24A2 CDR-H3 RGGYYGSGNYGGLDV 89 10A5_24A2 VL DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKVPKL LIYAASTLQSGVPSRFSGTGSGTDFTLTISSLQPEDVATYYCQKYD SAPWTFGQGTKVEIK 50 10A5_24A2 CDR-L1 RASQGISNYLA 73 10A5_24A2 CDR-L2 AASTLQS 52 10A5_24A2 CDR-L3 QKYDSAPWT 90 16B10_27D2 VH QVQLVESGGGVVQPGRSLRLSCAASGFTFNNYGMHWVRQAPGRGLE WVAIIWNDGSNPYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTA VYYCVRDSSSWFVNYFDYWGQGTLVTVSS 91 16B10_27D2 CDR-H1 GFTFNNYGMH 92 16B10_27D2 CDR-H2 IIWNDGSNPYYADSVKG 93 16B10_27D2 CDR-H3 DSSSWFVNYFDY 94 16B10_27D2 VL EIVMTQSPATLSVSPGERATLSCRASQSVNRNLAWYQQKPGQAPRL LIYGASTRATGIPASFSGSGSGTEFTLTISSLQSEDFAVYYCQHYN HWPLTFGGGTKVEIK 95 16B10_27D2 CDR-L1 RASQSVNRNLA 96 16B10_27D2 CDR-L2 GASTRAT 97 16B10_27D2 CDR-L3 QHYNHWPLT 98 3D8D11 VH QVQLQESGPGLVKPSETLSLTCTVSGGSISSYFWSWIRQPPGKGLE WIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAV YYCARRGGYSYGYGYYGMDVWGQGTTVTVSS 46 3D8D11 CDR-H1 GGSISSYFWS 63 3D8D11 CDR-H2 YIYYSGSTNYNPSLKS 99 3D8D11 CDR-H3 GGYSYGYGYYGMDV 100 3D8D11 VL DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKVPKL LIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYN SAPWTFGQGTKLEIK 50 3D8D11 CDR-L1 RASQGISNYLA 73 3D8D11 CDR-L2 AASTLQS 60 3D8D11 CDR-L3 QKYNSAPWT 101 3H3_24B2 VH QIQLQESGPGLVNPSKTLSLTCTVSGGSIRSYFWSWIRQPPGKGLE WIGYIYDSGNTNYNPSLKSRVTISVDTSKNHFSLKLSSVTAADTAV YYCARRGGYYGSGNYGGMDVWGQGTTVTVSS 102 3H3_24B2 CDR-H1 GGSIRSYFWS 103 3H3_24B2 CDR-H2 YIYDSGNTNYNPSLKS 48 3H3_24B2 CDR-H3 RGGYYGSGNYGGMDV 100 3H3_24B2 VL DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKVPKL LIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYN SAPWTFGQGTKLEIK 50 3H3_24B2 CDR-L1 RASQGISNYLA 73 3H3_24B2 CDR-L2 AASTLQS 60 3H3_24B2 CDR-L3 QKYNSAPWT 104 6B6_24B5 VH QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLE WIGYIHYSGSTNYNPSLKSRVTISEDTSKNQFSLKLSSVTAADTAV FYCAGRRYYFDSSGYFDYWGQGTLVTVSS 62 6B6_24B5 CDR-H1 GGSISSYYWS 105 6B6_24B5 CDR-H2 YIHYSGSTNYNPSLKS 106 6B6_24B5 CDR-H3 RRYYFDSSGYFDY 100 6B6_24B5 VL DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKVPKL LIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYN SAPWTFGQGTKLEIK 50 6B6_24B5 CDR-L1 RASQGISNYLA 73 6B6_24B5 CDR-L2 AASTLQS 60 6B6_24B5 CDR-L3 QKYNSAPWT 107 8C7_24B1 VH QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLE WIGYIHYSGSTNYNPSLKSRVTISEDTSKNQFSLKLSSVTAADTAV FYCAGRRYYYDSSGYLDYWGQGTLVTVSS 62 8C7_24B1 CDR-H1 GGSISSYYWS 105 8C7_24B1 CDR-H2 YIHYSGSTNYNPSLKS 106 8C7_24B1 CDR-H3 RRYYYDSSGYLDY 100 8C7_24B1 VL DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKVPKL LIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYN SAPWTFGQGTKLEIK 50 8C7_24B1 CDR-L1 RASQGISNYLA 73 8C7_24B1 CDR-L2 AASTLQS 60 8C7_24B1 CDR-L3 QKYNSAPWT 108 4F4_27D3 VH QVQLQESGPGLVKPSETLSLTCTVSGGSISSHYWSWIRQPPGKGLE WIGYIYYNGGTNYKPSLKSRVTISVDTSKNQFSLKLTSVTAADTAV YYCAGRRYYYDSSGYLDYWGQGTLVTVSS 109 4F4_27D3 CDR-H1 GGSISSHYWS 110 4F4_27D3 CDR-H2 YIYYNGGTNYKPSLKS 106 4F4_27D3 CDR-H3 RRYYYDSSGYLDY 100 4F4_27D3 VL DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKVPKL LIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYN SAPWTFGQGTKLEIK 50 4F4_27D3 CDR-L1 RASQGISNYLA 73 4F4_27D3 CDR-L2 AASTLQS 60 4F4_27D3 CDR-L3 QKYNSAPWT
TABLE-US-00004 TABLE 3 Nucleic Acid Variable Region Sequences of Human Antibodies SEQ ID Clone Protein NO: Name Domain DNA Sequence 111 1E2F12H8_3D2 VH GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGT CCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTAGCAGCTATGC CATGAGTTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCA ATTATTAGTGGTAGTGGTGGTGACACATACTACGCAGACTCCGTGAAGG GCCGGTTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCA GATGAACAGCCTGAGAGCCGAGGACACGGCCGTATATTACTGTGCGAAA ACCGATGACCACGGTGACTTCTTTGACTACTGGGGCCAGGGAACCCTGG TCACCGTCTCCTCA 112 1E2F12H8_3D2 VL GACATCCAGATGACCCAGTCTCCTTCCACCCTGTCTGCATCTGTAGGAG ACAGAGTCACCATCACTTGCCGGGCCAGTCAGAGTATTAGTAGCTGGTT GGCCTGGTATCAGCAGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTAT AAGGCGTCTAGTTTAGAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTG GATCTGGGACAGAATTCACTCTCACCATCAGCAGCCTGCAGCCTGATGA TTTTGCAACTTATTACTGCCAACAGTATAATAGTTATTGGACGTTCGGC CAAGGGACCAAGGTGGAGATCAAA 113 1E12H10_7A1 VH CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGT CCCTGAGACTCTCCTGTGCAACGTCTGGATTCACCTTCAGTAGCTATGG CATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCA CTTATATGGTTTGATGGAGGTAATCAATACTATGCGGACTCCGTGAAGG GCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATTTGCA ATTGAACAGTCTGAGAGCCGAAGACACGGCTGTGTATTTCTGTGCGAGA GATGTGATCAGTATGGTTCGGGGAGTCCCTTTTGACTACTGGGGCCAGG GAACCCTGGTCACCGTCTCCTCA 114 1E12H10_7A1 VL GACGCTGTTGTGACTCAGGAATCTGCACTCACCACATCACCTGGTGAAA CAGTCACACTCACTTGTCGCTCAAGTACTGGGGCTGTTACAACTGGTAA CTATGCCAACTGGGTCCAAGAAAAACCAGATCATTTATTCACTGGTCTA ATAGGTGGTATTAAGAACCGAGTTCCAGGTGTTCCTGCCAGATTCTCAG GCTCCCTGATTGGAGACAGGGCTGCCCTCACCATCACAGGGGCACAGAC TGAGGATGAGGCAATATATTTCTGTGCTCTATGGTACAGTAATCATTGG GTGTTCGGTGGAGGAACCAAACTGACTGTCCTAGGC 115 3C4A3_7C5 VH GAGGTGCAGCTATTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGT CCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTAGCAGCTATGC CATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCA GTTATTAGTGGTAGTGGTGGTAGCACATACTACGCAGACTCCGTGAAGG GCCGGTTCACCATCTCCAGAGACAATTCCAAGAACACGCTGGATCTGCA AATGAACAGCCTGAGAGCCGAGGACACGGCCGTATATTACTGTGCGAAA TTGGGGGACTACTACTACGGTATGGACGTCTGGGGCCAAGGGACCACGG TCACCGTCTCCTCA 116 3C4A3_7C5 VL GATATTGTGATGACTCAGTCTCCACTCTCCCTGCCCGTCACCCCTGGAG AGCCGGCCTCCATCTCCTGCAGGTCTAGTCAGAGCCTCCTGCATAGTAA TGGATACAACTATTTGGATTGGTACCTGCAGAAGCCAGGGCAGTCTCCA CAGCTCCTGATCTATTTGGGTTCTAATCGGGCCTCCGGGGTCCCTGACA GGTTCAGTGGCAGTGGATCAGGCACAGATTTTACACTGAAAATCAGCAG AGTGGAGGCTGAGGATGTTGGGGTTTATTACTGCATGCAAGCTCTACAA GCTCCGTGGACGTTCGGCCAAGGGACCAAGCTGGAGATCAAA 117 8E11B6 VH CAGGTGCAGCTGGAGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGT CCCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCTTCAGTAGCTATGG CATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCA GTTATATGGTATGATGGAAGTAATACATACTATGCAGACTCCGTGAAGG GCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCA AATGAACAGCCTGAGAGCCGAGGACACGGCTGTGTATTATTGTGCGAGA GAGAGGGAAACTTTTTTTTATGTTATGGATGCCTGGGGTCAAGGAGCTC GGTCACCGTCTCCTCA 118 8E11B6 VL GACATCCAGATGACCCAGTCTCCTTCCACCCTGTCTGCATCTGTAGGAG ACAGAGTCACCATCACTTGCCGGGCCAGTCAGAGTATTAGTAGCTGGTT GGCCTGGTATCAGCAGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTAT AAGGCGTCTAGTTTAGAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTG GATCTGGGACAGAATTCACTCTCACCATCAGCAGCCTGCAGCCTGATGA TTTTGCAATTTATTACTGCCAACAGTTTAATCGTTTTATCACCTTCGGC CAAGGGACACGACTGGAGATTAAA 119 17E8_27C5 VH CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGT CCCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCTTTAGTAACTATGG CATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGATGGCA GGCATATGGTTTGATGGAACTAACAAATACTATATAGACTCCGTGAAGG GCCGATTCACCATTTCCAGAGACAACTCCAAGAACACGCTGTATCTGCA AATGAACAACCTGAGAGCCGAGGACACGGCTGTGTATTATTGTGCGAGA GATGTAATTAGTATGGTTCGGGGAGTCCCCTTTGACTACTGGGGCCAGG GAACCCTGGTCACCGTCTCCTCA 120 17E8_27C5 VL GACGCTGTTGTGACTCAGGAATCTGCACTCACCACATCACCTGGTGAAA CAGTCACACTCACTTGTCGCTCAAGTACTGGGGCTGTTACAACTAGTAA CTATGCCAACTGGGTCCAAGAAAAACCAGATCATTTATTCACTGGTCTA ATAGGTGGTATCAACAACCGAGCTCCAGGTGTTCCTGCCAGATTCTCAG GCTCCCTGATTGGAGACAAGGCTGCCCTCACCATCACAGGGGCACAGAC TGAGGATGAGGCAATATATTTCTGTGCTCTATGGTACAGCAACCATTGG GTGTTCGGTGGAGGAACCAAACTGACTGTCCTAGGCCAGCCCAAGGCT 121 17F4_27C6 VH CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGT CCCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCTTCAGTACCTATGG CATTCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCA GTTATATGGTTTGATGGAAGTAATAAATACTATGCAGACTCCGTGAAGG GCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCA AATGAACAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAGA GATGTAATTAGTATGGTTCGGGGAGTCCCCTTTGACTACTGGGGCCAGG GAACCCTGGTCACCGTCTCCTCA 122 17F4_27C6 VL GACGCTGTTGTGACTCAGGAATCTGCACTCACCACATCACCTGGTGAAA CAGTCACACTCACTTGTCGCTCAAGTACTGGGGCTGTTACAACTAGTAA CTATGCCAACTGGGTCCAAGAAAAACCAGATCATTTATTCACTGGTCTA ATAGGTGGTATCAACAACCGAGTTCCAGGTGTTCCTGCCAGATTCTCAG GCTCCCTGATTGGAGACAAGGCTGCCCTCACCATCACAGGGGCACAGAC TGAGGATGAGGCAATATATTTCTGTGCTCTATGGTACAGCAACCATTGG GTGTTCGGTGGAGGAACCAAGGTGACTGTCCTAGGCCAGCCCAAGGCT 123 11H10_27D4 VH CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGT CCCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCTTCAGTAACTATGG CATTCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCA GTTATATGGTTTGATGGAAATAATAAATACTATGCAGACTCCGTGAAGG GCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCA AATGAACAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAGA GACGTCATTACTTTGGTTCGGGGAGTCCCTTTTGACTACTGGGGCCAGG GAACCCTGGTCACCGTCTCCTCA 124 11H10_27D4 VL GACGCTGTTGTGACTCAGGAATCTGCACTCACCACATCACCTGGTGAAA CAGTCACAGTCACTTGTCGCTCAAGTACTGGGGCTGTTACAACTAGTAA CTATGCCAATTGGGTCCAAGAAAAACCAGATCATTTATTCACTGGTCTA ATAGGTGGTATCAACAACCGAGCTCCAGGTGTTCCTGCCAGATTCTCAG GCTCCCTGATTGGAGACAAGGCTGCCCTCACCATCACAGGGGCACAGAC TGAGGATGAGGCAATATATTTCTGTGCTCTCTGGTACAGCAACCATTGG GTGTTCGGTGGAGGAACCAAGTTGACTGTCCTAGGCCAGCCCAAG 125 1C4_24B3 VH CAGGTGCAACTGCAGGAGGCGGGCCCAGGACTGGTGAACCCTTCGAAGA CCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTAGTTACTT CTGGAGCTGGATCCGGCAGCCCCCAGGAAAGGGACTGGAGTGGATTGGT ATATCTATAACAGTGGGAGCACCAACTACAACCCCTCCCTCCAGAGTCG AGTCACCATATCAGTAGACATGTCCAAGAACCACTTCTCCCTGAAGCTG AGCTCTGTGACCGCTGCGGACACGGCCGTATATTACTGTGCGAGAAGGG GGGGTTACTATGGTTCGGGGAATTATGGTGGTATGGACGTCTGGGGCCA AGGGACCACGGTCACCGTCTCCTCA 126 1C4_24B3 VL GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGCAGGAG ACAGAGTCACCATCACTTGCCGGGCGAGTCAGGGCATTAGCAATTATTT AGCCTGGTACCAGCAGAAACCAGGGAAAGTTCCTAAGCTCCTGATGTAT GCTGCATCCGCTTTGCAATCAGGGGTCCCATCTCGGTTCAGTGGCAGTG GATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGA TGTCGCAACTTATTACTGTCAAAAGTATGACAGTGCCCCGTGGACGTTC GGCCAAGGGACCAAGGTGGAGATCAAA 127 20H6_24C3 VH CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGCTGAAGCCTTCGGAGA CCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTCCTTACTA CTGGAGCTGGATCCGGCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGG TATATCTATTACAGTGGGAACACCAACTACAACCCCTCCCTCCAGAGCC GACTCACCATATCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAGCT GAGCTCTGTGACCGCTGCGGACACGGCCGTATATTACTGTGCGAGACGT GGATACAGTTTTGGTTTCTACTACGGTTTGGACGTCTGGGGCCAAGGGA CCACGGTCACCGTCTCCTCA 128 20H6_24C3 VL GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAG ACAGAGTCACCATCACTTGCCGGGCGAGTCAGGACATTAGCATTTATTT AGCCTGGTATCAGCAGAAACCAGGGAAAGTTCCTAACCTCCTGATCTAT CTTGCTTCCACTTTGCAATCAGGGGTCCCATCTCGGTTCAGTGGCAGTG GATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGA TGTTGCAACTTATTACTGTCAAAAGTATAACAGTGCCCCGTGGACGTTC GGCCAAGGGACCAAGCTGGAGATCAAA 129 14E7_27C1 VH CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGA CCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTAGTTACTA CTGGAGCTGGATCCGGCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGG TATATCTATTACAGTGGGAGCACCAACTACAACCCCTCCCTCAAGAGCC GACTCACCATATCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAGCT GAGCTCTGTGACCGCTGCGGACACGGCCGTATATTACTGTGCGAGACGT GGATACAGCTATGGTTACTACTACGGTATGGACGTCTGGGGCCAAGGGA CCACGGTCACCGTCTCCTCA 130 14E7_27C1 VL GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAG ACAGAGTCACCATCACTTGCCGGGCGAGTCAGGACATTAGCAATTATTT AGCCTGGTATCAGCAGAAACCAGGGAAAGTTCCTAAGCTCCTGATCTCT CCTGCATCCACTTTGCAATCAGGGGTCCCATCTCGGTTCAGTGGCAGTG GATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGA TGTTGCAACTTATTACTGTCAAAAGTATAACAGTGCCCCGTGGACGTTC GGCCAAGGGACCAAGCTGGAGATCAAA 131 5A2_24A1 VH CAGGTGCAACTGCAGGAGTCGGGCCCAGGACTGGTGAACCCTTCGAAGA CCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTAGGTACTT CTGGAGCTGGATCCGGCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGG TATATCTATGACAGTGGGAGCACCAACTACAACCCCTCCCTCAAGAGTC GAGTCACCATATCAGTAGACACGTCCAAGAACCACTTCTCCCTGAAGCT GAGCTCTGTCACCGCTGCGGACACGGCCGTGTATTACTGTGCGAGAAGG GGGGGTTACTATGGTTCGGGGAGTTATGGTGGTATGGACGTCTGGGGCC AAGGGACCACGGTCACCGTCTCCTCA 132 5A2_24A1 VL GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAG ACAGAGTCACCATCACTTGCCGGGCGAGTCAGGGCATTAGCAATTATTT AGCCTGGTATCAGCAGAAACCAGGGAAAATTCCTAAGCTCCTGATCTCT GCTGCATCCACTTTGCAATCAGGGGTCCCATCTCGGTTCAGTGGCAGTG GATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGA TGTTGCAACTTATTACTGTCAAAAGTATGACAGTGCCCCGTGGACGTTG GCCAAGGGACCAAGGTGGAGATCAAA 133 5E3-24B4 VH CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGA CCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTAGTCACTA CTGGAACTGGATCCGGCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGG TACATCCATTACAGTGGGGGCACCAACTACAACCCCTCCCAAAAGAGTC GAGTCACCATATCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAGCT GAGCTCTGTGACCGCTGCGGACACGGCCGTGTATTACTGTGCGGGGAGG AGGTATTACTTTGATAGTAGTGGTTATCTTGACTACTGGGGCCAGGGAA CCCTGGTCACCGTCTCCTCA 134 5E3-24B4 VL GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAG ACAGAGTCACCATCACTTGCCGGGCGAGTCAGGGGATTAGCAATTATTT AGCCTGGTATCAGCAGAAACCAGGGAAAATTCCTAAGCTCCTGATCTAT GCTGCATCCACTTTGCAATCAGGGGTCCCATCTCGGTTCAGTGGCAGTG GATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGA TGTTGCAACTTATTACTGTCAAAAGTATAACAGTGCCCCGTGGACGTTC GGCCAAGGGACCAAGCTGGAGATCAAA 135 7C12_24A6 VH CAGGTGCAACTGCAGGAGTCGGGCCCAGGACTGGTGAACCCTTCGAAGA CCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTAGTTACTT CTGGAGCTGGATCCGGCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGG TATATCTATGACAGTGGGAGCACCAACTACAACCCCTCCCTCAAGAGTC GAGTCACCATATCAGTAGACACGTCCAAGAACCACTTCTCCCTGAAGCT GAGCTCTGTGACCGCTGCGGACACGGCCGTGTATTACTGTGCGAGAAGG GGGGGTTACTATGGTTCGGGGAGTTATGGTGGTATGGACGTCTGGGGCC AAGGGACCACGGTCACCGTCTCCTCA 136 7C12_24A6 VL GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAG ACAGAGTCACCATCACTTGCCGGGCGAGTCAGGGCATTAGCAATTATTT AGCCTGGTATCAGCAGAAACCAGGGAAAGTTCCTAAGCTCCTGATCTCT GCTGCATCCACTTTGCAATCAGGGGTCCCATCTCGGTTCAGTGGCAGTG GATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGA TGTTGCAACTTATTACTGTCAAAAGTATAACAGTGCCCCGTGGACGTTC GGCCAAGGGACCAAGCTGGAGATCAAA 137 6H9_27D5 VH CAGGTGGAGCTGCAGCAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGA CCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTACTTACTT CTGGAGCTGGACCCGGCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGG TATACCAACTACAGAGGAAACACCAACTACAACCCCTCCCTCGAGAGTC GAGTCACCATATCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAGCT GAGCTCTGTGACCGCTGCGGACACGGCCGTGTATTACTGTGCGAGAAGG GGGGGTTATTATGGTTCGGGGAATTATGGTGGTATGGACGTCTGGGGCC AAGGGACCACGGTCACCGTCTCCTCA 138 6H9_27D5 VL GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAG ACAGAGTCACCATCACTTGCCGGGCGAGTCAGGGCATTAGCAATTATTT AGCCTGGTATCAGCAGAAACCAGGGAAAGTTCCTAAACTCCTGATCTAT GCTGCATCCACTTTGCAATCAGGGGTCCCATCTCGATTCAGTGGCAGTG GATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGA TCTTGCAACTTATTACTGTCAAAAGTATGACAGTGCCCCGTGGACGTTC GGCCAAGGGACCAAGCTGGAGATCAAA 139 10A5_24A2 VH CAGTTGCAACTGCAGGAGTCGGGCCCAGGACTGGTGAACCCTTCGAAGA CCCTGTCCCTCACCTGCAATGTCTCTGGTGGCTCCATGAGTAATTACTT CTGGAGCTGGATCCGGCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGG TACATCTATAATTCTGGGAACACCAACTACCACCCCTCCCTCCAGAGTC GAGTCACCATATCAGTAGACACGTCCAAGAACCTCTTCTCCCTGAAGCT GACCTCTGTGACCGCTGCGGACACGGCCGTGTATTATTGTGCGAGAAGG GGGGGTTACTATGGTTCGGGGAATTATGGTGGTTTGGACGTCTGGGGCC ACGGGACCACGGTCACCGTCTCCTCA 140 10A5_24A2 VL GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAG ACAGAGTCACCATCACTTGCCGGGCGAGTCAGGGCATTAGCAATTATTT AGCCTGGTATCAGCAGAAACCAGGGAAAGTTCCTAAGCTCCTGATCTAT GCTGCATCCACTTTGCAATCAGGGGTCCCATCTCGGTTCAGTGGCACTG GATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGA TGTTGCAACTTATTACTGTCAAAAGTATGACAGTGCCCCGTGGACGTTC GGCCAAGGGACCAAGGTGGAGATCAAA 141 16B10_27D2 VH CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGT CCCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCTTCAATAACTATGG CATGCACTGGGTCCGCCAGGCTCCTGGCAAGGGGCTGGAGTGGGTGGCA ATTATATGGAATGATGGAAGTAATCCATACTATGCAGACTCCGTGAAGG GCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCA AATGAACAGCCTGAGAGCCGAAGACACGGCTGTATATTACTGTGTGAGA GATAGCAGCAGCTGGTTCGTGAACTACTTTGACTACTGGGGCCAGGGAA CCCTGGTCACCGTCTCCTCA 142 16B10_27D2 VL GAAATAGTGATGACGCAGTCTCCAGCCACCCTGTCTGTGTCTCCAGGGG AAAGAGCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAATAGGAACTT AGCCTGGTACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTAT GGTGCATCCACCAGGGCCACTGGTATCCCAGCCAGTTTCAGTGGCAGTG GGTCTGGGACAGAGTTCACTCTCACCATCAGCAGCCTGCAGTCTGAAGA TTTTGCAGTTTATTACTGTCAGCATTATAATCACTGGCCGCTCACTTTC GGCGGAGGGACCAAGGTGGAGATCAAA 143 3D8D11 VH CAGGTGCAGCTACAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGA CCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTAGTTACTT CTGGAGCTGGATCCGGCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGG TATATCTATTACAGTGGGAGCACCAACTACAACCCCTCCCTCAAGAGTC GAGTCACCATATCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAGCT GAGTTCTGTGACCGCTGCGGACACGGCCGTGTATTACTGTGCGAGAAGG GGGGGATACAGCTATGGTTACGGCTACTACGGTATGGACGTCTGGGGCC AAGGGACCACGGTCACCGTCTCCTCA 144 3D8D11 VL GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAG 3H3_24B2 ACAGAGTCACCATCACTTGCCGGGCGAGTCAGGGCATTAGCAATTATTT 6B6_24B5 AGCCTGGTATCAGCAGAAACCAGGGAAAGTTCCTAAGCTCCTGATCTAT 8C7_24B1 GCTGCATCCACTTTGCAATCAGGGGTCCCATCTCGGTTCAGTGGCAGTG 4F4_27D3 GATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGA TGTTGCAACTTATTACTGTCAAAAGTATAACAGTGCCCCGTGGACGTTC GGCCAAGGGACCAAGCTGGAGATCAAA 145 3H3_24B2 VH CAGATACAACTGCAGGAGTCGGGCCCAGGACTGGTGAACCCTTCGAAGA CCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGAAGTTACTT CTGGAGCTGGATCCGGCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGG TATATCTATGACAGTGGGAACACCAACTACAACCCCTCCCTCAAGAGTC GAGTCACCATATCAGTAGACACGTCCAAGAACCACTTCTCCCTGAAGCT GAGTTCTGTGACCGCTGCGGACACGGCCGTGTATTACTGTGCGAGAAGG GGGGGTTACTATGGTTCGGGGAATTATGGTGGTATGGACGTCTGGGGCC AAGGGACCACGGTCACCGTCTCCTCA 146 6B6_24B5 VH CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGA CCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTAGTTACTA CTGGAGCTGGATCCGGCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGG TATATCCATTACAGTGGGAGCACCAACTACAATCCCTCCCTCAAGAGTC GAGTCACCATATCAGAAGACACGTCCAAGAACCAGTTCTCCCTGAAGCT GAGCTCTGTGACCGCTGCGGACACGGCCGTGTTTTACTGTGCGGGGAGG AGGTATTACTTTGATAGTAGTGGTTATTTTGACTACTGGGGCCAGGGAA CCCTGGTCACCGTCTCCTCA 147 8C7_24B1 VH CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGA CCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTAGTTACTA CTGGAGCTGGATCCGGCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGG TATATCCATTACAGTGGGAGCACCAACTACAACCCCTCCCTCAAGAGTC GAGTCACCATATCAGAAGACACGTCCAAGAACCAGTTCTCCCTGAAGCT GAGCTCTGTGACCGCTGCGGACACGGCCGTGTTTTACTGTGCGGGGAGG AGGTATTACTATGATAGTAGTGGTTATCTTGACTACTGGGGCCAGGGAA CCCTGGTCACCGTCTCCTCA 148 4F4_27D3 VH CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGA CCCTGTCCCTCACCTGCACCGTCTCTGGTGGCTCCATCAGTAGCCACTA CTGGAGCTGGATCCGGCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGG TATATCTATTACAATGGGGGCACCAACTACAAACCCTCCCTAAAGAGTC GAGTCACCATATCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAGCT GACCTCTGTGACCGCTGCGGACACGGCCGTGTATTACTGTGCGGGGAGG AGGTATTACTATGATAGTAGTGGCTATCTTGACTATTGGGGCCAGGGAA CCCTGGTCACCGTCTCCTCA
[0492] Binding affinity curves for four antibodies: E2F12H8, E12H10, 3C4A3, and 8E11B6 are set forth in
[0493] Binding kinetic values against human ILT3 (for all antibodies set forth in Table 2) and against cynomolgus monkey ILT3 (for antibodies E2F12H8, E12H10, 3C4A3, and 8E11B6) are set forth in Table 4, below.
TABLE-US-00005 TABLE 4 Binding affinities of human anti-human ILT3 antibodies Antibody Human ILT3 Cynomolgus Monkey Name K.sub.D (nM) ILT3 K.sub.D (nM) 1E12H10_7A1 3 200 1E2F12H8_3D2 6 27 8E11B6 10 >1,000 3C4A3_7C5 21 56 6H9_27D5 1 20H6_24C3 1 11H10_27D4 1 16B10_27D2 1 5E3-24B4 2 17E8_27C5 2 10A5_24A2 2 17F4_27C6 3 6B6_24B5 8 1C4_24B3 12 5A2_24A1 30 4F4_27D3 30 3H3_24B2 40 7C12_24A6 50 8C7_24B1 60 14E7_27C1 75 3D8D11 170
[0494] EC50 values of antibodies 5E3, 6B6, 6H9, 20H6, 17E8, 3C4A3, 1E12 (also referred to herein as 1E12H10), 1E2 (also referred to herein as 1E2F12H8), and 3D8, range from 6 to greater than 100 nM affinities (see
Example 3. In Vitro Target Internalization and Killing Assay
[0495] Given that myeloid derived suppressor cells (MDSC) infiltrating solid tumors have been shown to express ILT3 (de Goeje, P. L. et al, OncoImmunology. 2016; 4, e1014242-1-e1014242-11) and that targeting and eliminating MDSCs promotes anti-tumor response by tumor infiltrating lymphocytes (TILS) (Stromnes, I. M. et al, Gut. 2014; 63, 1769-1781), developing antibodies conjugated to a toxin that can promote ILT3 internalization is of interest. Thus, the target internalization and killing ability of ten recombinant antibodies (3D8, 6H9, 20H6, 6B6, 5E3, 17E8, 1E12H10 (also referred to herein as 1E12 or E12H10), 3C4A3, 1E2F12H8 (also referred to herein as 1E2 or E2F12H8), and 8E11 conjugated to the saporin toxin was determined.
[0496] Method
[0497] In Vitro Killing of Cells Endogenously Expressing ILT3 Using a Secondary ADC Assay ILT3.sup.+ THP1 cells were cultured at least 48 hours before seeding at 5,000 cells/well on 96 well flat clear bottom black polystyrene tissue culture treated microplates (Corning Lifescience, Tewksbury, Mass.) in 60 ul RPMI+10% FBS/well. THP1 is a human acute monocytic leukemia (AML) cell line (see, e.g., Chanput, W., et al. Int Immunopharmacol. 2014 November; 23(1):37-45). Twenty-four hours later, master mix of the anti-ILT3 antibody was prepared by diluting the antibody with complete culture media at a concentration of 0.5 μg/ml (final concentration 0.1 ug/ml). The secondary anti-human IgG antibody conjugated to saporin, Fab-ZAP human IT 51™ (Advanced Targeting Systems, San Diego, Calif.), was diluted to a concentration of 2 μg/ml (final concentration 0.4 μg/ml) with complete culture media. Twenty microliters per well of the primary antibody or media alone were added onto the cell plates using a multichannel repeater pipet, minimizing the introduction of bubbles to the wells.
[0498] Within 5 minutes, 20 μL/well of secondary ADC or media alone were added onto the cell plates. Plates were incubated for 72 hours at 37° C. At 72 hours, the CellTiter Glo™ reagent (Promega, Madison, Wis.) was thawed and equilibrated to room temperature as well as the plate for 10 min, 100 μL of prepared CellTiter Glo™ was added to each well, followed by a gentle shake with an orbital shaker. The plates were incubated for 30 minutes at room temperature and read with an EnSpire™ multimode plate luminometer (Perkin Elmer, Waltham, Mass.).
[0499] Results
[0500] As set forth in
Example 4. In Vitro Effects of Blocking ILT3 in Combination with Other Immune-Oncology Targets on T Cell Activation and Effector Function
[0501] ILT3 has been shown to directly inhibit T cell activation, proliferation and effector cell function (Kim-Schulze et al., 2006, Journal of Immunology 176, 2790-2798), which is driven by binding of ILT3 to a yet unidentified receptor on T cells. Blockade of ILT3 with antibodies has been shown to reverse T cell tolerization, resulting in T cell activation and IFNγ secretion (Suciu-Foca et al., 2007, Journal of Immunology 178, 7432-7441). This Example describes the effects of blocking ILT3 with an ILT3 antibody in combination with immune-oncology antibodies that target other immuno-regulator antigens, such as anti-PD1, anti-PD-L1 and anti-CTLA4 antibodies.
[0502] Method
[0503] Effects of In Vitro Blockade of ILT3, PD1, PD-L1 and CTLA4 with Monoclonal Antibodies on T Cell Activation
[0504] Purified monocytes were cultured at a density of 1×10.sup.6 cells per mL with 100 ng/mL of human GM-CSF (CST, #8922) and human IL-4 (CST, #8919) for 7 days, media was replaced and replenished with fresh cytokine every 2 days. The differentiation of CD14.sup.−CD11.sup.highCD831 .sup.low immature dendritic cells (DC) was confirmed by flow cytometric analysis, which was >98% routinely. DCs were then incubated for an additional day with 100 units/mL of recombinant human IL-10 (R&D Systems) and human IFNα-2b (PBL assay science, #11145-1). Expression of ILT3 was determined after 1 day in culture by flow cytometry. Cytokine treated monocyte derived dendritic cells (MDDC) were cultured with CD25.sup.− peripheral blood allogeneic T cells, from healthy donors, at a 1:10 (MDDC:T cell) ratio for a period of 6 days in the presence of 20 μg/mL of anti-human ILT3 fully human antibodies of the invention (
[0505] Flow Cytometry to Determine T Cell Activation
[0506] Multicolor flow cytometry was used to determine activation status of T cells cultured in mixed lymphocyte reactions in the presence or absence of anti-PD1, anti-PD-L1, anti-CTLA4 or anti-ILT3 antibodies as single agents or in combination studies, whereby anti-ILT3 antibodies were combined with either anti-PD1, anti-PD-L1 or anti-CTLA4 antibodies. T cell subsets were identified by staining with antibodies against CD3, CD4 or CD8. Activation was determined by expression of CD25, using fluorochrome labeled anti-CD25 antibodies. Cells were stained using standard flow cytometry procedure. Briefly, cells were collected from tissue culture plates, washed twice with flow buffer (1×PBS, 0.5% BSA, 2 mM EDTA). After the second wash, the cells were counted and the concentration was adjusted to 1×10.sup.6 cells per 1 mL. Cells were transferred to 96-V bottom polypropylene plates and spun at 1250 rpm for 5 minutes at 4° C. to pellet the cells. The cell pellets were resuspended with a mix of antibodies against T cell antigens, each at a final concentration of 1 ug/mL diluted in cold flow buffer and incubated at 4° C. for 30 minutes. After incubation, cells were washed 2× with flow buffer and then resuspended in 200 μL of flow buffer containing propidium iodide (PI) to identify dead cells and remove from analysis. Cells were run on a MACSQuant Analyzer 10 flow cytometer (Miltenyi Biotec, Bergisch Gladbach, Germany) and analysis was performed with FlowJo software (FlowJo, Ashland, Oreg.).
[0507] Effects of In Vitro Blockade of ILT3 and PD-L1 with Monoclonal Antibodies on T Cell IFNγ Secretion.
[0508] IFNγ levels were measured using an ELISA kit purchased from BD Biosciences, following the manufacturer's instructions. Briefly, samples were mixed with provided ELISA diluent and allocated in corresponding pre-coated wells. Standards provided were treated similarly. Samples and standards were incubated for 2 hours at room temperature protected from light. The working detector solution was prepared 15 minutes prior to use. Detection Antibody was added and mixed well into a clean tube along with Enzyme Concentrate (250×). The wells were washed 5 times with wash buffer supplied by manufacturer prior to adding the detection solution for 1 hour at room temperature. The detection solution was decanted and wells were washed 7 times with wash buffer. After the last wash, plates were blotted in absorbent paper to remove any residual buffer and 100 μL of TMB One-Step Substrate Reagent was added to each well and incubated without plate sealer for 30 minutes at room temperature in the dark. Stop solution was added and plates were read on a Perkin Elmer Multimode EnSpire Plate Reader at 450 nm absorbance.
[0509] Results
[0510] As shown in
[0511] The addition of anti-CTLA4 antibody Ipilimumab in combination with mouse anti-ILT3 monoclonal antibody clone ZM4.1 did not enhance T cell activation as measured by CD25 expression that was already achieved by ILT3 blockade with mouse anti-ILT3 monoclonal antibody clone ZM4.1 alone (
[0512] Blockade of both ILT3 with certain human antibodies of the invention in comination with blockade of PD-L1 with anti-PD-L1 antibody Atezolizumab resulted in increased IFNγ levels as compared with Atezolizumab alone (see
[0513] Thus, these results illustrate that combining an ILT3 antibody with a checkpoint inhibitor antibody, results in an additive effect in increasing activation of T cells.
TABLE-US-00006 SEQUENCE SUMMARY SEQ ID NO: Description 1 E2F12H8 VH amino acid sequence 2 E2F12H8, 3C4A3 VH CDR1 amino acid sequence 3 E2F12H8 VH CDR2 amino acid sequence 4 E2F12H8 VH CDR3 amino acid sequence 5 E2F12H8 VL amino acid sequence 6 E2F12H8, 8E11B6 VL CDR1 amino acid sequence 7 E2F12H8, 8E11B6 VL CDR2 amino acid sequence 8 E2F12H8 VL CDR3 amino acid sequence 9 E12H10 VH amino acid sequence 10 E12H10, 8E11B6 VH CDR1 amino acid sequence 11 E12H10 VH CDR2 amino acid sequence 12 E12H10, 17E8_27C5, 17F4_27C6 VH CDR3 amino acid sequence 13 E12H10 VL amino acid sequence 14 E12H10 VL CDR1 amino acid sequence 15 E12H10 VL CDR2 amino acid sequence 16 E12H10, 17E8_27C5, 17F4_27C6, 11H10_27D4 VL CDR3 amino acid 17 3C4A3 VH amino acid sequence 18 3C4A3 VH CDR2 amino acid sequence 19 3C4A3 VH CDR3 amino acid sequence 20 3C4A3 VL amino acid sequence 21 3C4A3 VL CDR1 amino acid sequence 22 3C4A3 VL CDR2 amino acid sequence 23 3C4A3 VL CDR3 amino acid sequence 24 8E11B6 VH amino acid sequence 25 8E11B6 VH CDR2 amino acid sequence 26 8E11B6 VH CDR3 amino acid sequence 27 8E11B6 VL amino acid sequence 28 8E11B6 VL CDR3 amino acid sequence 29 17E8_27C5 VH amino acid sequence 30 17E8_27C5 VH CDR1 amino acid sequence 31 17E8_27C5 VH CDR2 amino acid sequence 32 17E8_27C5 VL amino acid sequence 33 17E8_27C5, 17F4_27C6, 11H10_27D4 VL CDR1 amino acid sequence 34 17E8_27C5, 11H10_27D4 VL CDR2 amino acid sequence 35 17F4_27C6 VH amino acid sequence 36 17F4_27C6 VH CDR1 amino acid sequence 37 17F4_27C6 VH CDR2 amino acid sequence 38 17F4_27C6 VL amino acid sequence 39 17F4_27C6 VL CDR2 amino acid sequence 40 11H10_27D4 VH amino acid sequence 41 11H10_27D4 VH CDR1 amino acid sequence 42 11H10_27D4 VH CDR2 amino acid sequence 43 11H10_27D4 VH CDR3 amino acid sequence 44 11H10_27D4 VL amino acid sequence 45 1C4_24B3 VH amino acid sequence 46 1C4_24B3, 7C12_24A6, 3D8D11 VH CDR1 amino acid sequence 47 1C4_24B3 VH CDR2 amino acid sequence 48 1C4_24B3, 6H9_27D5, 3H3_24B2 VH CDR3 amino acid sequence 49 1C4_24B3 VL amino acid sequence 50 1C4_24B3, 5A2_24A1, 5E3_24B4, 7C12_24A6, 6H9_27D5, 10A5_24A2, 3D8D11, 3H3_24B2, 6B6_24B5, 8C7_24B1, 4F4_27D3 VL CDR1 amino acid sequence 51 1C4_24B3 VL CDR2 amino acid sequence 52 1C4_24B3, 5A2_24A1, 6H9_27D5, 10A5_24A2 VL CDR3 amino acid 53 20H6_24C3 VH amino acid sequence 54 20H6_24C3 VH CDR1 amino acid sequence 55 20H6_24C3 VH CDR2 amino acid sequence 56 20H6_24C3 VH CDR3 amino acid sequence 57 20H6_24C3 VL amino acid sequence 58 20H6_24C3 VL CDR1 amino acid sequence 59 20H6_24C3 VL CDR2 amino acid sequence 60 20H6_24C3, 14E7_27C1, 5E3_24B4, 7C12_24A6, 3D8D11, 3H3_24B2, 6B6_24B5, 8C7_24B1, 4F4_27D3 VL CDR3 amino acid sequence 61 14E7_27C1 VH amino acid sequence 62 14E7_27C1, 6B6_24B5, 8C7_24B1 VH CDR1 amino acid sequence 63 14E7_27C1 VH CDR2 amino acid sequence 64 14E7_27C1 VH CDR3 amino acid sequence 65 14E7_27C1 VL amino acid sequence 66 14E7_27C1 VL CDR1 amino acid sequence 67 14E7_27C1 VL CDR2 amino acid sequence 68 5A2_24A1 VH amino acid sequence 69 5A2_24A1 VH CDR1 amino acid sequence 70 5A2_24A1, 7C12_24A6 VH CDR2 amino acid sequence 71 5A2_24A1, 7C12_24A6 VH CDR3 amino acid sequence 72 5A2_24A1 VL amino acid sequence 73 5A2_24A1, 5E3_24B4, 7C12_24A6, 6H9_27D5, 10A5_24A2, 3D8D11, 3H3_24B2, 6B6_24B5, 8C7_24B1, 4F4_27D3 VL CDR2 amino acid sequence 74 5E3-24B4 VH amino acid sequence 75 5E3-24B4 VH CDR1 amino acid sequence 76 5E3-24B4 VH CDR2 amino acid sequence 77 5E3-24B4 VH CDR3 amino acid sequence 78 5E3-24B4 VL amino acid sequence 79 7C12_24A6 VH amino acid sequence 80 7C12_24A6 VL amino acid sequence 81 6H9_27D5 VH amino acid sequence 82 6H9_27D5 VH CDR1 amino acid sequence 83 6H9_27D5 VH CDR2 amino acid sequence 84 6H9_27D5 VL amino acid sequence 85 10A5_24A2 VH amino acid sequence 86 10A5_24A2 VH CDR1 amino acid sequence 87 10A5_24A2 VH CDR2 amino acid sequence 88 10A5_24A2 VH CDR3 amino acid sequence 89 10A5_24A2 VL amino acid sequence 90 16B10_27D2 VH amino acid sequence 91 16B10_27D2 VH CDR1 amino acid sequence 92 16B10_27D2 VH CDR2 amino acid sequence 93 16B10_27D2 VH CDR3 amino acid sequence 94 16B10_27D2 VL amino acid sequence 95 16B10_27D2 VL CDR1 amino acid sequence 96 16B10_27D2 VL CDR2 amino acid sequence 97 16B10_27D2 VL CDR3 amino acid sequence 98 3D8D11 VH amino acid sequence 99 3D8D11 VH CDR3 amino acid sequence 100 3D8D11, 3H3_24B2, 6B6_24B5, 8C7_24B1, 4F4_27D3 VL amino acid 101 3H3_24B2 VH amino acid sequence 102 3H3_24B2 VH CDR1 amino acid sequence 103 3H3_24B2 VH CDR2 amino acid sequence 104 6B6_24B5 VH amino acid sequence 105 6B6_24B5, 8C7_24B1 VH CDR 2 amino acid sequence 106 6B6_24B5, 8C7_24B1, 4F4_27D3 VH CDR3 amino acid sequence 107 8C7_24B1 VH amino acid sequence 108 4F4_27D3 VH amino acid sequence 109 4F4_27D3 VH CDR1 amino acid sequence 110 4F4_27D3 VH CDR2 amino acid sequence 111 E2F12H8 VH nucleic acid sequence 112 E2F12H8 VL nucleic acid sequence 113 E12H10 VH nucleic acid sequence 114 E12H10 VL nucleic acid sequence 115 3C4A3 VH nucleic acid sequence 116 3C4A3 VL nucleic acid sequence 117 8E11B6 VH nucleic acid sequence 118 8E11B6 VL nucleic acid sequence 119 17E8_27C5 VH nucleic acid sequence 120 17E8_27C5 VL nucleic acid sequence 121 17F4_27C6 VH nucleic acid sequence 122 17F4_27C6 VL nucleic acid sequence 123 11H10_27D4 VH nucleic acid sequence 124 11H10_27D4 VL nucleic acid sequence 125 1C4_24B3 VH nucleic acid sequence 126 1C4_24B3 VL nucleic acid sequence 127 20H6_24C3 VH nucleic acid sequence 128 20H6_24C3 VL nucleic acid sequence 129 14E7_27C1 VH nucleic acid sequence 130 14E7_27C1 VL nucleic acid sequence 131 5A2_24A1 VH nucleic acid sequence 132 5A2_24A1 VL nucleic acid sequence 133 5E3-24B4 VH nucleic acid sequence 134 5E3-24B4 VL nucleic acid sequence 135 7C12_24A6 VH nucleic acid sequence 136 7C12_24A6 VL nucleic acid sequence 137 6H9_27D5 VH nucleic acid sequence 138 6H9_27D5 VL nucleic acid sequence 139 10A5_24A2 VH nucleic acid sequence 140 10A5_24A2 VL nucleic acid sequence 141 16B10_27D2 VH nucleic acid sequence 142 16B10_27D2 VL nucleic acid sequence 143 3D8D11 VH nucleic acid sequence 144 3D8D11, 3H3_24B2, 6B6_24B5, 8C7_24B1, 4F4_27D3 VL nucleic acid 145 3H3_24B2 VH nucleic acid sequence 146 6B6_24B5 VH nucleic acid sequence 147 8C7_24B1 VH nucleic acid sequence 148 4F4_27D3 VH nucleic acid sequence 149 Human ILT3 amino acid sequence (with signal sequence) 150 Primer 151 Primer 152 Primer 153 Primer 154 Primer 155 Primer 156 Primer 157 Primer 158 Primer 159 Primer 160 Primer 161 Primer 162 Primer 163 Primer 164 Primer 165 Primer 166 Primer 167 Primer 168 Primer 169 Primer 170 Primer 171 Primer 172 Primer 173 Primer 174 Primer 175 Primer
INCORPORATION BY REFERENCE
[0514] The contents of all references, patents, pending patent applications and published patents, and Accession Numbers, cited throughout this application are hereby expressly incorporated by reference.
EQUIVALENTS
[0515] Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.