Composition for promoting maturation of dendritic cell containing fusion protein of Rv2299c and ESAT-6
11414646 · 2022-08-16
Assignee
Inventors
Cpc classification
A61K38/16
HUMAN NECESSITIES
A61K39/00
HUMAN NECESSITIES
C12N5/0639
CHEMISTRY; METALLURGY
International classification
A61K38/16
HUMAN NECESSITIES
Abstract
The present invention relates to a composition for inducing dendritic cell maturation and a method for maturing dendritic cells. More particularly, the present invention relates to a composition including a fusion protein of Rv2299c and ESAT-6, both derived from M. tuberculosis, as an active ingredient for inducing dendritic cell maturation, and a method for differentiating immature dendritic cells into dendritic cells by using the same. The method of the present invention can increase a dendritic cell immune response in the body.
Claims
1. A composition for inducing maturation of dendritic cells, the composition comprising a fusion protein of Rv2299c and ESAT-6 as an active ingredient.
2. The composition of claim 1, wherein the Rv2299c is a protein derived from M. tuberculosis.
3. The composition of claim 1, wherein the fusion protein of Rv2299c and ESAT-6 is included at a concentration of 1 μg/ml to 20 μg/ml.
4. A method for inducing maturation of immature dendritic cells, the method comprising: treating immature dendritic cells with a fusion protein of Rv2299c and ESAT-6 to mature the immature dendritic cells into mature dendritic cells.
5. The method of claim 4, wherein after treating the immature dendritic cells with the fusion protein of Rv2299c and ESAT-6, the cells are cultured for 12 hours to 36 hours.
6. The method of claim 4, wherein the fusion protein of Rv2299c and ESAT-6 increases the production of at least one selected from the group consisting of TNF-α, IL-12p70, IL-6 and IL-1β during the maturation of immature dendritic cells.
7. The method of claim 4, wherein the fusion protein of Rv2299c and ESAT-6 is included at a concentration of 1 μg/ml to 20 μg/ml.
8. The method of claim 4, wherein the maturation of the immature dendritic cells is caused by stimulation of TLR (toll-like receptor)-4 with the fusion protein of Rv2299c and ESAT-6.
9. The method of claim 4, wherein the maturation of immature dendritic cells is caused by stimulation of mitogen-activated protein kinase (MAPK) and NF-κB.
10. A composition for enhancing immunity, the composition comprising the composition of claim 1.
11. A composition for enhancing immunity, the composition comprising the composition of claim 2.
Description
BRIEF DESCRIPTION OF DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
DETAILED DESCRIPTION
(23) So far, a number of studies have been conducted on proteins derived from M. tuberculosis in the immune response to immunocytes, but studies on Rv2299c are not known.
(24) Immature dendritic cells mature so as to form mature dendritic cells. Mature dendritic cells lose the ability to up-regulate expression of cell surface molecules and various cytokines that capture and simultaneously stimulate the antigen. Specifically, mature dendritic cells express MHC type I and type II antigens at higher levels compared to immature dendritic cells and regulate cluster of differentiation (CD) 80+, CD83+, CD86+ and CD14−. More MHC expression induces an increase in the antigenic density of dendritic cells, whereas up-regulation of CD80 and CD86, the co-stimulatory molecules, results in the improvement of a T cell activation signal through a co-stimulatory molecular counterpart such as CD28 on T cells.
(25) The mature dendritic cells of the present invention may be prepared by contacting to Rv2299c or fusion protein of Rv2299c and ESTA-6 prepared by a recombinant method. The present invention may induce the maturation of dendritic cells through a composition including Rv2299c or a fusion protein of Rv2299c and ESTA-6. Rv2299c or a fusion protein of Rv2299c and ESTA-6 prepared by an effective recombinant method is not limited thereto, but the amount of Rv2299c may be included in the composition at a concentration of 1 μg/ml to 20 μg/ml, preferably 5 μg/ml to 10 μg/ml.
(26) The maturation of dendritic cells may be monitored by methods known in the art. Cell surface markers may be detected with assays familiar to the art, such as flow cytometry and immunohistochemistry. The cells may also be monitored through cytokine production (e.g., ELISA, FACS, and other immunoassays).
(27) Hereinafter, the present invention will be described in more detail with reference to Examples. The following Examples are provided to illustrate the present invention in a more easily understandable manner, and the present invention is not limited to Examples.
Example 1
(28) Materials and Methods
(29) 1.1 Production of Bacterial Strain and Mycobacterium Genus
(30) Mtb H37Rv (ATCC 27294) and H37Ra (ATCC 25177) were purchased from an American strain bank (American Type Culture Collection, ATCC, Manassas, Va.), and Mtb HM878 was obtained from the International Tuberculosis Research Institute (ITRC, Changwon, Gyeongsangnam-do, South Korea). Mycobacterium bovis BCG (Pasteur strain 1173P2) was provided by Dr. Brooch of the Pasteur Institute (Paris, France). All mycobacteria used in these studies were prepared as described above (Cha et al., 2015b).
(31) 1.2 Animal, Vaccination and Aerosol Infection
(32) 5 to 6 weeks specific pathogen-free female C57BL/6 mice as well as OT-I and OT-II T-cell receptor (TCR) transformant mice (C57BL/6 background), C57BL/6 (H-2K.sup.b and I-A.sup.b), C57BL/6J TLR2 knockout mice (TLR2.sup.−/−; B6.129-Th2.sup.tm1Kir/J) and C57BL/10 TLR4 knockout mice (TLR4.sup.−/−; C57BL/10ScNJ) were purchased from The Jackson Laboratory (Bar Harbor, Me., USA). Mice were maintained at a constant temperature (24±1° C.) and humidity (50±5%) under the barrier conditions in the BL-3 biohazard animal facilities of the Yonsei University Medical Research Center. The animals were provided with a sterile commercial mouse diet as well as random access to water under standardized light control conditions (cycle of 12-hour light and 12-hour dark). Mice were monitored daily and none of the mice showed any clinical signs or illness during these experiments.
(33) For vaccination, mice were first vaccinated with BCG Pasteur 1173P2 through subcutaneous injection (2.0×10.sup.5 CFU/mouse). Six weeks after post-BCG immune vaccination, subunit vaccines were administered three times every three weeks as well as dimethyldioctadecylammonium (DDA) liposome (5 μg/injection) including monophosphoryl lipid-A (MPL, 5 μg/injection). Four weeks after the final immune vaccination, spleen and lung cells were harvested and used to investigate immunogenicity (levels of IFN-γ secretion and cycles of IFN-γ-producing T cells and Ag-specific T cells). In order to examine the prophylactic effect of the subunit vaccine alone, the BCG immunization alone and the BCG priming-subunit vaccine boosting group were challenged to generate a gas with Mtb H37Rv (ATCC 27294) or Mtb HN878 strains as described above (Cha et al., 2015b, Lee et al., 2009). To sum up, the mice were exposed to the inhalation chamber of an air-infected device (Glas-Col, Terre Haute, Ind., USA) for a period of 60 minutes with a given dose of H37Rv or HN878 in order to expose to Mtb having viable amount of about 200 CFU. At 8 or 16 weeks post-challenge, spleen and lung cells were harvested from respective groups, and flow cytometric analysis was used to evaluate the cycle of multifunctional T cells and T cell subtypes.
(34) 1.3 Antibody and Reagent
(35) Recombinant mouse macrophage colony-stimulating factor (M-CSF), granulocyte-mouse macrophage colony factor (GM-CSF) and interleukin-4 (IL-4) were purchased from Creagene (Gyeonggi, South Korea). Fluorescein isothiocyanate (FITC)-Annexin V/propidium iodide kit was purchased from Research & Development System (Minneapolis, Minn., USA). Dextran-FITC (molecular weight, 40,000 Da) was obtained from Sigma (St. Louis, Mo., USA). Lipopolysaccharide from E. coli 0111:B4 was purchased from InvivoGen (San Diego, Calif., USA). Endotoxin filter (END-X) and endotoxin removal resin (END-X B15) were obtained from ACC (East Falmouth, Mass., USA). OT-I peptide (OVA.sub.257-264) and OT-II peptide (OVA.sub.323-339) were synthesized by a Peptron (Daejeon, South Korea). An anti-phosphorylated ERK1/2 monoclonal antibody, an anti-ERK1/2 monoclonal antibody, an anti-phosphorylated p38 monoclonal antibody, an anti-p38 monoclonal antibody, an anti-NF-κB (p65) polyclonal antibody, an anti-phosphorylated IκB-α monoclonal polyclonal antibody, an anti-IκB-a monoclonal antibody, an anti-lamin B polyclonal antibody, and an anti-13-actin polyclonal antibody were obtained from CST (Danvers, Mass., USA). An HRP-conjugated anti-mouse IgG antibody and an HRP-rhddor anti-rabbit antibody were obtained from Calbiochem (San Diego, Calif., USA), and anti-β-actin mAb (AC-15) was purchased from Sigma. CD11c, p65, IFN-g and CD62L-targeting FITC-conjugated mAbs, IL-12p70, IL-10 and CD3-targeting APC-conjugated mAb, CD4 and CD8-targeting PerCP-Cy5.5-conjugated mAb, CD8.sup.+− targeting APC-Cy7-conjugated mAb, CD80, CD86, MHC class I, MHC class II, IFN-γ and CD44-targeting phycoerythrin (PE)-conjugated mAb, CD11c and IL-2-targeting PE-Cy7-conjugated mAb, and CD3e-targeting eFluor 450-conjugated mAb were purchased from eBioscience (San Diego, Calif., USA). Phycoerythrin (PE)-conjugated mouse anti-IgG1, mouse anti-IgG2a and mouse anti-IgG2b, APC-conjugated mouse anti-IgG2a and mouse anti-IgG1, FITC-conjugated mouse anti-anti-IgG2b, and PE-Cy7-conjugated mouse anti-IgG1 and mouse anti-IgG2b were obtained from eBioscience (San Diego, Calif., USA). The antibodies were used as an isotype control. TNF-α, IFN-γ, IL-2, IL-4, IL-6, IL-10 and IL-12p70 ELISA kits were obtained from eBioscience.
(36) 1.4 Expression and Purification of Recombinant Protein
(37) To produce the recombinant Rv2299c protein, the corresponding genes were amplified by polymerase chain reaction (PCR) using the M. tuberculosis H37Rv ATCC27294 genomic DNA as a template and the following primers: Rv2299c forward, 5′-CATATGAACGCCCATGTCGAGCAGTTG-3′ (SEQ. ID. No. 2), and reverse, 5′-GAATTCGGCAAGGTACGCGCGAGACGTTC-3′ (SEQ. ID. No. 3), ESAT-6 forward, 5′-AAGCTTATGACAGAGCAGCAGTGGAAT-3′ (SEQ. ID. No. 4), and reverse, 5′-CTCGAGTGCGAACATCCCAGTGACGTT-3′ (SEQ. ID. No. 5). The PCR product of Rv2299c was digested with NdeI and EcoRI, and ESAT-6 was digested with HindIII and XhoI. These products were inserted into the pET22b (+) vector (Novagen, Madison, Wis., USA) and the result was sequenced. The recombinant plasmid was transformed into E. coli BL21 cells by thermal shock for 1 minute at 42° C. Over-expressed proteins were produced with slight modifications as described above (Cho et al., 2006). Briefly, E. coli-containing recombinant plasmids were incubated at 37° C. until the optical density (OD) thereof was 0.4-0.5 at 600 nm, and then they were induced by 1 mM isopropyl-D-thiogalactopyranoside (IPTG; ELPIS-Biotech, Daejeon, South Korea). The bacterial cells were then harvested by centrifugation and suspended in 20 mM Tris-HCl (pH 8.0), 0.5 M sodium chloride, 5 mM imidazole and 1 mM phenylmethylsulfonyl fluoride (Sigma); and dissolved by sonication. The recombinant proteins were purified by nickel-nitrilotriacetic acid (Ni-NTA) agarose chromatographic analysis according to the manufacturers instructions (Qiagen, Chatsworth, Calif., USA). The respective purification steps were analyzed by 13.5% sodium dodecyl sulfate polyacrylamide gel (SDS-PAGE) with Coomassie Brilliant Blue strain and immunoblot using anti-His antibody (Santa Cruz). The purified proteins were collected, concentrated and dialyzed for phosphate buffered saline (PBS, pH 7.4). In order to eliminate the endotoxin contamination, the dialyzed recombinant proteins were incubated with polymyxin B-agarose (PmB, Sigma) at 4° C. for 6 hours. Finally, the recombinant proteins without purified endotoxin were filtered and sterilized and frozen at −70° C. The protein concentrations were measured with a BCA protein assay kit (Pierce, Rockford, Ill.) using bovine serum albumin as a standard. The residual LPS of recombinant proteins was determined using the biological endotoxin (LAL) test (Lonza, Basel, Switzerland) according to the manufacturer's instructions. The purity of the recombinant proteins was evaluated by Coomassie Brilliant Blue (CB) staining and Western blot using anti-histidine antibodies.
(38) 1.5 Cell Culture
(39) As recently described, murine bone marrow-derived DCs were produced, cultured, and purified (Byun et al., 2012b). Bone marrow-derived macrophages (BMDMs) were prepared using recombinant M-CSF as described above. Briefly, bone marrow cells isolated from C57BL/6 mice were dissolved with red blood cells (RBC) which dissolve buffer (4.15 g/500 ml of ammonium chloride and 0.01 M Tris-HCl buffer (pH 7.5±2)) and were washed with an RPMI 1640 medium. They were plated on a 6-well culture plate (10.sup.6 cells/ml, 3 ml/well) and were cultured using an RPMI 1640 medium supplemented with 100 unit/ml of penicillin/streptomycin (Lonza), 10% fetal bovine serum (Lonza), 50 mM mercaptoethanol (Lonza), 0.1 mM non-essential amino acid (Lonza), 1 mM sodium pyruvate (Sigma), 20 ng/ml of GM-CSF and 10 ng/ml of IL-4 (BMDC) or 20 ng/ml of M-CSF (BMDM) at 37° C. in the presence of 5% carbon dioxide.
(40) 1.6 Cytotoxicity Analysis
(41) Cytotoxicity assays were performed using the Annexin V/propidium iodide (PI) staining kit according to the manufacturer's instructions (BD Biosciences). Cells were stained with FITC-conjugated with Annexin V and PI. Analysis of stained cells was performed using FACSCanto II with FACSDiva, and the results were analyzed using FlowJo software (Tree Star, Ashland, Oreg., USA).
(42) 1.7 Analysis of Surface Molecule Expression by Flow Cell Analysis
(43) On the 6th day, BMDCs were harvested, washed with PBS and resuspended in fluorescence activation cell sorbent wash buffer (2% FBS and 0.1% sodium azide in PBS). The cells were pre-cultured with 0.5% BSA in PBS for 30 minutes and washed with PBS. The cells were stained with FITC-conjugated anti-CD11c with PE-conjugated anti-H-2Kb (MHC class I), anti-I-antibody (MHC class II), anti-CD80 and anti-CD86 at 4° C. for 45 minutes. The cells were washed with PBS three times and resuspended with 500 μl of PBS. Fluorescence was measured by flow cytometry, and data were analyzed using CellQuest data analysis software.
(44) 1.8 Antibody Uptake Capacity of BMDC by Rv2299c
(45) BMDCs (2×10.sup.5 cells) were maintained in equilibrium at 37° C. or 4° C. for 45 minutes and were pulsed at a concentration of 1 mg/ml with fluorescein-conjugated dextran. Cold dyeing buffer was added to stop the reaction. The cells were washed three times, stained with a PE-conjugated anti-CD11c antibody and then analyzed by FACSCanto. Non-specific binding of dextran to DC was determined by culturing DC with FITC-conjugated dextran at 4° C., and the resulting background values were subtracted from the specific binding values.
(46) 1.9 Identification of LPS-Contamination Removal for Rv2299c
(47) In order to identify that the maturation of DCs induced by Rv2299c was not due to endotoxin contamination or LPS in protein preparations, pretreatment with polymyxin B (PmB) (Sigma), thermal denaturation, and proteinase K (Sigma) degradation were performed and analyzed. DC was pre-incubated with 50 μg/ml of PmB for 1 hour at room temperature before treatment with 100 ng/ml LPS and 10 ug/ml of Rv2299c. For the thermal denaturation, LPS or Rv2299c was incubated at 100° C. for 1 hour. For the degradation of proteinase K, LPS or Rv2299c was digested with soluble protease K at a concentration of 10 μg/ml at 37° C. for 1 hour. For the deactivation of enzymes, the enzymes were heated at 100° C. for 15 minutes and then added to the BMDC culture solution. After 24 hours, the levels of TNF-α and IL-6 in BMDC supernatants were analyzed using ELISA.
(48) 1.10 Confocal Scanning Laser Microscope
(49) DCs were plated overnight on a poly-L-lysine-coated glass coverslip. After treatment with Rv2299c, the cells were fixed with 4% paraformaldehyde, permeabilized 0.1% Triton X-100. Before the cells were cultured with 2% BSA in anti-Rv2299c antibody including PBS/T at room temperature for 2 hours, the cells were blocked with 2% bovine serum albumin (BSA) in PBS including 0.1% Tween-20 (PBS/T) for 2 hours. After washing with PBS/T, the cells were re-cultured with Cy-3-conjugated secondary antibody in a dark room for 1 hour and then stained with 1 μg/ml of DAPI at room temperature for 10 minutes. Cell shape and fluorescence sensitivity were observed using a confocal laser microscope (Zeiss LSM 510 Meta; Carl Zeiss Ltd, Welwyn Garden City, UK). Their images were obtained using the LSM510 meta software and processed using an LSM image tester.
(50) 1.11 Immunoprecipitation
(51) DCs (1×10.sup.7) were cultured with 10 mg/ml of Rv2299c for 6 hours, and the cell pellet was dissolved in lysis buffer (10 mM Tris-HCl (pH 7.4), 1% NP-40, 0.25% sodium deoxycholate, 150 mM HCl, 1 mM EDTA, 1 mM PMSF, 1 μg/ml of aprotinin, 1 μg/ml of leupeptin, 1 μg/ml of pepstatin, 1 mM Na.sub.3VO.sub.4, and 1 mM NaF). In order to prevent non-specific binding, 50 μl of normal serum (Santa Cruz) and 100 μl of 50% protein A or G-sepharose bead slurry (Invitrogen, Carlsbad, Calif.) were added to 1 mg of cell lysate to identify the stability of the cell lysate in advance. After incubation at 4° C. for 2 hours, the mixture of beads and cell lysate was centrifuged at 10,000×g at 4° C. for 5 minutes, and the supernatant was collected for the further experiment. Rv2299c (His), TLR2 and TLR4-related proteins were incubated with anti-mouse IgG as control antibodies for anti-TLR2 and TLR4 at 4° C. for 1 hour and with anti-mouse IgG as a control antibody for anti-Rv2299c(His), and then immunoprecipitated by incubation with protein A or G-sepharose at 4° C. for 24 hours. The beads were harvested, washed, and boiled in 5× sample buffer for 5 minutes. The proteins were separated on 10% SDS-PAGE and transferred to a vinylidene chloride difluoride membrane (Millipore). The membranes were further examined with anti-TLR2, TLR4 and His antibodies as described.
(52) 1.12 Immunoblotting Analysis
(53) After stimulation with 10 μg/ml of Rv2299c, DCs were suspended in 100 μl of lysis buffer including 50 mM Tris-HCl (pH 7.5), 150 mM HCl, 1% Triton-X100, 1 mM EDTA, 50 mM NaF, 30 mM Na.sub.4PO.sub.7, 1 mM phenylmethane sulphonyl fluoride, 1 μg/ml of aprotinin and 1 mM pervanadate. Whole cell lysate samples were degraded in SDS-polyacrylamide gels and transferred to nitrocellulose membranes. The membranes were blocked with 5% skim milk, incubated with the antibody for 2 hours, and then incubated with HRP-conjugated secondary antibodies for 1 hour at room temperature. Epitopes on target proteins including MAPK and NF-κB which are specifically recognized for antibodies were visualized using an ECL advance kit (GE Healthcare, Little Chalfont, UK).
(54) 1.13 Production of Nuclear Extract
(55) The nuclear extracts obtained from the cells were prepared as follows. DCs were treated with 100 ml of lysis buffer (10 mM HEPES (pH 7.9), 10 mM KCl, 0.1 mM EDTA, 0.5% Nonidet P-40, 1 mM dithiothreitol (DTT) and 0.5 mM PMSF) on ice for 10 minutes. After the centrifugation at 4,000 rpm for 5 minutes, the pellet was resuspended in 100 μl of extraction buffer (20 mM HEPES (pH 7.9), 40 mM sodium chloride, 1 mM EDTA, 1 mM DTT and 1 mM PMSF), the cells were cultured on ice for 30 minutes. After the centrifugation at 12,000 rpm for 10 minutes, the supernatant including the nuclear extracts was collected and stored at −80° C. until needed.
(56) 1.14 Treatment of DC with Pharmacological Inhibitor for Signaling Pathway Analysis
(57) All pharmacological inhibitors were purchased from Calbiochem. The dimethyl sulfoxide (Sigma) was added to the culture as a solvent control at 0.1% (vol/vol). DCs were washed with PBS and pretreated with inhibitors in an RPMI 1640 medium including glutamine for 1 hour before the treatment with Rv2299c for 24 hours. The inhibitors were used at the following concentrations: U0126 (10 μM), SB203580 (20 μM), SP600125 (10 μM) and Bay11-7082 (20 μM). In all experiments where inhibitors were used, test concentrations were determined after careful titration experiments to assess the viability of DCs using MTT assays.
(58) 1.15 In Vitro T Cell Proliferation Assay
(59) Reactive T cells participating in the naive T cell response were isolated from total mononuclear cells prepared from BALB/c mice using a MACS column (Miltenyi Biotec). Both OVA-specific CD8.sup.+ and CD4.sup.+ reactive T cells, respectively were obtained from splenocytes from OT-1 and OT-2 mice. These T cells were stained with 1 μM CFSE (Invitrogen) as described above (Jeong et al., 2009). DCs (2×10.sup.5 cells per well) treated with OVA peptide for 24 hours in the presence of 10 μg/ml of Rv2299c were co-cultured with CFSE-stained CD8.sup.+ and CD4.sup.+ T cells (2×10.sup.6) at a DC to T cell ratio of 1:10. On the 3rd or 4th day from co-culture, the respective T cells were stained with PerCP-cy5.5-conjugated anti-CD4.sup.+ mAb, PE-cy5-conjugated anti-CD4.sup.+ mAb, PE-cy5-conjugated anti-CD8.sup.+ mAb, Alexa647-conjugated anti-CCR3 mAb or PE-conjugated anti-CXCR3 mAb and analyzed by flow cytometer. The supernatants were harvested, and IFN-γ, IL-2 and IL-4 production was measured using ELISA.
(60) 1.16 Effect/Memory T Cell Activation Analysis
(61) As described above, reactive T cells participating in allogeneic T cell response were isolated from total mononuclear cells prepared from Mycobacterium-infected BALB/c mice using a MACS column (Miltenyi Biotec). Staining with APC-conjugated anti-CD3 mAb (BD Biosciences) revealed that the preparation consisted mainly of CD3.sup.+ cells (>95%). Large-scale DCs (2×10.sup.5 cells per well) prepared from wild-type (WT), TLR2.sup.−/− and TLR4.sup.−/− C57BL/6 mice after washing were treated with Rv2299c for 24 hours. The cells were co-cultured with 2×10.sup.6 reactive allogeneic T cells at a ratio of T cell to DC of 1:10. On the 4th day of co-cultivation, the cells were stained with PerCP-cy5.5-conjugated anti-CD4.sup.+ mAb, PerCP-cy5.5-conjugated anti-CD8.sup.+ mAb, FITC-conjugated anti-CD62L mAb and PE-conjugated anti-CD44 mAb and analyzed by flow cytometer.
(62) 1.17 Measurement of Cytokine
(63) The sandwich enzyme-linked immunosorbent assay (ELISA) was used to detect IL-6, IL-1β, TNF-α, IFN-γ, IL-4, IL-2, IL-12p70 and IL-10 in the culture supernatant as described above (Byun et al., 2012b). Single cells prepared from lungs of vaccinated or infected mice were stimulated with PPD (2 μg/ml) or antigen-specific CD4 or CD8 T cell peptides (2 μg/ml) at 37° C. for 24 hours. IFN-γ cytokine levels in culture supernatants were measured using a commercial ELISA kit (eBioscience) according to the manufacturer's protocol.
(64) 1.18 Analysis of Intracellular Cytokine
(65) The cells were first blocked with 10% (vol/vol) normal goat serum at 4° C. for 15 minutes and stained with FITC-conjugated CD11c+antibodies at 4° C. for 30 minutes. The cells stained with the appropriate isotype-matched immunoglobulin (Ig) were used as a negative control. The cells were fixed and permeabilized with a Cytofix/Cytoperm kit (BD Biosciences) used according to the manufacturer's instructions. IL-12p70, IL-10, IL-2, IL-4 and IFN-γ in the cells were detected in permeation buffer with fluorescein-conjugated antibodies (BD Biosciences). Pure protein derivatives (PPD) were provided by Dr. Brennan of Aeras (Rockville, Md., USA). For intracellular cytokine staining, single-cell suspensions from vaccinated animals (2×10.sup.6 cells) were stimulated with PPD (2 μg/ml) and antigen-specific CD4 or CD8 T cell peptides (2 μg/ml) in the presence of GolgiStop at 37° C. for 12 hours (BD Biosciences). After the HN878 challenge, PPD was used alone as a stimulant for intracellular cytokine staining. The cells were first blocked with Fc block (anti-CD16/32) at 4° C. for 15 minutes and stained with BV421-conjugated anti-CD3, PerCp-Cy5.5-conjugated anti-CD4, APC-Cy7-conjugated anti-CD8 and FITC-conjugated anti-CD62L antibodies. The cells were fixed and permeabilized with a Cytofix/Cytoperm kit (BD Biosciences) used according to the manufacturer's instructions. TNF-α, IL-2 and IFN-γ in the cells were detected in permeation buffer using APC-conjugated anti-TNF-α, PE-Cy7-conjugated anti-IL-2 and PE-conjugated anti-IFN-γ antibodies. All antibodies were purchased from eBioscience (San Diego, Calif.) unless otherwise described. The cells were analyzed with FACSverse flow cytometry using a commercially available software program FlowJo (Treestar, Inc., San Carlos, Calif., USA).
(66) 1.19 Bacterial Count and Histopathological Analysis
(67) After the final vaccination and then 16 weeks of the HN878 challenge, 6 to 7 mice per group were euthanized with carbon dioxide, and their lungs and spleen were homogenized. The viable counts were determined by plating on a Middlebrook 7H11 agar (Difco Laboratories, Detroit, Mich., USA) via serial dilution of the organ (half of the left lung and half of the spleen) homogenate, and were supplemented with 10% OADC (Difco Laboratories), Amphotericin B (Sigma-Aldrich, St. Louis, Mo., USA) and 2 μg/ml of 2-thiophenecarboxylic acid hydrazide (Sigma-Aldrich). Colonies were counted after incubation at 37° C. for 4 weeks. For histopathological analysis, the upper lobe of the right lung was stained with hematoxylin and eosin and evaluated for the severity of inflammation. As described above (Cha et al., 2015a), inflammatory levels in the lungs were assessed using the ImageJ (National Institutes of Health, Bethesda, ML) software program. Further, the inflammatory response was evaluated based on the size of the lesion and the composition of the immune cells. Data for CFU and pulmonary inflammation were reported as median log.sub.10 CFU±quadrant range (IQR).
(68) 1.20 Statistical Analysis
(69) All experiments were repeated at least three times and consistent results were obtained. The significance level for the comparison between samples was determined by the distribution of Tukey's multiple comparison tests using a statistical software (GraphPad Prism Software, version 4.03; GraphPad Software, San Diego, Calif.). The data in the graph are expressed as means±SEM. Each value of *p<0.05, **p<0.01 or ***p<0.001 is considered statistically significant.
Example 2
(70) Recombinant Rv2299c Protein Induces Maturation and Activation of Dendritic Cells (DCs).
(71) 2.1 Experimental Method
(72) (A) (a) Rv2299c was successfully induced in E. coli BL21 as a supplement of 1 mM isopropyl β-D-thiogalactoside (IPTG) for 6 hours. The proteins were mainly localized in inclusion bodies. The molecular weight of the N-terminal His-tag Rv2299c was close to 72 kDa by SDS-PAGE (M: molecular weight marker; lane 1: non-induction, lane 2: induction). Recombinant Rv2299c was produced in BL21 cells and purified with NTA resin. The purified proteins were subjected to (b) SDS-PAGE and (c) Western blot analysis using 1:1000 mouse anti-His antibodies. (B) BMDCs were treated with Rv2299c for 1, 5, or 10 μg/ml for 30 minutes, and then cultured in the absence or presence of LPS for 24 hours. The cells were cultured with dextran (FITC) at 37° C. for 30 minutes and then at 4° C. for 30 minutes and evaluated by FAC analysis of dextran (FITC) uptake. Dextran (FITC)-positive CD11c (PE)-positive cell proportion is shown. The results represent four experimental results. The bar graph shows the mean±SEM of dextran-FITC-positive CD11c+cell proportions for three independent experiments, and statistical significance (***p<0.001) is shown for the treatment as compared to the control. (C) BMDCs were cultured in the presence of 1, 5 or 10 μg/ml of Rv2299c for 24 hours and analyzed by two-color flow cytometry. The cells were gated to exclude CD11c cells. Medium: untreated control; LPS: positive control (100 μg/ml of LPS). DCs were stained with anti-CD80, anti-CD86, anti-MHC class I or anti-MHC class II. The results represent the three experimental results. The average fluorescence intensity was calculated from the above graph. Each bar represents the average fluorescence level of the sample. Data are presented as mean±SEM (n=5). *p<0.05, **p<0.01 and ***p<0.001 as compared to the untreated control group. (D) BMDCs were stimulated with 1, 5 or 10 μg/ml of Rv2299c and 100 ng/ml of LPS for 24 hours. Analysis of TNF-α, IL-6, IL-1β, IL-12p70 and IL-10 production was measured by ELISA. The results came from a representative experiment in one of the three experiments conducted. Data are presented as mean±SEM (n=5). *p<0.05, **p<0.01 and ***p<0.001 as compared to the untreated control group. (E) Analysis of IL-12p70 and IL-10 expression in CD11c+DC by intracellular cytokine staining
(73) 2.2 Analysis of Experimental Results
(74) There is little information about the immunological role of the Rv2299c protein in the mycobacterial HSP family. The recombinant Rv2299c proteins in E. coli BL21 were purified and examined their immune response. The purity of Rv2299c was evaluated by SDS-PAGE and Western blotting analysis (
(75) Next, it was analyzed whether Rv2299c-mediated DC maturation was associated with the secretion of proinflammatory or anti-inflammatory cytokines. As illustrated in
Example 3
(76) Rv2299c Induces the Maturation of Dendritic Cells (DCs) Through the TLR4 Pathway.
(77) 3.1 Experimental Method
(78) (A) The bar graphs show the expression of CD86 or MHCII in Rv2299c-treated CD11c+-gated DCs derived from WT, TLR2/and TLR4/mice. DCs derived from WT, TLR2/and TLR4/mice were treated with Rv2299c (10 μg/ml) for 24 hours. The proportion of positive cells is shown on each panel. The bar graph shows the mean±SEM of the proportion for each surface molecule to CD11c+ cells in three independent experiments. Statistical significance (***p<0.001) appears as Rv2299c-treated TLR2/versus Rv2299c-treated WT DC. All data are expressed as mean±SD (n=3), and statistical significance (***p<0.001) appears for the treatment as compared to Rv2299c-treated WT DC. (B) DCs derived from WT, TLR2/and TLR4/mice were treated with Rv2299c or LPS for 24 hours. Production of TNF-α, IL-6, or IL-1β in Rv2299c- or LPS-treated DCs derived from WT, TLR2/and TLR4/mice was measured by ELISA. All data are presented as mean±SD (n=3) and statistical significance (***p<0.001) is shown for the treatment as compared to Rv2299c-treated WT DC. (C) DCs derived from WT, MyD88/and TRIF/mice were treated with Rv2299c (10 μg/ml) and LPS (100 ng/ml) for 24 hours. Production of TNF-α, IL-6, or IL-1β in Rv2299c- or LPS-treated DCs derived from WT, MyD88/and TRIF/mice was measured by ELISA. All data are presented as mean±SD (n=3) and statistical significance (***p<0.001) is shown for the treatment as compared to Rv2299c-treated WT DC. (D) Fluorescence intensity of anti-Rv2299c combined with Rv2299c-treated DC. DCs derived from WT, TLR2/and TLR4/mice were treated with Rv2299c (10 μg/ml) for 1 hour, fixed and stained with DAPI and Cy3-conjugated anti-His antibodies (reference: 10 μM). (E) BMDCs derived from WT, TLR2/and TLR4/mice were treated with Rv2299c (10 μg/ml) for 1 hour and stained with Alexa488-conjugated anti-His mAb. The proportion of positive cells is shown on each panel. The bar graph shows the mean±SEM of Rv2299c-Alexa488 proportion in CD11c+ cells obtained from three independent experiments. Statistical significance (***p<0.001) appears for Rv2299c-treated TLR4/as compared to Rv2299c-treated WT DC. (F) Immunoprecipitation (IP) with anti-His, anti-TLR2 or anti-TLR4 antibodies and immunoblotting with anti-His, anti-TLR2 or anti-TLR4 antibodies. DCs were treated with Rv2299c (10 μg/ml) for 6 hours. The cells were harvested, and cell lysates were immunoprecipitated with anti-mouse IgG, anti-mouse IgG, anti-His, anti-TLR2 or anti-TLR4. The proteins were then visualized by immunoblotting with anti-His, anti-TLR2 or anti-TLR4 antibodies. The total indicates the average total cell lysate.
(79) 3.2 Analysis of Experimental Results
(80) Several Mtb components which activate DCs through a toll-like receptor (TLRs) pathway have been identified (Harding and Boom, 2010). Therefore, it was investigated whether Rv2299c in DCs could be recognized by TLRs and activated through it. Expression of surface molecules (See
Example 4
(81) MAPK and NF-κB Pathways are Associated with the Maturation of Rv2299c-Mediated Dendritic Cell (DC).
(82) 4.1 Experimental Method.
(83) (A) DCs were treated with 10 μg/ml of Rv2299c proteins, and the protein expression was plotted over time. Cell lysates were placed on SDS-PAGE and immunoblot analysis was performed using respective specific antibodies to phospho-p38 (p-p38), p38, phospho-ERK1/2 (p-ERK1/2), phosphor-IκB-a, and p65 NF-κB. (B) Effect of Rv2299c on cellular localization of p65 subunit of NF-κB in DCs. DCs were plated on a closed glass chamber slide and treated with Rv2299c for 1 hour. After the stimulation, the immunoreactivity of p65 subunit of intracellular NF-κB was determined by immunofluorescence as described in “Materials and Methods.” (C and D) DCs were treated with p38 (SB203580, 20 μM), ERK1/2 (U0126, 10 μM), JNK (SP600125, 20 μM), Bay11-7082 (20 μM) or DMSO (vehicle control) pharmacological inhibitors for 1 hour before they were treated with 10 μg/ml of Rv2299c proteins for 24 hours. Expression of CD80 and CD86 was analyzed by flow cytometry. The bar graph shows the ratio of respective CD11c+ cells to surface molecules (mean±SEM for three separate experiments). The amounts of TNF-α, IL-6 and IL-1β in the culture medium were measured by ELISA. Mean±SEM is shown for three independent experiments, and statistical significance (*p<0.05, **p<0.01 or ***p<0.001) appears for the treatment as compared to Rv2299c-treated control.
(84) 4.2 Analysis of Experimental Results
(85) MAPK and NF-κB are critical signaling molecules to regulate DC maturation and proinflammatory cytokine secretion (Bansal et al., 2010b, Pathak et al., 2007). Thus, it was investigated whether MAPK and NF-κB were activated in response to Rv2299c. As expected, Rv2299c caused phosphorylation of p38 and ERK1/2 and phosphorylation and degradation of IκB-α in DCs (See
Example 5
(86) Rv2299c-Mature Dendritic Cells (DCs) Induce Naive T Cell Proliferation.
(87) 5.1 Experimental Method
(88) (A) Transformed OVA-specific CD8+T cells and transformed OVA-specific CD4+T cells were isolated and stained with CFSE. They were simultaneously cultured with Rv2299c (10 μg/ml) or LPS (100 ng/ml)-treated DCs for 96 hours. OVA-specific CD8+T cells and OVA-specific CD4+T cells, respectively, were pulsed with OVA25764 (1 μg/ml) and OVA323339 (1 μg/ml). T cells alone and T cells simultaneously-cultured with untreated DCs served as control. OT-I+ and OT-II+ T cell proliferation was evaluated by flow cytometry. (B) Cultured supernatants and IFN-γ, IL-2 and IL-4, harvested after 24 hours therefrom were measured by ELISA. Mean±SEM is shown for three independent experiments, and statistical significance (*p<0.05) is shown for the treatment as compared to the appropriate control (T cells/OVA257264-pulsed DCs or T cells/OVA323339-pulsed DCs). n.s refers to treatments without significant effect.
(89) 5.2 Analysis of Experimental Results
(90) In order to accurately illustrate the property of Rv2299c activity on the interaction between DCs and T cells, syngeneic MLR analysis was performed using OT-I T cell receptor (TCR) transformed CD8.sup.+T cells and OT-II TCR transformed CD4.sup.+T cells. DCs pulsed with OVA.sub.257-264 or OVA.sub.323-339 were co-cultured with transformed CFSE-labeled OVA-specific CD4.sup.+ or CD8.sup.+ T cells for 72 hours. Rv2299c- or LPS-treated DCs induced T cell proliferation to a significantly greater extent compared to untreated DCs (See
Example 6
(91) Rv2299c-Mature Dendritic Cells (DCs) Induced an Expansion of Effect/Memory T Cell Populations.
(92) 6.1 Experimental Method
(93) (A) T cells prepared from Mycobacterium tuberculosis-infected BALB/c mice. DCs were cultured with 10 μg/ml of Rv2299c proteins for 24 hours. Rv2299c-mature DCs were washed and co-cultured with allogeneic T cells at DCs to T cells ratio of 1:10 for 3 days. Splenocytes were stained with anti-CD4, anti-CD8 mAb, anti-CD62L and anti-CD44 mAb. The bar graph show CD62L.sup.lowCD44.sup.highT cells in the spleen. The bar graph shows the ratio (mean±SEM) for CD4+/CD8+CD44.sup.high and CD4+/CD8+CD62L.sup.low T cells in three independent experiments. (B) Expression of IFN-γ, IL-2 or IL-4 in CD3+/CD4+ and CD3+/CD8+ cells was analyzed in T cells of intestinal lymph nodes co-cultured with Rv2299c-pulsed DCs or LPS-pulsed DCs by intracellular IFN-γ, IL-2 or IL-4 staining. The proportion of double-positive cells in T cells is shown in the upper right corner, and the results represent three independent experiments. Statistical significance (**p<0.01 or ***p<0.001) is shown for comparison as compared to untreated DC, and n.s refers to no significant effect.
(94) 6.2 Analysis of Experimental Results
(95) In order to assess whether Rv2299c-stimulated DCs were reflected in their ability to particularly stimulate CD4.sup.+ obtained from mice infected with Mtb, the flow cytometry was used to analyze a change in expression of CD62L and CD44 in CD4.sup.+ splenic T cells induced Rv2299c-treated DCs. DCs were prepared from the bone marrow of WT, TLR2.sup.−/− or TLR4.sup.−/− mice and matured with Rv2299c or LPS. Both Rv2299c-mature DCs obtained from infected mice and syngenic CD4.sup.+ T cells were co-cultured for 72 hours. Then, Rv2299c-mature DCs obtained from WT or TLR2.sup.−/− mice, other than TLR4.sup.−/− mice, showed down-regulated CD62L and up-regulated CD44 expression in CD4.sup.+ T cells compared to control DCs or LPS-treated DCs (See
Example 7
(96) T Cells Activated by Rv2299c-Mature Dendritic Cells (DCs) Inhibit Mtb Growth in Cells.
(97) 7.1 Experimental Method
(98) BMDM was infected with H37Rv (MOI=1) for 4 hours. The infected BMDM was then treated with amikacin (200 μg/ml) for 2 hours and washed twice with PBS. Then, the previously prepared mixture was added to each shell of the plate and was cultured for 3 days. The mixture was antigen-activated DCs which were co-cultured with CD4+ T cells at a DC to T cell ratio of 1:10 for 3 days. The DCs activated the antigen were LPS (100 ng/ml) and Rv2299c (10 μg/ml). (A) Number of Mtb in infected macrophages. (B) The supernatant was analyzed using ELISA. The data shown is mean value±SD (n=3); *p<0.05, **p<0.01 or ***p<0.001 refers to a significance for treated cells versus untreated cells. Treatments without significant effects are denoted by n. s.
(99) 7.2 Analysis of Experimental Results In order to confirm that Rv2299c-mature DCs actually play a role in controlling Mtb, it was investigated whether T cells activated by Rv2299c-mature DCs could enhance bactericidal action in macrophages. Naive spleen T cells from uninfected mice were activated by co-culturing with Rv2299c-mature DCs for 72 hours and then added to the Mtb-infected BMDM. As illustrated in
Example 8
(100) Fusion Protein of Rv2299c and ESAT-6 Enhances the Immune Response of ESAT-6.
(101) 8.1 Experimental Methods to Confirm that Fusion Proteins Induce Dendritic Cell (DC) Maturation
(102) (A) BMDCs were cultured for 24 hours in the presence of 1, 2, 5, 10 or 20 μg/ml of ESAT-6 or fusion proteins and analyzed by flow cytometry. Staurosporine was a positive control. DCs were stained with anti-CD11c, Annexin V and PI. The proportion of positive cells (annexin V- and PI-stained cells) in each quadrant is shown. The results represent three experiments. (B) BMDCs were cultured in the presence of 1, 5 or 10 μg/ml of fusion proteins, 2 μg/ml of ESAT-6 or 10 μg/ml of Rv2299c for 24 hours and analyzed by two-color flow cytometry. The cells were gated to exclude CD11c cells. DCs were stained with anti-CD40, anti-CD80, anti-CD86 or anti-MHC class II. The results represent three experimental results. The average fluorescence intensity was calculated from the above graph. Each bar represents the average fluorescence level of the sample. Data are presented as means±SEM (n=5). *p<0.05, **p<0.01 and ***p<0.001 as compared to the untreated control, ESAT-6, or Rv2299c. (C) The supernatant was measured by ELISA. The results come from one representative experiment of the three experiments conducted. Data are presented as means±SEM (n=5). *p<0.05, **p<0.01 and ***p<0.001 as compared to the untreated control, ESAT-6, or Rv2299c.
(103) 8.2 Experimental Method to Confirm Inhibition of Mtb Growth in Macrophages by Fusion Proteins
(104) BMDM was infected with H37Rv (MOI=1) for 4 hours. The infected BMDM was then treated with amikacin (200 μg/ml) for 2 hours and washed twice with PBS. Then, the previously prepared mixture was added to each shell of the plate and was cultured for 3 days. The mixture was antigen-activated DCs which were co-cultured with CD4+ T cells at a DC to T cell ratio of 1:10 for 3 days. The DCs that activated the antigen were ESAT-6 (2 μg/ml), Rv2299c, and fusion protein (10 μg/ml). (A) Number of Mtb in infected macrophages. (B) The supernatant was analyzed using ELISA. The data shown is mean value±SD (n=3); *p<0.05, **p<0.01 or ***p<0.001 refers to a significance for treated cells versus untreated cells. Treatments without significant effects are denoted by n. s.
(105) 8.3 Analysis of Experimental Results
(106) It was assumed that DC-activated proteins could enhance the prophylactic immunity of T cell-stimulating antigens. In order to test this assumption, ESAT-6, a major T cell vaccine candidate, was expressed and purified in proteins fused to Rv2299c in E. coli, and its immunogenicity was investigated. First, the cytotoxicity of recombinant Rv2299c-fused ESAT-6 in BMDM was determined by annexin V and propidium iodide (PI) staining. ESAT-6 showed cytotoxicity higher than 5 μg/ml, but the fusion proteins did not show toxicity at 10 μg/ml (See
Example 9
(107) Fusion Proteins of Rv2299c and ESAT-6 Elicit a Significant BCG Prime Boosting Effect on the Highly Virulent Strain Mtb HN878 Strain.
(108) 9.1 Experimental Method
(109) (A) Vaccination schedule and experimental design, (B) The difference in the degree of bacterial growth in one mouse lung is shown in the lung of the mice vaccinated with BCG alone, protein alone, BCG/Rv2299c+ESAT-6 fusion protein and adjuvant control (MPL-DDA only) at 16 weeks after challenge with Mtb HN878. (C) The lung sections from each mouse vaccinated at 16 weeks after challenge with Mtb HN878 (n=6 animals/group) were stained with H&E (D) Percentage of inflammatory tissue sites in lung tissue sections. G1: infection control, G2: MPL/DDA inoculation control, G3: BCG alone, G4: BCG/Rv2299c+ESAT-6/MPL-DDA fusion protein inoculation, G5: ESAT-6/MPL-DDA inoculation group. *P<0.05, **p<0.01 and ***p<0.001 compared to the MPL-DDA-alone group.
(110) 9.2 Analysis of Experimental Results
(111) Finally, it was assessed whether the Rv2299c+ESAT-6 fusion protein is potentially a vaccine against TB. First, Mtb Erdman strain was used to evaluate the vaccine effect of Rv2299c protein alone in a mouse model. However, in views of reducing bacterial burden in the lungs and spleen, the Rv2299c/MPL-DDA inoculation did not show a significant protective effect on the Erdman strain.
(112) Next, it was assessed whether the Rv2299c+ESAT-6 fusion protein is potentially a BCG-prime booster in the challenge model of Mtb HN878, the highly pathogenic M. tuberculosis strain. Previous studies have shown that BCG-only vaccination of mice provides less protection against W-Beijing isolates compared to Mtb H37Rv at 10 weeks after post-infection (Lopez et al., 2003). Thus, as described above, the vaccine efficacy of the protein in the mouse model was tested using a clinically highly virulent HN878 strain, one of the W-Beijing families (Cha et al., 2015b). Four weeks after the final vaccination, mice were challenged with the Mtb HN878 strain, and bacterial load in their lungs was determined at 16 weeks (See
Example 10
(113) Immunogenicity of Antigen-Specific Th1 Immune Responses in Mice Infected with Mtb HN878
(114) 10.1 Experimental Method to Confirm the Induction of Antigen-Specific Multifunctional T Cells in the Mouse Lung with Immunity
(115) Each group of mice was vaccinated and sacrificed as described in Materials and Methods. 4 weeks after the final vaccination, each group of mice (n=6) was euthanized and their lung cells were stimulated with the labeled antigen in the presence of GolgiStop at 37° C. for 12 hours. The proportion of antigen-specific CD4+ T cells producing IFN-γ, TNF-α, and/or IL-2 in cells isolated from lungs of vaccinated mice was analyzed using multicolor flow cytometry while gating against CD4+ lymphocytes. The pie chart represents the average number of cells co-expressing IFN-γ, TNF-α and/or IL-2. The data were expressed as mean±SD obtained from 5 mice in each group, and independent sample t-test was used to determine a significance. *P<0.05, **p<0.01 and ***p<0.001 as compared to the MPL-DDA-alone group (independent sample t-test).
(116) 10.2 Experimental Method to Confirm Maintenance of Multifunctional T Cells in the Spleen after Challenge with Mycobacterium tuberculosis Strain HN878.
(117) After 16 weeks of infection, each group of mice (n=6) was euthanized, and their spleen cells (2.0×10.sup.6 cells) were stimulated with each antigen (5 μg/ml) in the presence of GolgiStop at 37° C. for 12 hours. The proportion of antigen-specific CD4+ T cells producing IFN-γ, TNF-α, and/or IL-2 in cells isolated from the lung of each group of mice was analyzed using multicolor flow cytometry while gating against CD4+ lymphocytes. The pie chart represents the average number of cells co-expressing IFN-γ, TNF-α and/or IL-2. The data were expressed as mean±SD obtained from 5 mice in each group, and independent sample t-test was used to determine a significance. *p<0.05, **p<0.01 and ***p<0.001 as compared to the MPL-DDA-alone group (independent sample t-test).
(118) 10.3 Analysis of the Aforementioned Experimental Results
(119) Th1-mediated immune responses and multifunctional T cells play an important role in prophylactic immunity against Mtb. Thus, the changes in T cell phenotype induced by Rv2299c+ESAT-6 fusion protein-vaccination was next evaluated. At 16 weeks after the challenge, lung cells (See
Example 11
(120) Consideration
(121) It was found that subunit protein vaccines are potentially useful in boosting BCG replacement or BCG-induced immune responses (Dalmia and Ramsay, 2012). A new vaccine development strategy is proposed to improve the preventive effect of TB vaccine candidates. Selecting the optimal antigen to include a multi-protein vaccine is the most important step in vaccine development. DCs regulate subsequent development of Th1 or Th2 types in naive T cell polarization and lymph node drainage. Thus, DC-activated protein-based vaccines can improve the prophylactic immunity of other antigens produced. In this study, it is found that the Rv2299c protein capable of activating DCs is a valuable target for the development of a TB vaccine. This indicates that the Rv2299c+ESAT-6 fusion protein significantly reduces the bacterial load of lungs after the challenge with highly virulent Mtb HN878 clinical strains.
(122) The basic principle of TB vaccine development designed to induce T-cell-based immunity is based on the assumption that the strong Th1 response specifically against the tuberculosis antigens is the essential mechanism of anti-tuberculosis immunity. Antigens that do not induce the Th1 response do not have a vaccine efficacy against Mtb, but not all of the proteins that induce a strong Th1 response elicit a significant protective effect (Orr et al., 2014). The MVA85A vaccine, which elicits a robust Th1 response against Ag85A, does not show a pronounced BCG boosting effect in humans (Tameris et al., 2013). It is important that the vaccine induces a memory T cell response and induces a long-term immune response. DCs play a critical role in effective activation of T cells and the induction of memory T cell responses. It is known that mice vaccinated with Mtb-infected DCs (Tascon et al., 2000) or antigen extract-treated DCs (Rubakova et al., 2007) are protected against Mtb infection. These results support the strategy development of an anti-tuberculosis vaccine that targets in vivo DCs (Sinha et al., 2007). In this study, in order to test the hypothesis that DC-activated proteins are potential vaccine candidates, it is an important research question to choose a reliable DC-activated protein. First, mycobacterial HSPs are selected because mycobacterial HSPs are associated with an ability to activate immune cell DCs such as macrophages and DCs (Wang et al., 2001, Wang et al., 2002, Franco et al., 2008) and adjuvant activity (Srivastava et al., 1998). This study reveals that Rv2299c (HSP90) among mycobacterial HSPs induce DC maturation through TLR4 signaling and MAPK and NF-κB activation. This activation leads to an increase in the expression of co-stimulatory molecules promoting Th1-type immune responses and the secretion of proinflammatory cytokines. Recently, it has been reported that DCs isolated from spleen cells of mice treated with Rv2299c result in increased expression of MHC molecules and co-stimulatory molecules and DC-loaded tumor antigens with Rv2299c treatment induce an increased anti-tumor immunity effect (Vo et al., 2015). These results and our study results suggest that Rv2299c has adjuvant activity through DC activation in vivo and ex vivo.
(123) It was reported that several mycobacterial proteins activate DCs to induce Th1 infection response through the TLR2 pathway (Bansal et al., 2010a, Byun et al., 2012a) or the TLR4 pathway (Choi et al., 2015, Kim et al., 2013), or to induce Th2 infection response (Bansal et al., 2010b) through TLR2 pathway (Bansal et al., 2010b). This indicates that each antigen has different activity in dendritic cells. Recombinant mycobacterial HSP70 is signaled through both TLR4 and TLR2, whereas mycobacterial HSP65 is signaled through TLR4 alone to activate immune cells (Bulut et al., 2005). Human HSP90 elicits biological activity through the TLR4 pathway (Thuringer et al., 2011, Hutchinson et al., 2009). This study demonstrates that Rv2299c of the HSP90 family activates DCs in a TLR4-, MyD88- and TRIF-dependent manner This is demonstrated by pulldown analysis and experiments using TRL4 or TRL2 knockout mice.
(124) It is assumed that it is important to activate T cells with anti-mycobacterial activity for a reliable DC-based vaccine. However, there is little known about the actual anti-mycobacterial effect elicited by the DC-activated protein which induces the Th1 immune response. This study demonstrates that T cells activated by Rv2299c-mature DC significantly inhibit Mtb growth in macrophages and induce large amounts of cytokine production compared to inactivated T cells. T cells activated non-specifically by LPS-matured DCs exhibited no anti-bactericidal activity. These results demonstrate that Rv2299c induces specific activation of naive CD+T cells with prophylactic activity.
(125) It has been reported that a subunit vaccine consisting of two to four fusion protein antigens induces a strong preventive response and effect equivalent to prevention induced only by BCG. Most people are vaccinated with BCG at infancy, but their efficacy diminishes over time (Bertholet et al., 2010). Thus, boosting BCG-induced prophylactic immunity may be the most practical strategy. Therefore, the prophylactic immune response and effects of fusion proteins composed of Rv2299c and ESAT-6 are investigated. ESAT-6 is selected as a fusion partner because ESAT-6 is one of the major antigens included in the vaccine in current clinical trials. In this study, mice inoculated with fusion protein showed similar efficacy as mice inoculated with BCG alone. It has been suggested that memory T cell recall responses do not depend on DCs, and other untechnical antigen-presenting cells may be sufficient for the initiation of secondary responses (Bertram et al., 2004, Dawicki and Watts, 2004), whereas other studies have demonstrated that activation of memory T cells mainly depends on DC in response to systemic or local infection (Zammit et al., 2005; Wakim et al., 2008). In this study, it is found that Rv2299c-mature DCs induce the effect/memory CD4+ T cells expansion obtained from Mtb-infected mice. These suggest that Rv2299c can induce a memory T cell recall response in BCG-vaccinated subjects. Boosting BCG with the Rv2299c-fused ESAT-6 protein reduces pathology and provides long-term protection against Mtb compared to BCG alone. In particular, since BCG vaccination on mouse provides less protection against W-Beijing isolation compared to Mtb H37Rv, the effect of the fusion protein on the Mtb HN878, a virulent clinical strain obtained in the W-Beijing family is determined (Lopez et al., 2003). This isolation causes death and extensive lung pathology in infected C57BL/6 mice.
(126) The preventive effect of the Rv2299c+ESAT-6 fusion protein vaccine is examined against the Mtb HN878 strain, a highly virulent W-Beijing strain, in the mouse model. Rv2299c+ESAT-6 fusion protein-immunized mice were substantially prevented after challenging the Mtb HN878 strain according to lung pathology and bacterial growth assessment (See
(127) In general, vaccine-induced prevention against Mtb infection is particularly associated with Ag-specific multifunctional IFN-γ.sup.+TNF-α.sup.+IL-2.sup.+ and TNF-α.sup.+IL-2.sup.+ CD4.sup.+ T cells in the lungs. Importantly, testing for Ag-immunized mice exhibits that immunization against the Rv2299c+ESAT-6 fusion protein remarkedly induces production of multifunctional CD4.sup.+ T cells in the lungs in pre-challenge and post-challenge (See
(128) In conclusion, these results suggest that Rv2299c is an excellent candidate for the rational design of multi-antigen effective TB vaccines. Therefore, more detailed studies are required to examine the specific vaccine efficacy and effective prevention mechanisms of the Rv2299c+ESAT-6 fusion protein in murine or guinea pig models.
(129) TABLE-US-00001 Rv2299c amino acid sequence (SEQ. ID. No. 1) MNAHVEQLEFQAEARQLLDLMVHSVYSNKDAFLRELISNASDALDKLRIE ALRNKDLEVD TSDLHIEIDADKAARTLTVRDNGIGMAREEVVDLIGTLAKSGTAELRAQL REAKNAAASE ELIGQFGIGFYSSFMVADKVQLLTRKAGESAATRWESSGEGTYTIESVED APQGTSVTLH LKPEDAEDDLHDYTSEWKIRNLVKKYSDFIAWPIRMDVERRTPASQEEGG EGGEETVTIE TETLNSMKALWARPKEEVSEQEYKEFYKHVAHAWDDPLEIIAMKAEGTFE YQALLFIPSH APFDLFDRDAHVGIQLYVKRVFIMGDCDQLMPEYLRFVKGVVDAQDMSLN VSREILQQDR QIKAIRRRLTKKVLSTIKDVQSSRPEDYRTFWTQFGRVLKEGLLSDIDNR ETLLGISSFV STYSEEEPTTLAEYVERMKDGQQQIFYATGETRQQLLKSPHLEAFKAKGY EVLLLTDPVD EVWVGMVPEFDGKPLQSVAKGEVDLSSEEDTSEAEREERQKEFADLLTWL QETLSDHVKE VRLSTRLTESPACLITDAFGMTPALARIYRASGQEVPVGKRILELNPSHP LVTGLRQAHQ DRADDAEKSLAETAELLYGTALLAEGGALEDPARFAELLAERLARTL