ANTIBODY DIRECTED AGAINST THE APOE AMINO-TERMINAL FRAGMENT OF 12KDA
20220242939 · 2022-08-04
Inventors
Cpc classification
C07K2317/30
CHEMISTRY; METALLURGY
C07K2317/32
CHEMISTRY; METALLURGY
A61P25/28
HUMAN NECESSITIES
C07K2317/34
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
International classification
A61P25/28
HUMAN NECESSITIES
Abstract
The disclosure relates to an antibody or antigen binding portion thereof, which binds to a neo-epitope of a C-terminal fragment of apolipoprotein E, to methods of producing such an antibody or antigen binding portion thereof, and to therapeutic and diagnostic uses thereof.
Claims
1. An antibody or antigen binding portion thereof that binds to a fragment of apolipoprotein E (ApoE), wherein the fragment has an apparent molecular weight of 12 kDa as measured by SDS-PAGE, and an N-terminus corresponding to an amino acid in full-length apolipoprotein E which is selected from the group consisting of amino acids L198, A199 and G200; and wherein the antibody or antigen binding portion thereof binds to an epitope comprising the N-terminus of the fragment.
2. The antibody or antigen binding portion thereof according to claim 1, wherein the antibody or antigen binding portion thereof binds selectively to the ApoE fragment and does not bind to full-length apolipoprotein E.
3. The antibody or antigen binding portion thereof according to claim 1 or claim 2, wherein said fragment of apolipoprotein E is selected from i) a fragment consisting of the amino acid sequence of any one of SEQ ID NOs:1-3; and ii) a fragment having at least 80% identity to any one of SEQ ID NOs: 1-3.
4. The antibody or antigen binding portion thereof according to any one of claims 1-3, wherein the antibody or antigen binding portion thereof binds to an epitope comprising amino acid residues selected from the following: (i) amino acid residues 200-205 in full-length ApoE (GQPLQE); (ii) amino acid residues 199-204 in full-length ApoE (AGQPLQ); (iii) amino acid residues 199-205 in full-length ApoE (AGQPLQE); (iv) amino acid residues 198-203 in full-length ApoE (LAGQPL); (v) amino acid residues 198-204 in full-length ApoE (LAGQPLQ); and (vi) amino acid residues 198-205 in full-length ApoE (LAGQPLQE).
5. The antibody or antigen binding portion thereof according to any one of claims 1-4, wherein said fragment of apolipoprotein E consists of the amino acid sequence of SEQ ID NO:1, optionally wherein the epitope comprises amino acid residues 200-205 in full-length apolipoprotein E.
6. A method of producing an antibody or an antigen binding portion thereof, comprising a step of immunizing a host mammal with a peptide immunogen comprising an N-terminal amino acid sequence selected from the group consisting of LAGQPL (SED ID NO:4), AGQPLQ (SEQ ID NO:5), GQPLQE (SEQ ID NO:6), LAGQPLQ (SEQ ID NO:7), AGQPLQE (SEQ ID NO:8) and LAGQPLQE (SEQ ID NO:9).
7. The method according to claim 6, wherein said N-terminal amino acid sequence is GQPLQE (SEQ ID NO:6).
8. An antibody or antigen binding portion thereof, obtainable by a method according to claim 6 or claim 7.
9. The antibody or antigen binding portion thereof according to any one of claim 1-5 or 8, wherein the antibody or antigen binding portion thereof comprises a variable heavy chain domain (VH) comprising three CDR sequences (CDR-H1, CDR-H2 and CDR-H3), wherein the three VH CDR sequences are independently selected from: CDR-H1 selected from the group consisting of SEQ ID NO: 10, 15, 18 and 21; CDR-H2 selected from the group consisting of SEQ ID NO: 11, 13, 16, 19 and 22; and CDR-H3 selected from the group consisting of SEQ ID NO: 12, 14, 17, 20 and 23.
10. The antibody or antigen binding portion thereof according to any one of claims 1-5 and 8-9, wherein the antibody or antigen binding portion thereof comprises a variable light chain domain (VL) comprising three CDR sequences (CDR-L1, CDR-L2 and CDR-L3), wherein the three VL CDR sequences are independently selected from: CDR-L1 selected from the group consisting of SEQ ID NO: 24, 27, 29, 31 and 32; CDR-L2 being SEQ ID NO: 25; and CDR-L3 selected from the group consisting of SEQ ID NO: 26, 28, 30 and 33.
11. The antibody or antigen binding portion thereof according to any one of claims 1-5 and 8-10, wherein the antibody or antigen binding portion thereof comprises a heavy chain variable domain (VH) comprising or consisting of an amino acid sequence selected from: i) the group consisting of SEQ ID NOs: 34, 36, 38, 40, 42 and 43; and ii) a sequence having at least 70% identity to any one of SEQ ID NOs: 34, 36, 38, 40, 42 and 43.
12. The antibody or antigen binding portion thereof according to any one of claims 1-5 and 8-11, wherein the antibody or antigen binding portion thereof comprises a light chain variable domain (VL) comprising or consisting of an amino acid sequence selected from: i) the group consisting of SEQ ID NOs: 35, 37, 39, 41 and 44; and ii) a sequence having at least 70% identity to any one of SEQ ID NO:35, 37, 39, 41 and 44.
13. The antibody or antigen binding portion thereof according to any one of claim 1-5 or 8, wherein the antibody or antigen binding portion thereof comprises a variable heavy chain domain (VH) comprising three CDR sequences (CDR-H1, CDR-H2 and CDR-H3), wherein the three VH CDR sequences are independently selected from: CDR-H1 selected from the group consisting of SEQ ID NO: 59, 62 and 65; CDR-H2 selected from the group consisting of SEQ ID NO: 60, 63, 66, 68 and 70; and CDR-H3 selected from the group consisting of SEQ ID NO: 61, 64, 67 and 69.
14. The antibody or antigen binding portion thereof according to any one of claims 1-5, 8 and 13, wherein the antibody or antigen binding portion thereof comprises a variable light chain domain (VL) comprising three CDR sequences (CDR-L1, CDR-L2 and CDR-L3), wherein the three VL CDR sequences are independently selected from: CDR-L1 selected from the group consisting of SEQ ID NO: 71, 74, 76, 79 and 80; CDR-L2 selected from the group consisting of SEQ ID NO: 72 and 77; and CDR-L3 selected from the group consisting of SEQ ID NO: 73, 75, 78 and 81.
15. The antibody or antigen binding portion thereof according to any one of claims 1-5, 8 and 13-14, wherein the antibody or antigen binding portion thereof comprises a heavy chain variable domain (VH) comprising or consisting of an amino acid sequence selected from: i) the group consisting of SEQ ID NOs: 82, 84, 86, 88 and 90; and ii) a sequence having at least 70%, at least 80%, at least 90%, or at least 95% identity to any one of SEQ ID NOs: 82, 84, 86, 88 and 90.
16. The antibody or antigen binding portion thereof according to any one of claims 1-5, 8 and 13-15, wherein the antibody or antigen binding portion thereof comprises a light chain variable domain (VL) comprising or consisting of an amino acid sequence selected from: i) the group consisting of SEQ ID NOs: 83, 85, 87, 89 and 91; and ii) a sequence having at least 70%, at least 80%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 83, 85, 87, 89 and 91.
17. The antibody or antigen binding portion thereof according to any one of claim 1-5 or 8, wherein the antibody or antigen binding portion thereof comprises a variable heavy chain domain (VH) comprising three CDR sequences (CDR-H1, CDR-H2 and CDR-H3), wherein the three VH CDR sequences are independently selected from: CDR-H1 selected from the group consisting of SEQ ID NO: 62, 94 and 97; CDR-H2 selected from the group consisting of SEQ ID NO: 92, 95 and 98; and CDR-H3 selected from the group consisting of SEQ ID NO: 93, 96 and 99.
18. The antibody or antigen binding portion thereof according to any one of claims 1-5, 8 and 17, wherein the antibody or antigen binding portion thereof comprises a variable light chain domain (VL) comprising three CDR sequences (CDR-L1, CDR-L2 and CDR-L3), wherein the three VL CDR sequences are independently selected from: CDR-L1 selected from the group consisting of SEQ ID NO: 100, 103, 105 and 108; CDR-L2 selected from the group consisting of SEQ ID NO: 25, 101, 104 and 106; and CDR-L3 selected from the group consisting of SEQ ID NO: 28, 102 and 107.
19. The antibody or antigen binding portion thereof according to any one of claims 1-5, 8 and 17-18, wherein the antibody or antigen binding portion thereof comprises a heavy chain variable domain (VH) comprising or consisting of an amino acid sequence selected from: i) the group consisting of SEQ ID NOs: 109, 111, 113 and 115; and ii) a sequence having at least 70%, at least 80%, at least 90%, or at least 95% identity to any one of SEQ ID NOs: 109, 111, 113 and 115.
20. The antibody or antigen binding portion thereof according to any one of claims 1-5, 8 and 17-19, wherein the antibody or antigen binding portion thereof comprises a light chain variable domain (VL) comprising or consisting of an amino acid sequence selected from: i) the group consisting of SEQ ID NOs: 110, 112, 114 and 116; and ii) a sequence having at least 70%, at least 80%, at least 90%, or at least 95% identity to any one of SEQ ID NO: 110, 112, 114 and 116.
21. A pharmaceutical composition comprising an antibody or antigen binding portion thereof according to any one of claims 1-5 and 8-20 and at least one pharmaceutically acceptable excipient or carrier.
22. An antibody or antigen binding portion thereof according to any one of claims 1-5 and 8-20, or pharmaceutical composition according to claim 21, for use in therapy.
23. A method of detecting or diagnosing a neurological disorder or a disorder characterized by a loss of cognitive memory capacity in a subject, the method comprising contacting a sample obtained from the subject with an antibody or antigen binding portion thereof according to any one of claims 1-5 and 8-20.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0264]
[0265]
[0266]
[0267]
[0268]
[0269]
[0270]
[0271]
[0272]
[0273]
[0274]
[0275]
[0276]
[0277]
[0278]
[0279]
[0280]
[0281]
[0282]
[0283]
[0284]
[0285]
[0286]
[0287]
[0288]
[0289]
[0290]
[0291]
[0292]
[0293]
[0294]
DETAILED DESCRIPTION
[0295] One object of the invention is to further elucidate the structure of ApoE fragments in the brains of AD patients.
[0296] Another object is to provide novel insights into the function that ApoE fragments have in the genesis of disease.
[0297] Another object of the invention is to enable therapeutic intervention through targeting of novel epitopes on such ApoE fragments.
[0298] Another object of the invention is to enable the diagnosis of AD and other neurodegenerative disorders via detection of ApoE fragments implicated in disease formation and/or progression.
[0299] Another object of the invention is to provide antibodies, or antigen binding portions thereof, having a novel and useful binding specificity.
[0300] One or more of these and other objects that are apparent to the skilled person from reading the entire disclosure herein are met by the various aspects disclosed.
Anti-ApoE Antibodies and Methods of Production
[0301] Thus, in a first aspect, the disclosure provides an antibody or antigen binding portion that binds to a fragment of apolipoprotein E (ApoE), wherein the fragment has [0302] an apparent molecular weight of 12 kDa as measured by SDS-PAGE, and [0303] an N-terminus corresponding to an amino acid in full-length apolipoprotein E which is selected from the group consisting of amino acids L198, A199 and G200; and wherein the antibody or antigen binding portion thereof binds to an epitope comprising the N-terminus of the fragment. The full-length apolipoprotein E from which the fragment derives is typically human ApoE.
[0304] The invention is based on detailed insights into the structure of putatively neurotoxic ApoE fragments that were isolated from brains of Alzheimer's disease patients, as detailed in Examples 1-7 which follow. The identification of the exact sequence of these fragments enables the generation of inventive antibodies, or antigen binding portions thereof, that are specific for the N-terminal neo-epitopes formed upon ApoE fragmentation. Generation and characterization of exemplary such antibodies is detailed in Examples 8-18.
[0305] Without wishing to be bound by theory, it is contemplated that such novel antibodies, or antigen binding portions thereof, are useful in the diagnosis, prognosis and/or treatment of neurodegenerative diseases such as Alzheimer's disease, through specific binding to the putatively neurotoxic ApoE fragments.
[0306] In certain embodiments, the antibodies and antigen binding portions thereof of the first aspect bind selectively to the ApoE fragments described herein. As used herein, the term “bind selectively” refers to the preferential binding of the antibody or antigen binding portion thereof to the ApoE fragment target. In certain embodiments, the antibodies and antigen binding portions thereof of the first aspect do not bind to full-length apolipoprotein E, particularly full-length human apolipoprotein E.
[0307] In one embodiment, the antibody or antigen binding portion thereof of the first aspect is capable of selective binding to an epitope comprising the N-terminus of a fragment of apolipoprotein E, which fragment has an N-terminus corresponding to amino acid G200 in full-length ApoE.
[0308] In another embodiment, the antibody or antigen binding portion thereof of the first aspect is capable of selective binding to an epitope comprising the N-terminus of a fragment of apolipoprotein E, which fragment has an N-terminus corresponding to amino acid A199 in full-length ApoE.
[0309] In another embodiment, the antibody or antigen binding portion thereof of the first aspect is capable of selective binding to an epitope comprising the N-terminus of a fragment of apolipoprotein E, which fragment has an N-terminus corresponding to amino acid L198 in full-length ApoE.
[0310] In another embodiment, the antibody or antigen binding portion thereof of the first aspect is capable of selective binding to an epitope comprising the N-terminus of a fragment of apolipoprotein E, which fragment is selected from [0311] i) the group consisting of SEQ ID NO:1-3; and [0312] ii) a sequence having at least 80% identity to any one of SEQ ID NO:1-3.
[0313] In a more specific embodiment, i) in this definition is SEQ ID NO:1. In an alternative embodiment, i) in this definition is SEQ ID NO:2. In another embodiment, i) in this definition is SEQ ID NO:3.
[0314] As defined in this group of embodiments, the ApoE fragment with the epitope of interest may have a sequence that has at least 80% sequence identity to a sequence selected from SEQ ID NO:1-3. In one embodiment, said sequence may have at least 85%, such as at least 90%, such as at least 95%, such as 100%, identity to a sequence selected from SEQ ID NO:1-3. In one embodiment, such variation in the target sequence, to which the antibody or antigen binding portion thereof binds, is subject to the condition that the fragment retains the first three, such as the first four, such as the first five, such as the first six, amino acids of the sequence selected from SEQ ID NO:1-3, starting from the N-terminal, so as to ensure that the N-terminal neo-epitope of the fragment is present.
[0315] In the embodiment wherein ii) has 100% identity to i), the fragment of ApoE consists of an amino acid sequence selected from the group consisting of SEQ ID NO:1-3. In a more specific embodiment, the fragment consists of SEQ ID NO:1. In an alternative embodiment, the fragment consists of SEQ ID NO:2. In another alternative embodiment, the fragment consists of SEQ ID NO:3.
[0316] The antibodies and antigen binding portions of the first aspect bind to neo-epitopes at the N-terminus of the ApoE fragments described herein. In one embodiment, the antibody or antigen binding portion thereof binds to an epitope comprising amino acid residues 200-205 in full-length apolipoprotein E (GQPLQE). In one embodiment, the antibody or antigen binding portion thereof binds to an epitope comprising amino acid residues 199-204 in full-length apolipoprotein E (AGQPLQ). In one embodiment, the antibody or antigen binding portion thereof binds to an epitope comprising amino acid residues 199-205 in full-length apolipoprotein E (AGQPLQE). In one embodiment, the antibody or antigen binding portion thereof binds to an epitope comprising amino acid residues 198-203 in full-length apolipoprotein E (LAGQPL). In one embodiment, the antibody or antigen binding portion thereof binds to an epitope comprising amino acid residues 198-204 in full-length apolipoprotein E (LAGQPLQ). In one embodiment, the antibody or antigen binding portion thereof binds to an epitope comprising amino acid residues 198-205 in full-length apolipoprotein E (LAGQPLQE).
[0317] In a second aspect of the disclosure, there is provided a method of production of an antibody or an antigen binding portion thereof, comprising a step of immunizing a suitable host mammal with an immunogen that comprises one of the identified neo-epitopes of the putatively neurotoxic ApoE fragments disclosed herein. As such, this method comprises immunizing the host with a peptide immunogen comprising an N-terminal amino acid sequence selected from the group consisting of LAGQPL (SED ID NO:4), AGQPLQ (SEQ ID NO:5), GQPLQE (SEQ ID NO:6), LAGQPLQ (SEQ ID NO:7), AGQPLQE (SEQ ID NO:8) and LAGQPLQE (SEQ ID NO:9). The host mammal is preferably a non-human mammal.
[0318] In one embodiment of the second aspect, the peptide immunogen comprises an N-terminal amino acid sequence which is GQPLQE (SEQ ID NO:6). In another embodiment, the N-terminal amino acid sequence of the peptide immunogen is selected from LAGQPL (SED ID NO:4), LAGQPLQ (SEQ ID NO:7) and LAGQPLQE (SEQ ID NO:9). In another embodiment, the N-terminal amino acid sequence is selected from AGQPLQ (SEQ ID NO:5) and AGQPLQE (SEQ ID NO:8).
[0319] In addition to the step of immunizing a suitable host, the method of the second aspect of the disclosure may suitably comprise additional steps of a standard nature for the generation of antibodies from the immunized animals, such as plasma screening for reactive antibodies, isolation of spleen cells, generation of hybridomas, and other measures known to the person of skill in the art of antibody generation.
[0320] In a third aspect of the disclosure, there is provided an antibody or antigen binding portion thereof, which is obtainable by a method according to the second aspect. Such an antibody or antigen binding portion thereof is likely to exhibit the desired selectivity shown by the antibody, or antigen binding portion thereof, of the first aspect, and to be useful in the same contexts of diagnosis, prognosis and treatment of neurodegenerative disease.
[0321] In some embodiments of the antibody or antigen binding portion thereof according to the first and third aspects, the antibody or antigen binding portion thereof is selected from the group consisting of full-length antibodies, Fab fragments, Fab′ fragments, F(ab′).sub.2 fragments, Fc fragments, Fv fragments, single chain Fv fragments, (scFv).sub.2 and domain antibodies. In one embodiment, said at least one antibody or antigen binding portion thereof is selected from full-length antibodies, Fab fragments and scFv fragments. In one particular embodiment, the antibody is a full length antibody. In one embodiment, the antibody or antigen binding portion thereof is selected from the group consisting of monoclonal antibodies, human antibodies, humanized antibodies, and antigen binding portions thereof. In another embodiment, it is a monoclonal antibody or antigen binding portion thereof.
[0322] In a more specific such embodiment, the antibody or antigen binding portion thereof comprises at least three complementarity determining regions (CDRs).
[0323] As the skilled person will realize, embodiments of the antibody or antigen binding portion thereof of the first and third aspects of the disclosure may be characterized by specific amino acid sequences in the regions determining its binding capability, such as the CDRs of the variable light and variable heavy chains, or indeed the entire variable light and/or heavy chain domains or regions. Non-limiting examples of such specific amino acid sequences are provided herein for the specific antibodies generated as described in Examples 9-18. It is contemplated that the specific sequence information provided for the generated antibodies enables the skilled person to define combinations and variations of these sequences within the scope of the invention.
[0324] Thus, in one embodiment, the antibody or antigen binding portion thereof comprises the following three CDRs in any combination of CDR-H1/CDR-H2/CDR-H3, e.g. in a heavy chain variable region when present: [0325] CDR-H1 selected from the group consisting of SEQ ID NO:10, 15, 18 and 21; [0326] CDR-H2 selected from the group consisting of SEQ ID NO:11, 13, 16, 19 and 22; and [0327] CDR-H3 selected from the group consisting of SEQ ID NO:12, 14, 17, 20 and 23.
[0328] In another embodiment, the antibody or antigen binding portion thereof comprises the following three CDRs in any combination of CDR-L1/CDR-L2/CDR-L3, e.g. in a light chain variable region when present: [0329] CDR-L1 selected from the group consisting of SEQ ID NO:24, 27, 29, 31 and 32; [0330] CDR-L2 being SEQ ID NO:25; and [0331] CDR-L3 selected from the group consisting of SEQ ID NO:26, 28, 30 and 33.
[0332] In another embodiment, the antibody or antigen binding portion thereof comprises the six CDRs CDR-H1/CDR-H2/CDR-H3/CDR-L1/CDR-L2/CDR-L3 selected from the sequences listed above, in any combination thereof.
[0333] In specific embodiments of said first moiety, the combinations of CDRs are those present in the antibodies exemplified in Examples 9-12 (see Table 4).
[0334] In another more specific embodiment of the antibody or an antigen binding portion thereof according to the first or third aspect of the disclosure, the antibody or antigen binding portion thereof comprises a heavy chain variable region (VH) sequence selected from the group consisting of SEQ ID NO:34, 36, 38, 40, 42 and 43, and sequences having at least 70% identity thereto.
[0335] In another more specific embodiment of the antibody or an antigen binding portion thereof according to the first or third aspect of the disclosure, the antibody or antigen binding portion thereof comprises a light chain variable region (VL) sequence selected from the group consisting of SEQ ID NO:35, 37, 39, 41 and 44, and sequences having at least 70% identity thereto.
[0336] In another embodiment, the antibody or antigen binding portion thereof comprises the following three CDRs in any combination of CDR-H1/CDR-H2/CDR-H3, e.g. in a heavy chain variable region when present: [0337] CDR-H1 selected from the group consisting of SEQ ID NO: 59, 62 and 65; [0338] CDR-H2 selected from the group consisting of SEQ ID NO: 60, 63, 66, 68 and 70; and [0339] CDR-H3 selected from the group consisting of SEQ ID NO: 61, 64, 67 and 69.
[0340] In another embodiment, the antibody or antigen binding portion thereof comprises the following three CDRs in any combination of CDR-L1/CDR-L2/CDR-L3, e.g. in a light chain variable region when present: [0341] CDR-L1 selected from the group consisting of SEQ ID NO: 71, 74, 76, 79 and 80; [0342] CDR-L2 selected from the group consisting of SEQ ID NO: 72 and 77; and [0343] CDR-L3 selected from the group consisting of SEQ ID NO: 73, 75, 78 and 81.
[0344] In another embodiment, the antibody or antigen binding portion thereof comprises the six CDRs CDR-H1/CDR-H2/CDR-H3/CDR-L1/CDR-L2/CDR-L3 selected from the sequences listed above, in any combination thereof.
[0345] In specific embodiments of said first moiety, the combinations of CDRs are those present in the antibodies exemplified in Examples 13-15 (see Table 8).
[0346] In another more specific embodiment of the antibody or an antigen binding portion thereof according to the first or third aspect of the disclosure, the antibody or antigen binding portion thereof comprises a heavy chain variable region (VH) sequence selected from the group consisting of SEQ ID NOs: 82, 84, 86, 88 and 90, and sequences having at least 70% identity thereto.
[0347] In another more specific embodiment of the antibody or an antigen binding portion thereof according to the first or third aspect of the disclosure, the antibody or antigen binding portion thereof comprises a light chain variable region (VL) sequence selected from the group consisting of SEQ ID NOs: 83, 85, 87, 89 and 91, and sequences having at least 70% identity thereto.
[0348] In another embodiment, the antibody or antigen binding portion thereof comprises the following three CDRs in any combination of CDR-H1/CDR-H2/CDR-H3, e.g. in a heavy chain variable region when present: [0349] CDR-H1 selected from the group consisting of SEQ ID NO: 62, 94 and 97; [0350] CDR-H2 selected from the group consisting of SEQ ID NO: 92, 95 and 98; and [0351] CDR-H3 selected from the group consisting of SEQ ID NO: 93, 96 and 99.
[0352] In another embodiment, the antibody or antigen binding portion thereof comprises the following three CDRs in any combination of CDR-L1/CDR-L2/CDR-L3, e.g. in a light chain variable region when present: [0353] CDR-L1 selected from the group consisting of SEQ ID NO: 100, 103, 105 and 108; [0354] CDR-L2 selected from the group consisting of SEQ ID NO: 25, 101, 104 and 106; and [0355] CDR-L3 selected from the group consisting of SEQ ID NO: 28, 102 and 107.
[0356] In another embodiment, the antibody or antigen binding portion thereof comprises the six CDRs CDR-H1/CDR-H2/CDR-H3/CDR-L1/CDR-L2/CDR-L3 selected from the sequences listed above, in any combination thereof.
[0357] In specific embodiments of said first moiety, the combinations of CDRs are those present in the antibodies exemplified in Examples 16-18 (see Table 13).
[0358] In another more specific embodiment of the antibody or an antigen binding portion thereof according to the first or third aspect of the disclosure, the antibody or antigen binding portion thereof comprises a heavy chain variable region (VH) sequence selected from the group consisting of SEQ ID NOs: 109, 111, 113 and 115, and sequences having at least 70% identity thereto.
[0359] In another more specific embodiment of the antibody or an antigen binding portion thereof according to the first or third aspect of the disclosure, the antibody or antigen binding portion thereof comprises a light chain variable region (VL) sequence selected from the group consisting of SEQ ID NOs: 110, 112, 114 and 116, and sequences having at least 70% identity thereto.
[0360] In one embodiment, the definitions of VH and VL sequences of the antibody or antigen binding portion thereof is limited to any one of the listed sequences and sequences having at least 75%, such as at least 80%, such as at least 85%, such as at least 90%, such as at least 95%, such as at least 98%, such as at least 100% identity thereto.
[0361] In specific embodiments, the combinations of VH/VL are those present in the antibodies exemplified in Examples 9-18 (see Tables 3, 7 and 12 in particular).
[0362] For embodiments wherein the variable domains of the antibodies or antigen binding fragments are defined by a particular percentage sequence identity to a reference sequence, the VH and/or VL domains may retain identical CDR sequences to those present in the reference sequence such that the variation is present only within the framework regions.
[0363] As used herein, the terms “selective binding to X” and “affinity for X”, wherein X is an antigen or an epitope, refer to a property of an antibody or antigen binding portion thereof which may be tested for example by ELISA, by surface plasmon resonance (SPR), by Kinetic Exclusion Assay (KinExA®) or by bio-layer interferometry (BLI). The skilled person is aware of these methods and others.
[0364] For example, binding affinity for antigen or epitope X may be tested in an experiment in which an antibody or antigen binding portion thereof to be tested is captured on ELISA plates coated with antigen X or an antigen exhibiting the epitope X, and a biotinylated detector antibody is added, followed by streptavidin-conjugated HRP. Alternatively, said detector antibody may be directly conjugated with HRP. TMB substrate is added and the absorbance at 450 nm is measured using an ELISA multi-well plate reader. The skilled person may then interpret the results obtained by such experiments to establish at least a qualitative measure of the binding affinity of the antibody or antigen binding portion thereof for X. If a quantitative measure is desired, for example to determine the EC50 value (the half maximal effective concentration) for the interaction, ELISA may also be used. The response of the antibody or antigen binding portion thereof against a dilution series of X may be measured using ELISA as described above. The skilled person may then interpret the results obtained by such experiments and EC50 values may be calculated from the results, using for example Graph Pad Prism 8 and non-linear regression.
[0365] As used herein, the term “EC50” refers to the half maximal effective concentration of an antibody or antigen binding portion thereof which induces a response halfway between the baseline and maximum after a specified exposure time.
[0366] Additionally, inhibition ELISA may be used to obtain a quantitative measure of interaction by determination of the “IC50” (the half maximal inhibitory concentration). In an inhibition ELISA, the concentration of an antigen or epitope X in a fluid sample is measured by detecting interference in an expected signal output. In principle, a known antigen or epitope-bearing substance is used to coat a multiwell plate. In parallel, an antibody or antigen binding portion thereof with putative affinity for the antigen or epitope is added and incubated with a solution containing antigen at varied concentrations. Following standard blocking and washing steps, samples containing the mixture of said antibody or antigen binding portion thereof and the antigen or epitope are added to the well. Labeled detection antibody with affinity for the antigen- or epitope-binding antibody or antigen binding portion thereof is then applied for detection using relevant substrates (for example TMB). In principle, if there is a high concentration of antigen or epitope in the fluid sample, a significant reduction in signal output will be observed. In contrast, if there is very little antigen or epitope in the fluid sample, there will be very little reduction in the expected signal output. The skilled person appreciates that the signal output is also dependent on the affinity of the antibody or antigen binding portion thereof for said antigen or epitope.
[0367] As used herein, the term “IC50” refers to the half maximal inhibitory concentration of an antibody or antigen binding portion thereof which induces a response halfway between the baseline and maximum inhibition after a specified exposure time. Herein, a lower IC50 value indicates that a lower concentration of antigen or epitope is required to interfere with the binding of the detection antibody to the known antigen or epitope coated on the plate, as compared to a higher IC50 value. Thus, a lower IC50 value typically corresponds to a higher affinity.
[0368] The binding affinity of an antibody or antigen binding portion thereof may also be tested by surface plasmon resonance (SPR). For example, said binding affinity may be tested in an experiment in which antigen or epitope X is immobilized on a sensor chip of the instrument, and the sample containing the antibody or antigen binding portion thereof to be tested is passed over the chip. Alternatively, the antibody or antigen binding portion thereof to be tested may be immobilized on a sensor chip of the instrument, and a sample containing X is passed over the chip. The skilled person may then interpret the results obtained by such experiments to establish at least a qualitative measure of the binding affinity of the moiety for X. If a quantitative measure is desired, for example to determine a K.sub.D value for the interaction, SPR may also be used. Binding values may for example be defined in a Biacore (GE Healthcare) or PrateOn XPR 36 (Bio-Rad) instrument. The antigen or epitope is suitably immobilized on a sensor chip of the instrument, and samples of the antibody or antigen binding portion thereof whose affinity is to be determined are prepared by serial dilution and injected. K.sub.D values may then be calculated from the results using for example the 1:1 Langmuir binding model of the Biacore Insight Evaluation Software 2.0 or other suitable software, typically provided by the instrument manufacturer.
[0369] Another method for determining binding affinity of an antibody or antigen binding portion thereof to antigen or epitope X is the Kinetic Exclusion Assay (KinExA; Sapidyne Instruments Inc; Darling and Brault, Assay and Drug Dev Tech (2004) 2(6):647-657) for measurements of the equilibrium binding affinity and kinetics between unmodified molecules in solution. A KinExA K.sub.D analysis requires immobilization of one interaction partner (e.g. the titrated binding partner) to a solid phase, which is then used as a probe to capture the other interaction partner (e.g. the constant binding partner) free in solution once an equilibrium is reached.
[0370] The binding affinity may also be measured by bio-layer interferometry (BLI), a label-free technology for measuring biomolecular interactions within the interactome. It is an optical analytical technique that analyzes the interference pattern of white light reflected from two surfaces: a layer of immobilized protein on the biosensor tip, and an internal reference layer. The binding between a ligand (antigen or epitope X) immobilized on the biosensor tip surface and an analyte (such as an antibody or antigen binding portion thereof with affinity for X) in solution produces an increase in optical thickness at the biosensor tip resulting in a wavelength shift, AA, which is a direct measure of the change in thickness of the biological layer. Interactions are measured in real time, providing the ability to monitor binding specificity, rates of association and dissociation, or concentration, with precision and accuracy.
[0371] The skilled person is aware of the above mentioned and other methods for measuring the affinity of an antibody or antigen binding portion thereof for antigen or epitope X, either qualitatively or quantitatively or both.
[0372] As used herein, the term “antibody or antigen binding portion thereof” encompasses not only full-length or intact polyclonal or monoclonal antibodies, but also antigen binding portions thereof, such as Fab, Fab′, F(ab).sub.2, Fabs, Fv and variants thereof, fusion proteins comprising one or more antibody portions, humanized antibodies, chimeric antibodies, minibodies, diabodies, triabodies, tetrabodies, linear antibodies, single chain antibodies, multispecific antibodies (e.g. bispecific antibodies) and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity, including glycosylation variants of antibodies, amino acid sequence variants of antibodies and covalently modified antibodies. Further examples of modified antibodies and antigen binding portions thereof include nanobodies, AlbudAbs, DARTs (dual affinity re-targeting), BiTEs (bispecific T-cell engager), TandAbs (tandem diabodies), DAFs (dual acting Fab), two-in-one antibodies, SMIPs (small modular immunopharmaceuticals), FynomAbs (fynomers fused to antibodies), DVD-Igs (dual variable domain immunoglobulin), CovX-bodies (peptide modified antibodies), duobodies and triomAbs. This listing of variants of antibodies and antigen binding portions thereof is not to be seen as limiting, and the skilled person is aware of other suitable variants.
[0373] A full-length antibody comprises two heavy chains and two light chains. Each heavy chain contains a heavy chain variable region (VH) and first, second and third constant regions (CH1, CH2 and CH3). Each light chain contains a light chain variable region (VL) and a light chain constant region (CL). Depending on the amino acid sequence of the constant domain of its heavy chains, antibodies are assigned to different classes. There are six major classes of antibodies: IgA, IgD, IgE, IgG, IgM and IgY, and several of these may be further divided into subclasses, e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2. The term “full-length antibody” as used herein, refers to an antibody of any class, such as IgD, IgE, IgG, IgA, IgM or IgY (or any sub-class thereof). The subunit structures and three-dimensional configurations of different classes of antibodies are well known.
[0374] The term “antigen binding portion” refers to a portion or region of an antibody molecule, or a derivative thereof, that retains all or a significant part of the antigen binding of the corresponding full-length antibody. An antigen binding portion may comprise the heavy chain variable region (VH), the light chain variable region (VL), or both. Each of the VH and VL regions or domains typically contains three complementarity determining regions CDR1, CDR2 and CDR3, denoted CDR-H1, CDR-H2 and CDR-H3 for the CDRs from the VH domain and CDR-L1, CDR-L2 and CDR-L3 for the CDRs from the VL domain. The three CDRs in VH or VL are flanked by framework regions (FR1, FR2, FR3 and FR4). As briefly listed above, examples of antigen binding portions include, but are not limited to: (1) a Fab fragment, which is a monovalent fragment having a VL-CL chain and a VH-CH1 chain; (2) a Fab′ fragment, which is a Fab fragment with the heavy chain hinge region, (3) a F(ab′).sub.2 fragment, which is a dimer of Fab′ fragments joined by the heavy chain hinge region, for example linked by a disulfide bridge at the hinge region; (4) an Fc fragment; (5) an Fv fragment, which is the minimum antibody fragment having the VL and VH domains of a single arm of an antibody; (6) a single chain Fv (scFv) fragment, which is a single polypeptide chain in which the VH and VL domains of an scFv are linked by a peptide linker; (7) an (scFv).sub.2, which comprises two VH domains and two VL domains, which are associated through the two VH domains via disulfide bridges and (8) a domain antibody, which may be an antibody single variable domain (VH or VL) polypeptide that specifically bind antigen. Antigen binding portions can be prepared via routine methods. For example, F(ab′).sub.2 fragments can be produced by pepsin digestion of a full-length antibody molecule, and Fab fragments can be generated by reducing the disulfide bridges of F(ab′).sub.2 fragments. Alternatively, portions can be prepared via recombinant technology by expressing the heavy and light chain portions in suitable host cells (e.g., E. coli, yeast, mammalian, plant or insect cells) and having them assembled to form the desired antigen binding portions either in vivo or in vitro. A single-chain antibody can be prepared via recombinant technology by linking a nucleotide sequence coding for a heavy chain variable region and a nucleotide sequence coding for a light chain variable region. For example, a flexible linker may be incorporated between the two variable regions.
[0375] Furthermore, the skilled person is aware of the meaning of the terms polyclonal antibodies and monoclonal antibodies. Polyclonal antibodies are normally generated by administering an antigen to an animal. Said antigen will evoke an immune response giving rise to polyclonal antibodies. Monoclonal antibodies are made by immunizing an animal, usually a mouse, with an antigen and the subsequent isolation of the spleen from said animal. Isolated spleen cells are immortalized by fusion with myeloma cells to give rise to hybridoma cells. Each hybridoma cell produces a unique monoclonal antibody. The term “human antibody” as used herein, refers to antibodies having variable and constant regions corresponding to, or derived from, antibodies obtained from human subjects. The term “chimeric antibodies” as used herein, refers to recombinant or genetically engineered antibodies, such as for example antibodies with variable regions (VH and VL) of mouse origin and human constant region (Fc), to reduce the antibodies' immunogenicity. The term “humanized antibodies” refers to antibodies from non-human species whose protein sequences have been modified to increase their similarity to antibody variants produced naturally in humans, in order to reduce immunogenicity of the full antibody itself.
[0376] In yet another embodiment, the antibody or antigen binding portion thereof of the first and third aspects of the disclosure is selected from the group consisting of human antibodies, humanized antibodies and antigen binding portions thereof. In one particular embodiment, said antibody or antigen binding portion thereof is a humanized antibody or an antigen binding portion thereof.
Pharmaceutical Compositions
[0377] In a fourth aspect, there is provided a pharmaceutical composition comprising an antibody or antigen binding portion thereof as described herein and at least one pharmaceutically acceptable excipient or carrier.
[0378] Techniques for formulating antibodies for human therapeutic use are well known in the art and are reviewed, for example, in Wang et al., Journal of Pharmaceutical Sciences, Vol. 96, pp1-26, 2007, the contents of which are incorporated herein in their entirety.
[0379] Pharmaceutically acceptable excipients that may be used to formulate the compositions include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances (for example sodium carboxymethylcellulose), polyethylene glycol, polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, polyethylene glycol and wool fat.
[0380] In certain embodiments, the pharmaceutical compositions are formulated for administration to a subject via any suitable route of administration including but not limited to intramuscular, intravenous, intradermal, intraperitoneal injection, subcutaneous, epidural, nasal, oral, rectal, topical, inhalational, buccal (e.g., sublingual), and transdermal administration. In preferred embodiments, the composition is formulated for intravenous or subcutaneous administration.
Methods of Prevention, Treatment, Detection and Diagnosis
[0381] The antibodies or antigen binding portions thereof according to the present disclosure may be useful as therapeutic and/or diagnostic agents.
[0382] Hence, in a fifth aspect of the present disclosure, there is provided an antibody or antigen binding portion thereof according to the first or third aspect, or a pharmaceutical composition according to the fourth aspect, for use as a medicament.
[0383] In a sixth aspect of the disclosure, there is provided an antibody or antigen binding portion thereof according to the first or third aspect, or a pharmaceutical composition according to the fourth aspect, for use as a diagnostic agent.
[0384] Also provided are methods of preventing, treating or diagnosing disease or assessing disease prognosis, wherein an antibody or antigen binding portion thereof as disclosed herein is administered to a subject, typically a human subject.
[0385] Also provided is the use of the disclosed antibodies or antigen binding portions thereof for the manufacture of compositions (such as medicaments) for use in the prevention, treatment, diagnosis and/or prognosis of any one of the listed diseases.
[0386] Also provided are methods of detecting or diagnosing a disease in a subject, wherein the methods comprise contacting a sample obtained from the subject with an antibody or antigen binding portion thereof as described herein. These methods are typically in vitro methods.
[0387] Thus, said antibody or antigen binding portion thereof, or pharmaceutical composition comprising it, is useful in the treatment, prevention and/or diagnosis of a condition selected from neurological disorders or conditions characterized by a loss of cognitive memory capacity. Such diseases or conditions include but are not limited to Alzheimer's disease (AD), mild cognitive impairment (MCI), dementia with Lewy body, Down's syndrome, hereditary cerebral hemorrhage with amyloidosis (Dutch type); as well as other diseases which are based on or associated with amylogenic proteins, such as cerebral amyloid angiopathy, Parkinson's disease, and cataract due to amyloid beta deposition.
[0388] Thus, in one embodiment, there is provided an antibody or antigen binding portion thereof, or pharmaceutical composition comprising it, for use in the treatment, prevention and/or diagnosis of an Aβ peptide-associated condition, such as amyloidosis. In one embodiment, there is provided an antibody or antigen binding portion thereof, or pharmaceutical composition comprising it, for use in the treatment, prevention and/or diagnosis of an Aβ peptide-associated condition, selected from the group consisting of Alzheimer's disease (AD), mild cognitive impairment (MCI), dementia with Lewy bodies, Down's syndrome, hereditary cerebral hemorrhage with amyloidosis (Dutch type), cerebral amyloid angiopathy, Parkinson's disease and cataract due to amyloid beta deposition. In one specific embodiment, said antibody or antigen binding portion thereof, or pharmaceutical composition comprising it, is provided for use in the treatment, prevention and/or diagnosis of Alzheimer's disease.
[0389] In a seventh aspect, there is provided a method of treatment, prevention and/or diagnosis of an Aβ peptide-associated condition in a mammal having, or being at risk of developing, said disorder, comprising administering to said mammal an amount, such as a therapeutically effective amount, of an antibody or antigen binding portion thereof, or pharmaceutical composition comprising it.
[0390] In one embodiment, said Aβ peptide-associated condition is, for example selected from the group consisting of amyloidosis, which refers to a group of diseases and disorders associated with amyloid plaque formation including secondary amyloidosis and age-related amyloidosis including, but not limited to, neurological disorders or conditions characterized by a loss of cognitive memory capacity such as, for example, Alzheimer's disease (AD), mild cognitive impairment (MCI), dementia with Lewy body, Down's syndrome, hereditary cerebral hemorrhage with amyloidosis (Dutch type); as well as other diseases which are based on or associated with amylogenic proteins, such as cerebral amyloid angiopathy, Parkinson's disease, and cataract due to amyloid beta deposition.
[0391] In a more specific embodiment, there is provided a method for treatment, prevention and/or diagnosis of an Aβ peptide-associated condition as disclosed herein, wherein said Aβ peptide-associated condition is selected from the group consisting of Alzheimer's disease (AD), mild cognitive impairment (MCI), dementia with Lewy bodies, Down's syndrome, hereditary cerebral hemorrhage with amyloidosis (Dutch type), cerebral amyloid angiopathy, Parkinson's disease and cataract due to amyloid beta deposition. In one particular embodiment, there is provided a method for treatment, prevention and/or diagnosis as disclosed herein, wherein said Aβ peptide-associated condition is Alzheimer's disease.
[0392] With regard to therapeutic or preventive use of the disclosed antibody, or antigen binding portion thereof, for the treatment of neurodegenerative diseases, there are several putative mechanisms of action. Without wishing to be bound by theory, non-limiting and independently possible mechanisms of action are for example i) the neutralization of putatively neurotoxic ApoE fragments and aggregated forms thereof; ii) Restoration of Aβ metabolism by removal of C-terminal ApoE fragments which have disrupted normal cholesterol/lipid transportation and thereby affected the processing of amyloid precursor protein (APP) so as to cause an increased production of Aβ; iii) reduction of Aβ aggregation caused by C-terminal ApoE fragments through binding of Aβ via the lipid binding region contained in these fragments; and iv) increased Aβ clearance in a situation wherein the C-terminal ApoE fragments form part of amyloid aggregates as such.
[0393] With regard to diagnostic or prognostic use of the disclosed antibody, or antigen binding portion thereof, in neurodegenerative diseases, the putatively neurotoxic ApoE fragments can be detected and measured in patients at risk of disease or showing signs of incipient disease. One such method is PET scan using a radio-labelled antibody of the disclosure. Another method for diagnosis and prognosis is biochemical analysis analyzing the levels of neurotoxic ApoE fragments in blood/plasma using ELISA/MSD.
[0394] While the invention has been described with reference to various exemplary aspects and embodiments, it will be understood by those skilled in the art that various changes may be made and equivalents may be substituted for elements thereof without departing from the scope of the invention. In addition, many modifications may be made to adapt a particular situation or molecule to the teachings of the invention without departing from the essential scope thereof. Therefore, it is intended that the invention not be limited to any particular embodiment, but that the invention will include all embodiments falling within the scope of the appended claims. The invention will be further illustrated by the following non-limiting Examples.
INCORPORATION BY REFERENCE
[0395] Various publications are cited in the present application, each of which is incorporated by reference herein in its entirety.
EXAMPLES
Example 1
Analysis of ApoE Fragments in Human Brain Extracts from Alzheimer's Disease Patients and Controls
[0396] This example describes the homogenization of human brain tissues and the following Western blot analysis of ApoE fragments from brain extracts in Radio-Immunoprecipitation Assay (RIPA) buffer with 2% sodium dodecyl sulfate (SDS).
Materials and Methods
[0397] Brain tissue homogenization and sample preparation: Fresh frozen human brain tissue from Alzheimer's disease (AD) patients (n=24) and controls (n=14), with various APOE genotypes, were homogenized by 1:5 weight:volume in RIPA 2% SDS extraction buffer followed by a 16000×g centrifugation for 1 h. The resulting supernatant was frozen at −80° C. until analysis.
[0398] Analysis of ApoE fragments in human brain extracts: RIPA 2% SDS brain extract containing 10 μg total protein was mixed with 2×Laemmli sample buffer, boiled for 5 min at 95° C. and loaded onto SDS-PAGE gels (Bolt™ 12% Bis-Tris Plus 10 well, Thermo Fisher). Gels were run for 30-40 min at 180 V, after which proteins were transferred from the gels to nitrocellulose membranes using the Trans-Blot® Turbo™ system (BioRad). Membranes were blocked in Odyssey® blocking buffer for 1 h and then incubated over night at room temperature with a polyclonal anti-ApoE antibody (Calbiochem, cat. No. 178479) diluted 1:2000 in Odyssey® blocking buffer with 0.1% Tween® 20. Membranes were washed and incubated for 1 h at room temperature with detection antibody anti-goat-800CW (LI-COR, cat. No 925-32214) diluted 1:25000 in Odyssey® blocking buffer with 0.1% Tween® 20. Membranes were washed and images acquired using Odyssey® FC (LI-COR). Image Studio Software (version 5.2) was used to quantify the relative amount of ApoE fragments in ratio to the amount of full-length ApoE in the acquired Western blot images.
Results
[0399] Full-length ApoE as well as several low molecular weight (LMW) ApoE fragments were identified by Western blot analysis of human brain RIPA 2% SDS extracts (n=38).
[0400] Analysis of ApoE fragments in ratio to full-length (FL) ApoE, demonstrated that the 12 kDa ApoE fragment was significantly increased in the AD group (n=24) as compared to the control group (n=14) (
Example 2
Extraction and Isolation of ApoE Fragments from Human Brain Extracts from Alzheimer's Disease Patients
[0401] This example describes a procedure for isolation and concentration of full-length ApoE and 12 and 15 kDa ApoE fragments from human brain extracts, in order to prepare pure samples of ApoE with a protein concentration sufficient for amino acid sequence analysis.
Materials and Methods
[0402] Isolation of ApoE from human brain extracts from AD patients with various APOE genotypes: A protocol for immunoprecipitation (IP) of ApoE from human brain extracts was established. Protocol optimization resulted in pure samples of ApoE with a protein concentration sufficient for amino acid sequence analysis. For a schematic overview of the workflow, see
[0403] Concentration of isolated ApoE followed by analysis by SDS-PAGE: In order to concentrate the ApoE protein, the eluted IP sample was centrifuged in a rotational vacuum concentrator at 1300 rpm at 40° C. for approximately 2 h, to reduce the volume from 250 μl to approximately 15 μl. 2×Laemmli buffer was added to the concentrated samples and the samples were incubated for 5 min at 95° C. with 900 rpm. After a quick spin, the samples were loaded onto SDS-PAGE gels (Bolt™ 12% Bis-Tris Plus 10 well, Thermo Fisher, cat. No NW04120BOX). Gels were run for 30-40 min at 180 V, after which one gel was used for confirmation of ApoE fragments by Western blot analysis and one gel was silver stained and used for excision of ApoE.
[0404] Western blot analysis of SDS-PAGE gels: Proteins were transferred from the gels to nitrocellulose membranes using the Trans-Blot® Turbo™ system (BioRad). Membranes were blocked in Odyssey® blocking buffer for 1 h and then incubated over night at room temperature with the anti-ApoE C-terminal antibody (Thermo Scientific, cat. No PA5-27088) diluted 1:2000 in Odyssey® blocking buffer with 0.1% Tween® 20. Membranes were washed and incubated for 1 h at room temperature with detection antibody anti-rabbit-800CW (LI-COR, cat. No 925-32211) diluted 1:25000 in Odyssey® blocking buffer with 0.1% Tween® 20. Membranes were washed and images acquired using Odyssey® FC (LI-COR).
[0405] Silver staining of SDS-PAGE gels: Gels were fixated and stained with silver staining according to manufacturer's instructions (Pierce Silver Stain for Mass Spectrometry, Thermo Scientific, cat. No 24600). After the silver staining was complete, the stop buffer was exchanged to Milli-Q H.sub.2O and rinsed 2×10 min. Full-length ApoE, and the 12 and 15 kDa ApoE bands were excised from the gel and placed in Milli-Q H.sub.2O in clean Eppendorf tubes.
Results
[0406] Using the established IP protocol (
[0407] Extraction of ApoE was confirmed by Western blot analysis.
Example 3
Identification of Trypsin Cleavage Sites in 12 kDa ApoE Fragment
Sample Preparation
[0408] Silver-stained strips of gels from Example 2 in 1.5 ml PP-tubes, including a band of recombinant human full-length ApoE4 (rhApoE4) and/or 34 kDa from immunoprecipitation, band of 15 kDa from immunoprecipitation, and band of 12 kDa from immunoprecipitation, were washed with enough water and followed by dehydration using 500 μl acetonitrile (ACN; Wako). After turning each gel white, any solvent was removed and followed by adding 500 μl of water to get each gel swelling. After removal of water, 500 μl of Silver Quest Destainer (Invitrogen) was added to each gel and incubated for 15 min at room temperature. After removal of any destainer solvent, 1000 μl of water was added, then incubated for 10 min at room temperature. After the removal of water, 1000 μl of water was added again to wash each gel, then any solvent was removed from tubes. 500 μl ACN was added to each gel, then excess ACN was removed after turning each gel white.
[0409] 500 μl of 10 mM dithiothreitol (DTT; Wako) was added into gels, followed by incubation at 56° C. for 30 min. After removal of DTT solution, 500 μl ACN was added to shrink each gel with gentle mixing incubation at room temperature for 10 min. After removal of ACN, 55 mM iodoacetoamide (IAA; Wako) was added into each tube, then incubated at room temperature in the dark for 30 min. After removal of IAA solution, 500 μl ACN was added into each tube again, with occasional vortex mixing for 10 min, in order to obtain shrunk gels. After removal of ACN, 300 μl of 13 μg/ml trypsin in 10 mM ammonium bicarbonate with 10% ACN was added into the gels, then incubated at 5° C. for 6 hours. Then, gels were placed in a 37° C. chamber to promote digestion of proteins in each gel, followed by incubation over night.
[0410] 600 μl of 5% formic acid in water/ACN in a 1/2 (v/v) solution was added to each tube and mixed well with vortex. Then, incubation at 37° C. with gentle rotating was conducted to obtain a solution including tryptic peptides from each gel. The obtained solution was dried by SpeedVac system (Thermo Fisher Scientific), followed by reconstitution using 300 μl of 5% methanol in 0.1% TFA-water. The solution was desalted by Monospin C18 solid extraction column (GL Sciences) according to the vendor's instruction manual, after which the eluent was dried by SpeedVac system. 30 μl of 5% methanol in 0.1% TFA-water was added into each tube to obtain the final reconstituted solution. The solution was subjected to LC-MS analysis.
LC/MS Analysis
[0411] The obtained samples were analyzed in a nano-flow LC-MS/MS system using a Q Exactive HF mass spectrometer (Thermo Fisher Scientific) coupled with an online UltiMate 3000 Rapid Separation LC (Dionex) and an HTC PAL sample injector (CTC Analytics) fitted with a microcapillary column (360 nm outer diameter (OD)×100 μm ID), which was packed with <20 cm of ReproSil C18-AQ 3 μm beads (Dr. Maisch GmbH) and equipped with an integrated electrospray emitter tip (P-2000 laser-based puller, Sutter Instruments). Each sample was loaded onto the capillary column by 4 μl full-loop mode injection. For LC separation, a mobile phase A of 4% ACN and 0.5% acetic acid (Wako) and a mobile phase B of 80% acetonitrile and 0.5% acetic acid were used for multiple linear gradient elution from 1-40% of B over 60 min, 40-70% of B over 10 min, and 70-99% of B over 5 min, and then held at 99% of B for 10 min at 500 nl/min. The total analysis time for each sample was 120 min.
[0412] Each sample was analyzed using data dependent analysis (DDA) mode, which used higher energy collision dissociation (HCD) MS/MS scans (resolution 30000) for the top 15 most abundant ions of each full-scan MS from m/z 300 to 3000 (resolution 60000) with a full-scan MS ion target of 3×10.sup.6 ions and an MS/MS ion target of 2×10.sup.5 ions. The maximum ion injection time for the MS/MS scans was 100 ms. The HCD normalized collision energy was set to 27, the dynamic exclusion time was set to 20 s, and the peptide match and isotope exclusion functions were enabled.
Data Analysis
[0413] All DDA mass spectra were analyzed with Proteome Discoverer ver. 2.1 (Thermo Fisher Scientific) using a human ApoE4 FASTA file (SEQ ID NO:45). SEQUEST-HT algorithm was used for MS/MS searching of the data sets with the following parameters: oxidation of methionine as variable modifications, carbamidomethylation of cysteine as a fixed modification, and trypsin as the digestion enzyme. Two missed cleavages per peptide were allowed. The mass tolerance for precursor ions was set to 10 ppm, and the mass tolerance for product ions was set to 20 mDa. A maximum false discovery rate (FDR) of 1% was applied for peptide identification. Protein identification required more than two peptides per protein. Then, a detailed analysis focusing only on ApoE4 was conducted to identify the cleavage sites of the 12 kDa band (ApoE4 fragment).
Results
[0414] The 12 kDa ApoE fragment was subjected to tryptic digestion to survey the cleavage sites of ApoE on a peptide basis. rhApoE4 and 15 kDa bands were analyzed as references. The results (
Example 4
Identification of LysC Cleavage Sites in 12 kDa ApoE Fragment
Materials and Methods
[0415] Sample preparation, LC/MS analysis and data analysis were performed as described above for Example 3.
Results
[0416] To narrow down the cleavage site of 12 kDa ApoE fragment on an amino acid basis, digestion by another enzyme, lysyl endopeptidase (LysC), was carried out. As a result of standard LysC proteomic analysis of the 12 kDa band (fixed cleavage at lysine C-terminal), the only peptide detected was a peptide corresponding to amino acid residues 234-299 of ApoE (
Example 5
Further Characterization of LysC Cleavage Sites in 12 kDa ApoE Fragment
Materials and Methods
[0417] Sample preparation and LC/MS analysis were performed as described above for Example 4. Data analysis was performed as described above for Example 4, except that target analysis (describing peaks and the integration) from extracted-ion chromatograms (XIC) was performed for the specific peptides cleaved at unexpected regions. This peak qualification analysis was conducted by Qual Browser in Xcalibur 4.0 software (Thermo Fisher Scientific).
Results
[0418] Prior to the detailed analysis of possible cleavage sites that give rise to the identified 12 kDa fragment, it was investigated whether the peptide corresponding to amino acid residues 158-233 of ApoE (SEQ ID NO:46) obtained by LysC digestion was detected in any of the rhApoE4 band, the 34 kDa band from immunoprecipitation, and the 12 kDa band from immunoprecipitation. This was done by describing each XIC with the theoretical m/z (z=10-15, 5 ppm mass tolerance). The results showed that the 158-233 peptide was clearly detected in the solution from rhApoE4 and the 34 kDa band, which means that there is no artifact cleavage in the sample preparation step. On the other hand, the 158-233 peptide was not observed in the sample solution from the 12 kDa band. That indicated that there is at least one cleavage site between aa 158 and aa 233 in the 12 kDa ApoE4 fragment. In summary, the LC/MS results from the tryptic process described in Example 3 elucidated the preliminary cleavage site between positions 190-205, then the site was confirmed by the LysC process as described in Example 4 and above. To narrow down the possible cleavage sites between 190-205 on an amino acid basis, all theoretical “non-conventional” peptides provided by LysC digestion of the 12 kDa band (i.e. 190-233, 191-233, 192-233, 193-233, 194-233, 195-233, 196-233, 197-233, 198-233, 199-233, 200-233, 201-233, 202-233, 203-233, 204-233, 205-233, and 206-233) were searched by describing each XIC to check whether the fragment peak was detected or not.
[0419] In conclusion, nanoLC-MS/MS analysis of brain samples from three individual donors (ApoE ε3/ε4) demonstrated that the major cleavage sites that yield the 12 kDa ApoE fragment were at the N-terminus of L198, A199 and G200 (
Example 6
Identification of Cleavage Sites in 12 kDa ApoE Fragment in Human Brains with ε4/ε4, ε2/ε3 and ε3/ε3 Alleles
Materials and Methods
[0420] Sample preparation, LC/MS analysis and data analysis were performed as described above for Examples 3-5.
Results
[0421] The N-termini L198, A199 and G200 were identified as the main cleavage sites to yield the 12 kDa ApoE fragment from ApoE ε3/ε4. To clarify if these cleavage sites are specific only to the ε4 allele and not to the ε2 or ε3 alleles, 12 kDa bands from the brains of ApoE ε4/ε4, ε2/ε3 and ε3/ε3 carriers were analyzed by means of the same manner as the previous section.
[0422] The results are presented in
Example 7
Neuronal Toxicity of Identified ApoE Fragments
Materials and Methods
[0423] Cell culture: Neuro2A cells (ATCC) were seeded at 5.0×10.sup.4 cells/well in a 24 well plate (Falcon) and cultured in D-MEM High Glucose (WAKO) containing 10% fetal bovine serum. Transfection of pAAV-CMV vectors encoding human ApoE4 (full-length, SEQ ID NO:45) or the identified ApoE fragments (aa 198-299, SEQ ID NO:3; aa 199-299, SEQ ID NO:2; aa 200-299, SEQ ID NO:1) was done using Lipofectamine LTX and Plus Reagent (Invitrogen) on 1 day after seeding. 2 days later, vector-transfected cells were collected for Western blot analysis or seeded again at 2.0×10.sup.4 cells/well in a Seahorse XF96 cell culture microplate (Agilent Technologies) 4 hours before mitochondrial respiration measurement.
[0424] For assays using rat hippocampal neurons, the dissected hippocampi from fetuses obtained on embryonic day (E) 18 from timed pregnant Wistar rats (Charles River Laboratories) were digested using trypsinization and mechanical dissociation. The dissociated neurons were seeded at 1.5×10.sup.4 cells/well in Seahorse XF96 cell culture microplate (Agilent Technologies) for mitochondrial respiration measurement or 1.0×10.sup.5 cells/well in 24-well plate (Falcon) for Western blot analysis. Infection of AAV6 with full-length human ApoE4 or identified ApoE fragments (198-299, 199-299, 200-299) was performed at 7 days in vitro (DIV). Measurement of mitochondrial respiration or sample collection for Western blot analysis was performed at 7 days after infection (14 DIV).
[0425] Western blot analysis: Cells were lysed by RIPA buffer (50 mM Tris-HCl pH 7.6, 5 mM EDTA, 1 mM EGTA, 1% NP40, 0.25% sodium deoxycholate, 0.1 M NaCl, 0.5 mM PMSF) containing complete (EDTA-free) protease inhibitor cocktail (Roche) and PhosSTOP protein phosphatase inhibitor (Sigma), and sonicated. Sample Buffer Solution with Reducing Reagent (6×) (Nacalai Tesque) was added before SDS-PAGE. For SDS-PAGE, XV PANTERA MP Gel (DRC) 15% was used. For transfer, Trans-Blot Turbo (BIO-RAD) was used. For immunoblotting, iBind Western Systems (ThermoFisher Scientific) was used together with the following antibodies: anti-ApoE PA5-27088 (ThermoFisher Scientific); 178479 (Calbiochem).
[0426] Mitochondrial respiration measurement: Real-time measurement of oxygen consumption rates (OCR) was performed using an Extracellular Flux Analyzer XFe96 (Agilent Technologies). Before measurement, the culture medium was replaced by 37° C. pre-warmed XF Base Medium (Agilent Technologies) containing 10 mM sodium pyruvate (Sigma), 10 mM D-glucose (Sigma), 2 mM glutamine (Sigma). The pH of the measurement medium was adjusted to 7.4. The culture plates were incubated at 37° C. for 60 min prior to the assay. For analysis of mitochondrial function, XF Cell Mito Stress Test Kit (Agilent Technologies) was used. Following measurement of basal OCR, mitochondrial complex inhibitors were injected sequentially into each cell. The inhibitors were used at the following concentrations: oligomycin 1 μM; carbonyl cyanide 4-(trifluoromethoxy) phenylhydrazone (FCCP) 0.25 μM for Neuro2A cells, 2 μM for rat hippocampal neurons; rotenone/antimycin A 0.5 μM. OCR values were automatically calculated, recorded and plotted by the XFe96 software. Spare respiratory capacity was measured as (FCCP respiration—basal respiration).
Results
[0427] In both Neuro2A cells and rat primary hippocampal neurons, the groups expressing either one of the identified ApoE fragments (198-299, 199-299, 200-299) showed a reduction in spare respiratory capacity (
Example 8
Plasmid Preparation and Antigen Production
[0428] This example describes plasmid preparation and production by transient transfection of Expi293 cells and subsequent purification, to produce the antigens listed in Table 1 below.
TABLE-US-00001 TABLE 1 Produced antigens SEQ Antigen (short) Info/Tags Purification ID NO: ApoE4-1-272- 10xHIS-ApoE4(1-272) IMAC, desalting 56 HIS L198-HIS ApoE-L198-H299-10xHIS IMAC, desalting 57 A199-HIS ApoE-A199-H299-10xHIS IMAC, desalting 58 G200-HIS ApoE-G200-H299-10xHIS IMAC, desalting 48 ApoE4-FL-HIS 10xHIS-ApoE4(1-299) IMAC, desalting 49
[0429] Plasmid preparation: pcDNA3.4-TOPO plasmids with sub-cloned custom inserts of interest were ordered from GeneArt (Thermo Fisher Scientific). Plasmids were transformed into DH5a E. coli to produce enough material for cell transfections, unless preparative amounts of plasmid DNA were ordered alongside the cloning services.
[0430] Transformations and plasmid preparations were performed using established protocols. Briefly, 50 μl of freshly thawed competent DH5α° E. coli were transformed by adding 10-100 ng plasmid, incubated for 30 min on ice, followed by a 45 s heat shock at 42° C. and a recovery on ice for 5 min, after which 250 μl SOC medium (Invitrogen) were added and the bacteria were cultured for 1 h at 37° C. 25-100 μl of culture were used for streaking out on ampicillin-containing agar plates, from which colonies were selected the following day after incubation at 37° C. Clones were selected from colony re-streaks.
[0431] Preparative cultures of LB medium with ampicillin were inoculated with clones and expanded at 37° C. over night before pelleting the bacteria. Bacterial pellets were used to extract plasmid DNA using HiSpeed Maxi kits (Qiagen), and the supplier's instructions were followed throughout the procedure to obtain plasmid DNA.
[0432] Expression of antigen by transient transfection: The desired antigens were transiently expressed using the Expi293 system (Expi293 cells and ExpiFectamine™ 293 reagent; Thermo Fisher Scientific) and designed to be secreted into the supernatant.
[0433] Briefly, Expi293 cells were maintained in Expi293™ expression medium (37° C., 8% CO.sub.2, 85% humidity and 125 rpm). Cells seeded at 2×10.sup.6/ml one day prior to transfection were transfected with 1 μg/ml of plasmid DNA complexes, prepared using the ExpiFectamine™ 293 reagent kit, as per the supplier's instructions (typically >95% viable and counts 3-4×10.sup.6/ml at Day 0). Enhancers 1+11 were added on Day 1 after transfection according to protocol. Cell viability was monitored regularly (AO/PI staining, Nexcelom K2 cellometer) and cultures harvested once viability dropped below 50%. For harvesting, the supernatants were cleared by centrifugation (2000 g, 15 min, 4° C.), and then sterile filtered using 0.22 μm bottle top filters (Millipore). Filtered supernatant not immediately used for purification was stored at −80° C. for later processing.
[0434] Purification of HIS-tagged antigen by immobilized metal affinity chromatography (IMAC): The polyhistidine-tagged recombinant target proteins listed in Table 1 were purified by nickel-based IMAC, according to adapted protocols.
[0435] Briefly, input supernatants were re-filtered before being loaded onto pre-equilibrated (Buffer A: 20 mM Tris+0.5 M NaCl, pH 8) IMAC columns (HisTrap Excel, GE Healthcare, cat. no. 17-3712-06). Unbound protein was washed out before applying elution gradients optimized for sample concentration, purity and collection (Buffer B: 20 mM Tris+0.5 M NaCl+500 mM imidazole, pH 8). Fractions were analyzed, and relevant ones pooled prior to buffer exchange.
[0436] Purified samples were buffer exchanged to sterile PBS (pH 7.4) using HiPrep™ 26/10 desalting columns (GE Healthcare, cat. no. 17-5087-01) and concentrated using Amicon® Ultra Centrifugal Filters (Millipore). As a standard, final products were sterile-filtered using 0.2 μm syringe filters (Pall).
Example 9
Generation and Screening of Antibodies to the N-Terminal ApoE Fragment Neo-Epitope G200
[0437] This example describes the immunization of BALB/c mice and subsequent generation and screening of hydridoma cell lines.
Materials and Methods
[0438] Peptide synthesis: The immunogen used in this experiment was designed to incorporate one of the N-terminal neo-epitopes of the neurotoxic ApoE fragment identified in the previous Examples. As its N-terminal sequence, the immunogen comprised the amino acid residues corresponding to amino acid residues 200-205 in full-length ApoE. This N-terminal sequence was coupled C-terminally to a 6-aminocaproic acid linker (Acp; also denoted aminohexanoic acid linker (Ahx)), followed by a cysteine residue for the purposes of conjugation to for example keyhole limpet hemocyanin (KLH) or bovine serum albumin (BSA) as indicated. The entire immunogen sequence used was GQPLQE-Acp-C(SEQ ID NO:50). SEQ ID NO:50 was prepared by Innovagen AB and delivered at 95.5% purity.
[0439] Additionally, ApoE-derived peptides were prepared which incorporated the other two identified putative N-terminal neo-epitopes of the neurotoxic ApoE fragment, as well as a negative control peptide without any of the identified neo-epitopes. These peptides were likewise coupled to 6-aminocaproic acid and a cysteine residue. The first neo-epitope peptide comprised as its N-terminal sequence the amino acid residues corresponding to amino acid residues 199-204 in full-length ApoE. Thus, the entire sequence was AGQPLQ-Acp-C(SEQ ID NO:51). SEQ ID NO:51 was prepared by Innovagen AB and delivered at 96.7% purity. The second neo-epitope peptide comprised as its N-terminal sequence the amino acid residues corresponding to amino acid residues 198-203 in full-length ApoE. Thus, the entire sequence was LAGQPL-Acp-C(SEQ ID NO:52). SEQ ID NO:52 was prepared by Innovagen AB and delivered at 95.2% purity. The entire sequence of the negative control peptide was AATVGSLAGQPLQER-Acp-C (SEQ ID NO:53). SEQ ID NO:53 was prepared by Innovagen AB and delivered at 97.1% purity.
[0440] Immunization: 10-12 weeks old Balb/c mice were immunized with SEQ ID NO:50 conjugated to KLH. In the first injection (subcutaneous, s.c.), the immunogen was given together with Freund's complete adjuvant. In subsequent injections (s.c.) except the last one, the immunogen was given in Freund's incomplete adjuvant. Plasma samples were collected three weeks after each immunization. Every mouse can receive up to 10 injections, but fewer immunizations were used for all of the mice. The final immunizations (booster dose) were administered intraperitoneally (i.p.) without adjuvant.
[0441] Plasma screening by direct ELISA: Plasma samples were analyzed by ELISA for reactivity against the target peptide SEQ ID NO:50 conjugated to bovine serum albumin, BSA, and against the recombinant ApoE fragment G200-HIS (SEQ ID NO:48) to determine when to stop immunizations and initiate hybridoma generation. Briefly, 96-well half area plates (Corning) were coated with 1 μg/ml antigen, i.e. G200 N-terminal neo-epitope peptide (ApoE sequence 200-205 incorporated in SEQ ID NO:50) coupled to BSA or purified recombinant C-terminal ApoE fragment G200-HIS (SEQ ID NO:48), in PBS at 50 μl/well over night at 4° C. The plates were blocked with 150 μl/well of protein-free blocking solution (Pierce) for 1 h at room temperature with shake (600-900 rpm). The plates were washed four times with washing buffer containing 0.28 mM NaH.sub.2PO.sub.4, 2.5 mM Na.sub.2HPO.sub.4, 150 mM NaCl, 0.1% TWEEN®-20 and 0.0075% Kathon CG. Plasma samples 3-fold serially diluted with a starting dilution of 1/450 were added to the plates (dilution buffer: PBS with 0.1% BSA and 0.05% TWEEN®-20) and incubated for 2 h at room temperature. The plates were washed four times as before. Detection antibody (HRP-conjugated anti-mouse IgG, Southern Biotech, cat. no. 1030-05, diluted 1/10000 in dilution buffer) was added 50 μl/well, and the plates were incubated for 1 h at room temperature. After another wash (as above), 50 μl/well of K-Blue® aqueous substrate (Neogen) was added, and the reaction was stopped after 10-15 min with 50 μl/well of 0.5-2 M H.sub.2SO.sub.4. The optical density at 450 nm was read using an ELISA reader (Tecan). The end point titers were defined as the dilution above the average of the blank wells (background) plus 3 standard deviations of the blank wells. An end point titer of 1/100,000 was considered high enough, and after this had been reached, no more immunizations were done until generation of hybridomas.
[0442] Generation of hybridomas: The mice received a final booster dose of immunogen i.p. (no adjuvant) 3 days before generation of hybridomas. Isolated splenocytes from sacrificed mice were fused with Sp2/0 cells at a 3:1 ratio and plated in 96-well plates in the presence of ClonaCell™-HY hybridoma selection medium D (StemCell Technologies), containing HAT for selection.
[0443] Wells were preferably screened twice during the next two weeks for reactivity to the G200-HIS recombinant ApoE fragment, and positive wells containing visible clones were processed further. Identified clones were expanded and subjected to at least two rounds of limiting dilution assay to assure monoclonality. Clones of interest were cryopreserved, expanded for production of antibody, and sequenced (Absolute Antibodies, UK).
[0444] Hybridoma screening by direct ELISA: ELISA experiments to identify hybridoma clones producing antibodies with reactivity against the target epitope were performed according to standard ELISA protocols as described above in the section “Plasma screening by direct ELISA”. During screening of hybridomas, and to reach monoclonality, three different antigens were used at a concentration of 1 μg/ml antigen. These were the G200 N-terminal neo-epitope peptide (ApoE sequence 200-205 incorporated in SEQ ID NO:50) coupled to BSA, purified recombinant C-terminal ApoE fragment G200-HIS (SEQ ID NO:48) and recombinant full-length ApoE4 (SEQ ID NO:45). Hybridoma supernatants were diluted 2-fold (dilution buffer: PBS with 0.1% BSA and 0.05% TWEEN®-20) and screened against binding to G200-HIS fragment. For the hybridoma screening ELISAs, “positive” wells were selected based on OD-values of >2 and the presence of clone/s. The identified positive clones were then subjected to positive and negative screenings using the same ELISA protocol, with G200-HIS fragment (SEQ ID NO:48), G200-peptide (SEQ ID NO:50) coupled to BSA, and ApoE4 full-length protein (SEQ ID NO:45) as coat for the plates. Clones that showed no substantial binding in the negative screening were subjected to 2 rounds of limiting dilution assay to ensure monoclonality and screened for binding to the G200-HIS fragment. Monoclonal clones that still bound G200-HIS fragment but not full-length ApoE4 and continued to grow were considered especially interesting for further characterization.
Results
[0445] Generation of monoclonal antibodies by hybridoma technology: Antibodies that bind selectively to the N-terminal neo-epitope starting at amino acid G200 of the ApoE protein were generated by immunizations using an ApoE specific sequence consisting of the six first amino acids following the N-terminal in the 200-299 ApoE fragment. The shortness of the immunization peptide was considered necessary in order to enable generation of antibodies that bind selectively to the N-terminal neo-epitope starting at amino acid G200 of the ApoE protein, without any binding to the linear epitope found in full-length ApoE protein. The ApoE-specific sequence peptide 200-205, conjugated to keyhole limpet haemocyanin (KLH) via an Acp linker and a cysteine residue, was used in the immunizations. The plasma samples were analyzed by ELISA for reactivity against the corresponding peptide conjugated to BSA (to avoid detecting reactivity generated towards KLH), and against recombinant ApoE fragment. When titers were at least >1/100,000 the mice were sacrificed and the spleens were collected and used for hybridoma generation.
[0446] ELISA screening for antibodies that bind selectively to the N-terminal neo-epitope of ApoE fragment starting at G200: Generated hybridoma clones were screened for reactivity towards the recombinant ApoE fragment G200-HIS, as well as reactivity towards the target peptide SEQ ID NO:50 conjugated to BSA. In addition, lack of reactivity towards recombinant full-length ApoE4 was evaluated. Seven clones were identified as antibodies selective for the N-terminal neo-epitope of ApoE fragments starting at amino acid G200, and were denoted 4E6, 7610, 7C7, 17G4, 21C3, 23D5 and 28F2.
Example 10
Characterization of Unpurified Hybridoma Supernatants Containing Monoclonal Antibodies to the N-Terminal ApoE Fragment Neo-Epitope G200
[0447] This example describes the characterization, by direct ELISA, of monoclonal antibodies with affinity for the N-terminal neo-epitope of C-terminal ApoE fragments resulting from cleavage in the hinge region (starting at amino acid G200). In addition, the monoclonal antibodies were evaluated for their ability to selectively bind to ApoE fragments 12 kDa) with the N-terminal neo-epitope starting at amino acid G200 in Alzheimer's disease brain extracts, without any binding to full-length ApoE, using Western blot.
Materials and Methods
[0448] Selectivity evaluation by direct ELISA: The direct ELISA described below was used to evaluate the binding selectivity of generated monoclonal anti-ApoE antibodies with affinity for the N-terminal neo-epitope of C-terminal ApoE fragments starting at amino acid G200. The ability to selectively bind to N-terminal neo-epitope peptide (ApoE sequence aa 200-205, SEQ ID NO:6, incorporated in SEQ ID NO:50 for experimental purposes) and to the recombinant C-terminal ApoE fragment resulting from cleavage in the hinge region (ApoE sequence aa 200-299, SEQ ID NO:1, His-tagged for experimental purposes as SEQ ID NO:48) was compared with binding to recombinant full-length ApoE (ApoE4 sequence aa 1-299, SEQ ID NO:45).
[0449] The screening was performed according to standard ELISA protocols. Briefly, 1 μg/ml solutions of N-terminal neo-epitope peptide (SEQ ID NO:50) conjugated to BSA, the recombinant C-terminal ApoE fragment G200-HIS (SEQ ID NO:48) and recombinant full-length ApoE4 (SEQ ID NO:45; Abcam; cat. no. ab50243) were prepared by dilution in PBS. 50 μl/well were added to an ELISA half-area 96 well microtiter plate. Then, the plate was sealed with adhesive sealer and incubated over night at 4° C. The plates were blocked with 150 μl/well of protein-free blocking solution (Pierce) for 1 h at room temperature with shake (600-900 rpm). The plates were washed four times with washing buffer containing 0.28 mM NaH.sub.2PO.sub.4, 2.5 mM Na.sub.2HPO.sub.4, 150 mM NaCl, 0.1% TWEEN®-20 and 0.0075% Kathon CG. Antibodies of interest were serially diluted 3-fold with a starting dilution at 1 μg/ml (mixed 1:1 with dilution buffer: PBS with 0.1% BSA and 0.05% TWEEN®-20) and incubated for 2 h at room temperature. The plates were washed four times as before. Detection antibody (HRP-conjugated anti-mouse IgG, Southern Biotech, cat. no. 1030-05, diluted 1/10000 in dilution buffer) was added 50 μl/well, and the plates were incubated for 1 h at room temperature. After another wash (as above), 50 μl/well of K-Blue® aqueous substrate (Neogen) were added, and the reaction was stopped after 5-15 min with 50 μl/well of 0.5 M H2504. The optical density at 450 nm was read using an ELISA reader (Tecan). The optical density was plotted against the antibody concentration to generate concentration-response curves (
[0450] Isotyping: The isotype of each antibody clone was determined using Mouse Monoclonal Antibody Isotyping kit (Roche) according to the manufacturer's instructions.
[0451] Selectivity evaluation and human target binding in Alzheimer's disease brain extracts by Western blot analysis: The Western blot analysis described below was used to evaluate selective binding of monoclonal antibodies with affinity for the N-terminal neo-epitope of ApoE fragments 2 kDa, starting at G200, without binding to ApoE full-length protein, in human brain extracts from an Alzheimer's disease patient. Fresh frozen brain tissue from the Alzheimer's disease patient was homogenized in RIPA 2% SDS extraction buffer, followed by centrifugation at 16000×g for 1 h. The subsequent supernatant was subjected to standard protein concentration determination.
[0452] RIPA 2% SDS brain extract containing 80 μg total protein was mixed with 2×Laemmli sample buffer, boiled for 5 min at 95° C. and loaded onto SDS-PAGE gels (Bolt™ 12% Bis-Tris Plus 10 well, Thermo Fisher, cat. no. NW00120BOX). Gels were run for 30-40 min at 180 V, after which proteins were transferred from the gels to nitrocellulose membranes using the Trans-Blot® Turbo™ system (Bio-Rad). Membranes were blocked in Odyssey® blocking buffer for 1 h and incubated over night at room temperature with hybridoma supernatant diluted 1:1 in Odyssey® blocking buffer with 0.1% TWEEN®-20. Membranes were washed and incubated for 1 h at room temperature with the detection antibody anti-mouse-800CW (LI-COR, cat. no. 925-32210) diluted 1:25000 in Odyssey® blocking buffer with 0.1% TWEEN®-20. Membranes were washed and images acquired using Odyssey® FC (LI-COR).
[0453] To confirm that the obtained bands on the Western blot membranes were of ApoE origin, the membranes were re-stained over night with a polyclonal anti-ApoE antibody (Calbiochem, cat. no. 178479; immunogen ApoE aa 1-299), diluted 1:2000 in Odyssey® blocking buffer with 0.1% TWEEN®-20. Membranes were washed and incubated for 1 h at room temperature with detection antibody anti-goat-680RD (LI-COR, cat. no. 925-68074) diluted 1:25000 in Odyssey® blocking buffer with 0.1% TWEEN®-20. Membranes were washed and images acquired using Odyssey® FC (LI-COR).
Results
[0454] Selectivity evaluation: The seven hybridoma clones (4E6, 7610, 7C7, 17G4, 21C3, 23D5 and 28F2) that were selective for the N-terminal neo-epitope of ApoE fragments starting at amino acid G200 demonstrated binding to the G200-BSA peptide (SEQ ID NO:50 conjugated to BSA) and to the recombinant G200-HIS fragment (SEQ ID NO:48), whereas no binding to recombinant ApoE4 full-length protein (aa 1-299; SEQ ID NO:45) was shown (
[0455] Isotyping: The isotype of the antibody clones, as determined using the Mouse Monoclonal Antibody Isotyping kit (Roche), is shown in Table 2.
TABLE-US-00002 TABLE 2 Isotyping results Clone Sub-class Light chain 4E6 IgG1 κ 7B10 IgG1 κ 7C7 IgG2b κ 17G4 IgG1 κ 21C3 IgG2b κ 23D5 IgG1 κ 28F2 IgG1 κ
[0456] Selectivity evaluation and human target binding in Alzheimer's disease brain extracts by Western blot analysis: The hybridoma clones (4E6, 7610, 7C7, 17G4, 21C3, 23D5 and 28F2) selective for the N-terminal neo-epitope of ApoE fragments starting at amino acid G200 were tested for their ability to bind selectively to ApoE fragments 2 kDa in human brain extracts from an Alzheimer's disease patient, and without any binding to full-length ApoE. Western blot analysis demonstrated binding of the monoclonal hybridomas to two ApoE fragments approximately 12 kDa and 10 kDa in size, without any visual binding to full-length ApoE (
Example 11
Hybridoma Sequencing and Production of Recombinant Antibody
Materials and Methods
[0457] Hybridoma sequencing: Hybridoma clones producing monoclonal antibodies as generated and characterized in Examples 8-10, having a demonstrated selectivity for the N-terminal neo-epitope of ApoE fragment starting at amino acid G200, and a proven human target binding in brain extracts from Alzheimer's disease, were sent to Absolute Antibody for sequencing. Briefly, hybridoma sequencing was performed by whole transcriptome shotgun sequencing. The DNA and protein sequences of the mature VH and VL regions were identified.
[0458] Expression, production and purification of recombinant antibodies at Absolute Antibody: The variable domains were designed and optimized for expression in mammalian cells (HEK293) prior to being synthesized. The sequences were then subcloned into an Absolute Antibody cloning and expression vector for the appropriate isotype and subtype of immunoglobulin heavy and light chains.
[0459] HEK293 cells were passaged to the optimum stage for transient transfection. Cells were transiently transfected with heavy and light chain expression vectors and cultured for a further 6-14 days. An appropriate volume of cells were transfected with the aim of obtaining 2 mg of purified antibody.
[0460] Cultures were harvested and a one-step purification performed using affinity chromatography, after which the purified antibodies were buffer exchanged into PBS. Antibodies were analyzed for purity by SDS-PAGE and the concentration was determined by UV spectroscopy.
Results
[0461] Hybridoma sequencing and recombinant antibody production: Hybridoma clones with a demonstrated selectivity for the N-terminal neo-epitope of ApoE fragment starting at amino acid G200, in addition to a demonstrated binding to human target in brain extracts from Alzheimer's disease, were sequenced.
[0462] The following hybridoma clones were sequenced: 4E6, 7610, 7C7, 17G4, 21C3, 23D5 and 28F2. Sequencing revealed that antibodies 4E6 and 21C3 have the same sequence in both the primary VH and VL. The amino acid sequences of the entire antibodies were obtained. Amino acid sequences obtained for the respective variable heavy (VH) and variable light (VL) chains are given in Table 3 below.
TABLE-US-00003 TABLE 3 Variable region sequences SEQ ID Region Antibody NO: 4E6/21C3 VH EVQLVESGGDLVKPGGSLKLSCAASGFTFSSYAMSWVRQSPEKRLE 34 WVAEISGSGSRDHYTDSVTGRFTVSRDNAKNTLYLEMSSLRSEDTAIY YCARQLTGTDYYGTDYWGQGTSVTVSS VL DVLMTQIPLSLPVSLGDQASISCRSSQSIVYSNGNTYLEWYLQRPGQS 35 PKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQG SHLPYTFGGGTKLEIK 7B10 VH AVQLVESGGGLVKPGRSLKLSCAASGFTFSSYAMSWVRQFPDKRLD 36 WVAEISSGGGSTNYLDTVTGRFTISRDNAKNTLYLEMNSLRSEDTAMY YCARQLVGTDYYGTDYWGQGTSVTVSS VL DVLMTQTPLSLPVSLGDQASISCRSSQNIVYSNGNTYLEWYLQKPGQS 37 PKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQG SHVPYTFGGGTKLEIK 7C7 VH EVQLVESGGGLVKPGGSLRLSCAASGFTFSSFAMSWVRQSPERRLE 38 WVAEISRGGGYAFYSDTVTGRFTISRDNARNTLFLEMGSLRSEDTAMY YCSRQLTGTDYYAMDYWGQGTSVTVSS VL DVLLTQTPLSLFVSLGDQASISCRSSQSIVYTNGNTYLEWYLQKPGQS 39 PKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQG SQVPYTFGGGTKLELK 17G4 VH EVQLVESGGGLVKPGGSLKLSCSASGFTFSRYAMSWVRQSPEKRLE 40 WVAEINSGGSYSFYSDTVTGRFTISRDNAKNTLFLEMSSLRSEDTAIYY CARQLTGTDYYGTDYWGQGTSVTVSS VL DVLMTQTPLSLPVSHGDQASISCRSSQSLLYSNGNTYLEWYLQKPGQ 41 SPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQ GSHVPYTFGGGTKLEIK 23D5 VH EVQLVESGGGLVKPGGSLKLSCSASGFTFSRYAMSWVRQSPEKRLE 42 WVAEINSGGSYSFYSDTVTGRFTISRDNAKNTLFLEMSSLRSEDTAIYY CARQLSGTDYYGTDYWGQGTSVTVSS VL DVLMTQTPLSLPVSHGDQASISCRSSQSLLYSNGNTYLEWYLQKPGQ 41 SPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQ GSHVPYTFGGGTKLEIK 28F2 VH QIQLVQSGPDLKKPGETVKISCKASGYTFTNYAMHWMKQAPGKALKW 43 MGWINTYTGEPTFADDFKGRFAFSLETSASTAYLQINSLKNEDMATYF CAREGYYDRSHYFDYWGQGTTLTVSS VL DVLMTQTPLSLPVSLGDQASISCRSSLSLVHGDGNTYLEWYLQKPGQ 44 SPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCLQ GSHIPFTFGSGTKLEIK
[0463] The complementarity determining regions (CDRs) were identified using the Kabat definition for the primary VH and VL sequences and are given in Table 4 below.
TABLE-US-00004 TABLE 4 CDR region sequences Antibody CDR H1 CDR H2 CDR H3 4E6/21C3 SYAMS EISGSGSRDHYTDSVTG QLTGTDYYGTDY (SEQ ID NO: 10) (SEQ ID NO: 11) (SEQ ID NO: 12) 7B10 SYAMS EISSGGGSTNYLDTVTG QLVGTDYYGTDY (SEQ ID NO: 10) (SEQ ID NO: 13) (SEQ ID NO: 14) 7C7 SFAMS EISRGGGYAFYSDTVTG QLTGTDYYAMDY (SEQ ID NO: 15) (SEQ ID NO: 16) (SEQ ID NO: 17) 17G4 RYAMS EINSGGSYSFYSDTVTG QLTGTDYYGTDY (SEQ ID NO: 18) (SEQ ID NO: 19) (SEQ ID NO: 12) 23D5 RYAMS EINSGGSYSFYSDTVTG QLSGTDYYGTDY (SEQ ID NO: 18) (SEQ ID NO: 19) (SEQ ID NO: 20) 28F2 NYAMH WINTYTGEPTFADDFKG EGYYDRSHYFDY (SEQ ID NO: 21) (SEQ ID NO: 22) (SEQ ID NO: 23) CDR L1 CDR L2 CDR L3 4E6/21C3 RSSQSIVYSNGNTYLE KVSNRFS FQGSHLPYT (SEQ ID NO: 24) (SEQ ID NO: 25) (SEQ ID NO: 26) 7B10 RSSQNIVYSNGNTYLE KVSNRFS FQGSHVPYT (SEQ ID NO: 27) (SEQ ID NO: 25) (SEQ ID NO: 28) 7C7 RSSQSIVYTNGNTYLE KVSNRFS FQGSQVPYT (SEQ ID NO: 29) (SEQ ID NO: 25) (SEQ ID NO: 30) 17G4 RSSQSLLYSNGNTYLE KVSNRFS FQGSHVPYT (SEQ ID NO: 31) (SEQ ID NO: 25) (SEQ ID NO: 28) 23D5 RSSQSLLYSNGNTYLE KVSNRFS FQGSHVPYT (SEQ ID NO: 31) (SEQ ID NO: 25) (SEQ ID NO: 28) 28F2 RSSLSLVHGDGNTYLE KVSNRFS LQGSHIPFT (SEQ ID NO: 32) (SEQ ID NO: 25) (SEQ ID NO: 33)
[0464] The monoclonal antibodies 4E6, 7610, 7C7, 17G4, 23D5 and 28F2 were selected for production as recombinant IgG2c antibodies, whereas 21C3 was not produced (because of the sequence redundancy with 4E6). All recombinant antibodies were successfully produced and purified to a final concentration of 1 mg/ml. Antibody purity, as defined by SDS-PAGE, was >98% for all antibodies.
Example 12
Characterization of Recombinant Antibodies
[0465] This example describes the characterization of the recombinant antibodies produced in Example 11 by various methods, including direct ELISA, inhibition ELISA, biolayer interferometry, surface plasmon resonance, immunoprecipitation on human brain extract and immunohistochemistry on human brain sections.
Materials and Methods
[0466] Selectivity evaluation of recombinant antibodies by direct ELISA: The direct ELISA described below was used to evaluate the binding selectivity of the recombinant antibodies produced in Example 11. The ability to selectively bind to the G200 N-terminal neo-epitope ApoE peptide (BSA-conjugated SEQ ID NO:50) and to the recombinant G200-HIS C-terminal ApoE fragment resulting from cleavage in the hinge region (SEQ ID NO:48) was compared with binding to the L198, A199 and negative control peptides (BSA-conjugated SEQ ID NO:51, 52 and 53, respectively), and to His-tagged, recombinant full-length ApoE4 (ApoE sequence aa 1-299; SEQ ID NO:49).
[0467] The screening was performed according to standard ELISA protocols. Briefly, 1 μg/ml solutions of BSA-conjugated neo-epitope peptides, recombinant C-terminal ApoE fragment, negative control peptide and full-length ApoE were prepared by dilution in PBS. 50 μl/well were added to an ELISA half-area 96 well microtiter plate, the plate was sealed with adhesive sealer and incubated over night at 4° C. After discarding the solution, the plates were blocked with 150 μl/well of protein-free blocking solution (Pierce) for 1 h at room temperature with shake (900 rpm). The plates were washed four times with washing buffer containing 0.28 mM NaH.sub.2PO.sub.4, 2.5 mM Na.sub.2HPO.sub.4, 150 mM NaCl, 0.1% TWEEN®-20 and 0.0075% Kathon CG. Generated recombinant antibodies of interest were serially diluted 3-fold with a starting dilution at 0.5 μg/ml (mixed 1:1 with dilution buffer: PBS with 0.1% BSA and 0.05% TWEEN®-20). An anti-ApoE C-terminal antibody was used as a reference antibody (ApoE E-8 mouse monoclonal, cat. no. sc-393302; Santa Cruz Biotechnology). 50 μl/well were added into the ELISA plates and incubated for 2 h at room temperature with shake (900 rpm). The plates were washed four times as described previously. Detection antibody (HRP-conjugated anti-mouse IgG, Southern Biotech, cat. no. 1030-05, diluted 1:10000 in dilution buffer) was added 50 μl/well, and the plates were incubated for 1 h at room temperature with shake (900 rpm). After another wash (as described previously), 50 μl/well of K-Blue® aqueous substrate (Neogen) were added, and the reaction was stopped after 5-15 min with 50 μl/well of 0.5 M H2504. The optical density at 450 nm was read using an ELISA reader (Tecan). The optical density was plotted against the antibody concentration to generate concentration-response curves (
[0468] In addition, a second ELISA experiment was run, in which the plate was coated with both i) the recombinant G200-HIS C-terminal ApoE fragment resulting from cleavage in the hinge region (SEQ ID NO:48) and ii) recombinant full-length ApoE4 (ApoE sequence aa 1-299; SEQ ID NO:45; Abcam; cat. no. ab50243). These were added in the same molarity (0.1 μM) to provide an equal number of molecules available for binding by the antibodies (BSA-coupled peptides were coated at 1 μg/ml as before). The antibody concentration was increased to 3 μg/ml, and EC50 values were determined from a log agonist concentration response curve (
[0469] Selectivity evaluation and IC50 determination of recombinant antibodies by inhibition ELISA: The inhibition ELISA described below was used to evaluate the binding strength and selectivity for the recombinant antibodies produced in Example 11. The ability of the recombinant antibodies to bind to the N-terminal neo-epitope of synthetic ApoE peptides starting at amino acid G200 and to recombinant C-terminal ApoE fragment G200-HIS was evaluated in comparison with their ability to bind to synthetic ApoE peptides starting at amino acids L198 and A199, as well as to full-length ApoE4 (aa 1-299) in solution.
[0470] In brief, the recombinant antibody to be tested was allowed to interact with the N-terminal neo-epitope of synthetic ApoE peptides conjugated to BSA and starting at amino acid L198 (SEQ ID NO:52), A199 (SEQ ID NO:51) or G200 (SEQ ID NO:50), or to BSA-conjugated negative control peptide (SEQ ID NO:53), or to His-tagged recombinant C-terminal ApoE fragment G200-HIS (SEQ ID NO:48), or to His-tagged recombinant full-length ApoE4 in solution (SEQ ID NO:49). Thereafter, the mix was added to a microtiter plate coated with the BSA-coupled G200 synthetic ApoE peptide. If the recombinant antibody binds to any of the antigens in the pre-incubation step (the synthetic ApoE peptides, recombinant C-terminal ApoE fragment or full-length ApoE4), the antibody is prevented from binding to the synthetic G200 ApoE peptide immobilized on the microtiter plate. This leads to inhibition of the ELISA detection signal.
[0471] 0.5 μg/ml solution of N-terminal neo-epitope peptide G200 (SEQ ID NO:50) conjugated to BSA was prepared by dilution in PBS. 50 μl/well were added to an ELISA half-area 96 well microtiter plate, the plate was sealed with adhesive sealer and incubated over night at 4° C. After discarding the above solution, the plates were blocked with PBS-Tween 20 (0.05%) (150 μl/well) at room temperature for at least 1 h with shaking (900 rpm). The blocked plate was washed four times with washing buffer containing 0.28 mM NaH.sub.2PO.sub.4, 2.5 mM Na.sub.2HPO.sub.4, 150 mM NaCl, 0.1% TWEEN®-20 and 0.0075% Kathon CG.
[0472] 3-fold serial dilutions of each synthetic ApoE peptide, recombinant C-terminal ApoE fragment G200-HIS and full-length ApoE4 were prepared by 4-fold dilution starting from 1000 ng/ml in 96 well storage plates (30 μl final volume). Each recombinant antibody to be tested was added (30 μl) to the serial dilutions of each of the synthetic ApoE peptides, G200-HIS or full-length ApoE4 at a final concentration of 0.05 μg/ml per well. Samples were pre-incubated for 45 min at room temperature with shaking (900 rpm).
[0473] The pre-incubated samples were transferred (50 μl/well) to the blocked ELISA plates, and plates were incubated for 25 min at room temperature without shaking. Plates were washed as described above. Alkaline phosphatase conjugated anti-mouse IgG detection antibody (Mabtech, cat. no. 3310-4) was diluted 1:1000 and added to each plate (50 μl/well). The plate was sealed and incubated with shaking (900 rpm) for 45 min at room temperature and subsequently washed as described above. Alkaline phosphatase substrate (50 μl/well) was added to the plate and the optical density was read every 15 min at a wavelength of 405 nm for up to 120 min. The IC50 values were determined from a log inhibitor concentration response curve (
[0474] In addition, a second inhibition ELISA with the ApoE peptides conjugated to BSA was run, in which the starting concentration of the antigens in solution was increased 10-fold. i.e. the starting concentration of the N-terminal neo-epitope of synthetic ApoE peptides conjugated to BSA and starting at amino acid L198 (SEQ ID NO:52), A199 (SEQ ID NO:51) or G200 (SEQ ID NO:50), or to BSA-conjugated negative control peptide (SEQ ID NO:53), was 10000 ng/ml. Furthermore, a 4-fold serial dilution of antigen was used, the plates were blocked with protein-free blocking solution (Pierce) for 90 min, the pre-incubated samples were incubated on the coated plates for 10 min (instead of 25 min), and the optical density was read every 10 min (instead of every 15 min). IC50 values were determined from a log inhibitor concentration response curve (
[0475] Selectivity evaluation and K.sub.D determination of recombinant antibodies by bio-layer interferometry: Binding interactions between the N-terminal neo-epitope peptide G200 (SEQ ID NO:50) conjugated to BSA (ligand) and the recombinant antibodies produced in Example 11 (analyte) were evaluated using an Octet RED384 instrument (ForteBio). All analyzed proteins were diluted in 1×Kinetics Buffer (ForteBio).
[0476] To analyze the antibody-target interaction and to determine the binding affinity of the recombinant antibodies for recombinant C-terminal ApoE fragment G200-HIS (SEQ ID NO:48), anti-HIS capture biosensors (HIS1K) were used. In the first step (loading step), HIS-tagged recombinant C-terminal ApoE fragment was captured onto the surface of the biosensor. Next, a concentration gradient of pure antibodies was prepared ranging from 150 nM to 2.5 nM in 2-fold serial dilutions. Subsequently, the HIS1K biosensors with ligand were dipped in wells containing diluted antibodies, and the association phase was monitored for 600 s. For monitoring the dissociation phase, the HIS1K biosensors with ligand were moved to a well containing 1× Kinetics Buffer and the dissociation was monitored for 1000 s. For evaluation of the kinetic experiments, the Octet Data Analysis software was used. All values collected from interaction analysis were blank subtracted, and a 1:2 binding kinetics global fit model (bivalent analyte) was used for the evaluation.
[0477] Selectivity evaluation and K.sub.D determination of recombinant antibodies by surface plasmon resonance: Binding interactions between the antigens and antibodies were evaluated by surface plasmon resonance (SPR) using a Biacore 8K instrument (GE Healthcare) according to standard procedures.
[0478] To determine the binding affinity of the monoclonal antibodies for N-terminal neo-epitopes compared to full-length ApoE, single-cycle kinetics experiments were conducted. The recombinant fragments were immobilized onto a CM5 Sensor Chip (GE Healthcare, cat. no. 29104988) using an amine coupling kit (GE Healthcare, cat. no. BR100050) according to the manufacturer's instructions. Reference (no immobilized antigen) and active surfaces were treated with the same conditions using the amine coupling reagents on flow cell 1 (Fc1) and flow cell 2 (Fc2), respectively. The immobilization level for the active surfaces was kept at approximately 150-200 response units (RU). The same protocol setup was used to immobilize full-length ApoE onto the CM5 chip surface.
[0479] Purified antibodies were prepared in 2-fold serial dilution from 14 to 0.3 nM (in 5-7 steps). Next, the prepared serial dilution of purified antibodies was injected (30 μl/min, contact time 360 s, dissociation time 2500 s) over both flow cells of the sensor chip. The interaction series was done in triplets. Values were blank subtracted, and a bivalent analyte binding kinetics fit model was used for the evaluation.
[0480] In all SPR experiments, 1xPBS-P+(GE Healthcare, cat. no. 28995084) was used to dilute antibodies and target antigens. Experiments were performed at 25° C.
[0481] Selectivity evaluation and human target binding in Alzheimer's disease brain extracts by Western blot analysis: The Western blot analysis described below was used to evaluate selective binding of recombinant antibodies with affinity for the N-terminal neo-epitope of ApoE fragments 2 kDa starting at G200, without binding to ApoE full-length protein, in human brain extracts from an Alzheimer's disease patient. Fresh frozen brain tissue from the Alzheimer's disease patient was homogenized in RIPA 2% SDS extraction buffer, followed by centrifugation at 16000×g for 1 h. The subsequent supernatant was subjected to standard protein concentration determination.
[0482] RIPA 2% SDS brain extract containing approximately 60 μg total protein was mixed with 2×Laemmli sample buffer, boiled for 5 min at 95° C. and loaded onto SDS-PAGE gels (Bolt™ 12% Bis-Tris Plus 10 well, Thermo Fisher, cat. no. NW00120BOX). Gels were run for 30-40 min at 180 V, after which proteins were transferred from the gels onto nitrocellulose membranes using the Trans-Blot® Turbo™ system (Bio-Rad). Membranes were blocked in Intercept® PBS Blocking Buffer (LI-COR) for 1 h and incubated over night at room temperature with recombinant antibodies with affinity for the N-terminal neo-epitope of ApoE fragments 2 kDa starting at G200 (2 μg/ml in Intercept® PBS Blocking Buffer (LI-COR) with 0.1% TWEEN®-20). Membranes were washed and incubated for 1 h at room temperature with the detection antibody anti-mouse-800CW (LI-COR, cat. no. 925-32210) diluted 1:25000 in Intercept® PBS Blocking Buffer (LI-COR) with 0.1% TWEEN®-20. Membranes were washed and images acquired using Odyssey® FC (LI-COR).
[0483] To confirm that the obtained bands on the Western blot membranes were of ApoE origin, the membranes were re-stained over night with a polyclonal anti-ApoE antibody (Calbiochem, cat. no. 178479; immunogen ApoE aa 1-299), diluted 1:2000 in Intercept® PBS Blocking Buffer (LI-COR) with 0.1% TWEEN®-20. Membranes were washed and incubated for 1 h at room temperature with detection antibody anti-goat-680RD (LI-COR, cat. no. 925-68074) diluted 1:25000 in Intercept® PBS Blocking Buffer (LI-COR) with 0.1% TWEEN®-20. Membranes were washed and images acquired using Odyssey® FC (LI-COR).
[0484] Selectivity evaluation and human target binding in Alzheimer's disease brain extracts by immunoprecipitation and Western blot analysis: The immunoprecipitation/Western blot analysis described below was used to evaluate selective binding of recombinant antibodies with affinity for the N-terminal neo-epitope of ApoE fragments 2 kDa starting at G200, without binding to ApoE full-length protein, in human brain extracts from Alzheimer's disease patients. Fresh frozen brain tissue from Alzheimer's disease patients was homogenized in RIPA 2% SDS extraction buffer, followed by centrifugation at 16000×g for 1 h. The subsequent supernatants were subjected to standard protein concentration determination.
[0485] RIPA 2% SDS brain extract containing approximately 75 μg total protein was mixed with recombinant antibody with affinity for the N-terminal neo-epitope of ApoE fragments 12 kDa starting at G200, in IP buffer (PBS, 0.05% TWEEN®-20, 1% Triton X-100 and cOmplete™ Protease Inhibitor Cocktail) and incubated for 2 h (room temperature with head-to-tail rotation). Dynabeads™ Protein A beads (Invitrogen) were added and the extract-antibody-dynabeads mixture was incubated for 1 h (room temperature with head-to-tail rotation). The supernatant was removed and the magnetic beads were washed. The immunoprecipitate was eluted from the beads by addition of 2×Laemmli sample buffer and boiling for 5 min at 95° C. The eluate was loaded onto a SDS-PAGE gel (Bolt™ 12% Bis-Tris Plus 10 well, Thermo Fisher, cat. no. NW00120BOX) and run for 30-40 min at 180 V, after which proteins were transferred from the gels to nitrocellulose membranes using the Trans-Blot® Turbo™ system (Bio-Rad). Membrane was blocked in Intercept® PBS Blocking Buffer (LI-COR) for 1 h and incubated over night at room temperature with anti-ApoE C-terminal antibody (Sigma, cat. no. sab2701946) diluted 1:1000 in Intercept® PBS Blocking Buffer (LI-COR) with 0.1% TWEEN®-20. Membrane was washed and incubated for 1 h at room temperature with the detection antibody anti-rabbit-800CW (LI-COR, cat. no. 925-32211) diluted 1:25000 in Intercept® PBS Blocking Buffer (LI-COR) with 0.1% TWEEN®-20. Membrane was washed and image acquired using Odyssey® FC (LI-COR).
[0486] Human target engagement in Alzheimer's disease brain by immunohistochemistry (IHC): Paraffin embedded tissues from individuals with Alzheimer's disease (APOE ε3/ε3 and APOE ε4/ε4) were obtained from Netherlands Brain Bank. Sections were cut at 4 μm.
[0487] IHC staining was performed with the recombinant antibody 7C7 (see Example 11) and with anti-ApoE C-terminus antibody (Sigma, cat. no. sab2701946; immunogen ApoE aa 237-299) and anti-ApoE antibody (Calbiochem, cat. no. 178479; immunogen ApoE aa 1-299), using a Discovery XT Robot (Ventana Medical Systems). In addition, brain sections were stained using the anti-Aβ antibodies 6E10 (Covance, cat. no. SIG-39320) and 4G8 (Covance, cat. no. SIG-39220) for staining of amyloid plaques.
[0488] Briefly, for single fluorescent or brightfield IHC staining of amyloid beta or ApoE, an automated staining robot and HQ hapten technology were used. The detection system Discovery XT and kits from Ventana Medical Systems (F. Hoffmann-La Roche, Ltd) were used. The Amp HQ kit, in conjunction with 1) an Anti-HQ HRP, DISCOVERY (Roche, cat. no. 760-48202), Anti-Rabbit HQ, DISCOVERY (Roche, cat. no. 760-4815); 2) an OmniMap or UltraMap HRP Multimer with a monoclonal anti mouse IgG bridge antibody (Abcam, cat. no. [M204-3] ab133469); and 3) a chromogenic DISCOVERY ChromoMap DAB Kit (Roche, cat. no. 760-159) or fluorescent detection kit Cy5 Kit, DISCOVERY (Roche, cat. no. 760-238), enables the enhancement of the chromogenic or fluorescent signal in standard IHC. The paraffin sections were incubated at 60° C. for 30 min, deparaffinized in 2× xylene for 15 min, followed by gradient ethanol wash before rehydration in 1× PBS. Before application of antibodies, the sections were exposed to antigen retrieval solutions during an automated heat process (standard CC1 protocol from Ventana at 95° C., or a pre-treatment by protease (Ventana Protease 2, cat. no. 780-4148) applied to slides for 24 min.
[0489] Stained slides were scanned in brightfield or fluorescence channels Dapi (nuclear counterstain), 3,3′-diaminobenzidine (DAB) or CY5 (primary antibodies) and autofluorescence channel 44DCC using a Pannoramic 250 FLASH II slide scanner (3D Histech). The resulting image files were uploaded into viewer software (Pannoramic CaseViewer) and adjusted for optimal brightness and contrast, for manual assessment of the staining result.
Results
[0490] Selectivity evaluation of recombinant antibodies by direct ELISA: The six produced recombinant antibodies 4E6, 7610, 7C7, 17G4, 23D5 and 28F2 were screened for reactivity towards the BSA-conjugated peptides 198-203, 199-204 or 200-205 and the ApoE recombinant fragment aa 200-299. In addition, absence of reactivity towards recombinant full-length ApoE (ApoE4 1-299) and the negative control peptide (SEQ ID NO:53) conjugated to BSA was studied.
[0491] All recombinant antibodies demonstrated strong binding to the N-terminal neo-epitope peptide G200 (SEQ ID NO:50) and to the recombinant C-terminal ApoE fragment G200-HIS (aa 200-299; SEQ ID NO:48), whereas no binding to recombinant ApoE4 full-length protein (SEQ ID NO:49) or to the negative control peptide (SEQ ID NO:53) was shown (
[0492] No difference was found in the second direct ELISA, in which the coat consisted of recombinant G200-HIS C-terminal ApoE fragment (SEQ ID NO:48) and recombinant full-length ApoE4 (SEQ ID NO:45) added at equal molarities (0.1 μM) (
[0493] Selectivity evaluation and IC50 determination of recombinant antibodies by inhibition ELISA: The six produced recombinant antibodies 4E6, 7610, 7C7, 17G4, 23D5 and 28F2 were screened for binding strength and binding selectivity towards the N-terminal neo-epitope peptide G200-BSA (aa 200-205) and the recombinant C-terminal ApoE fragment G200-HIS (aa 200-299). In addition, antibodies were screened for lack of reactivity towards BSA-conjugated peptides 198-203 and 199-204, and recombinant full-length ApoE4.
[0494] All recombinant antibodies demonstrated strong binding and selectivity for the G200-BSA peptide (aa 200-205) and the recombinant G200 fragment (aa 200-299), whereas no binding to recombinant ApoE4 full-length protein (aa 1-299) was shown (
TABLE-US-00005 TABLE 5 Summary of results from direct and inhibition ELISA analysis of recombinant anti-G200 antibodies IC50 G200-BSA EC50 (ng/ml) G200-BSA G200-HIS peptide G200-BSA G200-HIS peptide fragment (ng/ml) Clone peptide fragment (ng/ml) (nM) 2.sup.nd protocol 4E6 6.9 9.5 2.9 4.0 11.5 7B10 7.3 10.7 2.2 2.8 5.8 7C7 13.0 18.1 3.1 2.8 6.3 17G4 5.1 7.9 2.9 3.0 5.8 23D5 11.6 10.1 2.8 2.4 3.8 28F2 7.2 21.5 3.2 2.4 3.7
[0495] Selectivity evaluation and K.sub.D determination of recombinant antibodies by bio-layer interferometry: Binding interactions between the recombinant G200 C-terminal ApoE fragment (ligand) and recombinant antibodies (analyte) were evaluated by using an Octet RED384 instrument (ForteBio). The results from the Octet experiment are outlined in
[0496] Selectivity evaluation and K.sub.D determination of recombinant antibodies by surface plasmon resonance: The six recombinant antibodies 4E6, 7610, 7C7, 17G4, 23D5, and 28F2 were evaluated for selectivity and their K.sub.D values determined, by surface plasmon resonance.
[0497] All recombinant antibodies demonstrated binding to the G200-HIS fragment (
TABLE-US-00006 TABLE 6 Summary of results from biolayer interferometry analysis and surface plasmon resonance of recombinant anti-G200 antibodies Octet: G200-HIS Biacore: G200-HIS fragment fragment on Bivalent analyte kd K.sub.D Clone biosensor K.sub.D (nM) ka (×10.sup.5 1/Ms) (×10.sup.−3 1/s) (nM) 4E6 0.9 815 6.0 1030 7B10 0.8 12.0 3.8 330 7C7 1.9 28.8 2.9 417 17G4 0.8 87.3 2.4 141 23D5 5.2 2.6 10.5 299 28F2 9.7 49.8 3.5 9830
[0498] Selectivity evaluation and human target binding in Alzheimer's disease brain extracts by Western blot analysis: The recombinant antibodies 4E6, 7610, 7C7, 17G4, 23D5 and 28F2 were tested for their ability to bind selectively to ApoE fragments 2 kDa in human brain extracts from an Alzheimer's disease patient, while not binding to full-length ApoE. Western blot analysis demonstrated binding of the recombinant antibodies to two ApoE fragments of approximately 12 kDa and 10 kDa in size, without any visual binding to full-length ApoE (
[0499] Selectivity evaluation and human target binding in Alzheimer's disease brain extracts by immunoprecipitation/Western blot analysis: The recombinant antibodies 4E6, 7610, 7C7, 17G4, 23D5 and 28F2 were tested for their ability to find and bind selectively to ApoE fragments 2 kDa in solution, in human brain extracts from Alzheimer's disease patients. Immunoprecipitation (IP) of brain extracts from Alzheimer's disease patients using the recombinant anti-G200 antibodies, followed by Western blot using an anti-ApoE C-terminal antibody, demonstrated immunoprecipitation of a 12 kDa ApoE fragment by four of the recombinant anti-G200 antibodies, namely 4610, 7C7, 17G4 and 28F2. No full-length ApoE was immunoprecipitated from the brain extracts. Results from the Western blot also show intense bands for the IP antibody heavy and light chain (
[0500] Human target engagement in Alzheimer's disease brain by immunohistochemistry: Immunohistochemical staining of brain sections from Alzheimer's disease (APOE ε3/ε3 and ε4/ε4) individuals demonstrates weak binding of 7C7 to amyloid plaques when compared to total Aβ IHC and ApoE reference antibodies (
Example 13
Generation and Screening of Antibodies to the N-Terminal ApoE Fragment Neo-Epitope L198
[0501] This Example describes the immunization of BALB/c and C57BI/6 mice and subsequent generation and screening of hydridoma cell lines.
Materials and Methods
[0502] Peptide synthesis: The immunogen used in this experiment was designed to incorporate one of the N-terminal neo-epitopes of the neurotoxic ApoE fragment identified in Examples 1-7. As its N-terminal sequence, the immunogen comprised the amino acid residues corresponding to amino acid residues 198-205 in full-length ApoE. This N-terminal sequence was coupled C-terminally to a 6-aminocaproic acid linker (Acp; also denoted aminohexanoic acid linker (Ahx)), followed by a cysteine residue for the purposes of conjugation to for example keyhole limpet hemocyanin (KLH) or bovine serum albumin (BSA) as indicated. The entire immunogen sequence used was LAGQPLQE-Acp-C(SEQ ID NO:54). SEQ ID NO:54 was prepared by Innovagen AB and delivered at 95.9% purity. In addition, the shorter peptide LAGQPL-Acp-C(SEQ ID NO:52), corresponding to amino acids 198-203, was used for screening for positive clones against the neo-epitope. SEQ ID NO:52 was prepared by Innovagen AB and delivered at 95.2% purity.
[0503] Additionally, as in Example 9, ApoE-derived peptides were prepared which incorporated the other two identified putative N-terminal neo-epitopes of the neurotoxic ApoE fragment, as well as a negative control peptide without any of the identified neo-epitopes. These peptides were AGQPLQ-Acp-C (SEQ ID NO:51, prepared by Innovagen AB and delivered at 96.7% purity), GQPLQE-Acp-C(SEQ ID NO:50, prepared by Innovagen AB and delivered at 95.5% purity) and the negative control peptide AATVGSLAGQPLQER-Acp-C (SEQ ID NO:53, prepared by Innovagen AB and delivered at 97.8% purity).
[0504] Immunization: 6-8 weeks old BALB/c or C57BI/6 mice were immunized with SEQ ID NO:54 conjugated to KLH. In the first injection (s.c.), the immunogen was given together with Freund's complete adjuvant. In subsequent injections (s.c.) except the last one, the immunogen was given in Freund's incomplete adjuvant. Plasma samples were collected three weeks and five weeks after the first immunization. Every mouse received between 2-3 injections. The final immunization (booster dose) was administered intraperitoneally (i.p.) without adjuvant.
[0505] Plasma screening by direct ELISA: Plasma samples were analyzed by ELISA for reactivity against the target peptide SEQ ID NO:54 conjugated to bovine serum albumin, BSA, and against the recombinant ApoE fragment L198-HIS (SEQ ID NO:57) to determine when to stop immunizations and initiate hybridoma generation. In addition, negative control peptide (SEQ ID NO:53) and ApoE 1-272 (SEQ ID NO:56) were tested for reactivity. Briefly, 96-well full area plates were coated with 1 μg/ml antigen, i.e. L198 N-terminal neo-epitope peptide (ApoE sequence 198-205 incorporated in SEQ ID NO:54) coupled to BSA, negative control peptide (ApoE sequence 192-206 incorporated in SEQ ID NO:53) coupled to BSA, or purified recombinant C-terminal ApoE fragment L198-HIS (SEQ ID NO:57) or ApoE 1-272-HIS (SEQ ID NO:56). ELISA was run according to a standard protocol and a peroxidase-conjugated goat anti-mouse IgG antibody was used as detection antibody. Only mice that responded well to immunizations and gave positive responses towards the target peptide SEQ ID NO:54 conjugated to BSA and the recombinant ApoE fragment L198-HIS (SEQ ID NO:57), and a negative response to ApoE 1-272 (SEQ ID NO:56) were considered interesting for fusion to hybridomas.
[0506] Generation of hybridomas: A selected mouse received a final booster dose of immunogen i.p. (no adjuvant) 4 days before generation of hybridomas. Generation of hybridomas was performed by fusion with Sp2/0 cells and the fused cells were plated in 96-well plates. Primary screening was performed by ELISA using BSA-conjugated peptide and ApoE fragment, and positive clones were screened against the negative control peptide and ApoE 1-272 fragment. Supernatant from the best responders (20 clones) were characterized further for selection of clones to be processed for limiting dilution assay to ensure monoclonality. After a limiting dilution assay, unpurified supernatant was subjected to further characterization. The clones of interest were cryopreserved and expanded for production and purification of antibody (Innovagen AB) and subjected to sequencing (Absolute Antibodies).
[0507] Hybridoma screening by direct ELISA: ELISA experiments to identify hybridoma clones that produced antibodies with reactivity against the target epitope were performed according to standard protocols as described above under “Plasma screening by direct ELISA” and the corresponding section of Example 9. During screening of hybridomas, and to reach monoclonality, six different antigens were used at a concentration of 1 μg/ml. These were the two L198 N-terminal neo-epitope peptides (ApoE sequence 198-205 incorporated in SEQ ID NO:54 and ApoE sequence 198-203 incorporated in SEQ ID NO:52) coupled to BSA, negative control peptide (SEQ ID NO:53) coupled to BSA, recombinant C-terminal ApoE fragment L198-HIS (SEQ ID NO:57), recombinant ApoE4 1-272 fragment (SEQ ID NO:56), and recombinant full-length ApoE4 (SEQ ID NO:45, Abcam, cat. no. ab50243).
[0508] For the hybridoma screening ELISAs, “positive” wells were selected based on positive response towards the target peptide SEQ ID NO:54 conjugated to BSA and the recombinant ApoE fragment L198-HIS (SEQ ID NO:57) and the presence of clone(s). The identified positive clones were then subjected to negative screenings using the same ELISA protocol, with negative control peptide (SEQ ID NO:53) coupled to BSA, and ApoE fragment 1-272 (SEQ ID NO:56) as coat for the plates. Supernatants from the top 20 clones that showed no binding in the negative screening were further characterized by determination of IgG concentration, by establishing concentration-response curves towards the L198 N-terminal neo-epitope peptide coupled to BSA, the recombinant ApoE fragment L198-HIS and ApoE4 full-length protein (performed as in Example 9), and by studying human target engagement by Western blot.
[0509] Determination of IgG concentration by direct ELISA: A standard ELISA protocol was used to determine the IgG concentration in the hybridoma supernatants. To be able to measure IgG concentration, plates were coated with a 0.5 μg/ml solution of an α-mouse IgG, F(ab′).sub.2 specific antibody, and a reference antibody with a known IgG concentration was used as standard. The optical density at 450 nm was plotted against the antibody concentration to generate concentration-response curves. IgG concentrations for the hybridoma supernatants were calculated from the curve fit.
[0510] Selectivity evaluation and human target binding in Alzheimer's disease brain extracts by Western blot analysis: Western blot analysis was used to evaluate selective binding of monoclonal antibodies with affinity for the N-terminal neo-epitope of ApoE fragments 2 kDa, starting at L198, without binding to ApoE full-length protein, in a human brain extract from an Alzheimer's disease patient. The same protocol as in Example 10 was used, except that a total protein content of 60 μg in the RIPA 2% SDS brain extract was mixed with 2×Laemmli sample buffer.
[0511] Based on the result from IgG concentration, ELISA and Western blot, the top five candidate clones were subjected to at least two rounds of limiting dilution assay to ensure monoclonality, and screened for binding to the L198-HIS fragment (SEQ ID NO:57) and the target peptide SEQ ID NO:54 conjugated to BSA. Furthermore, IgG concentrations were determined and concentration-response curves towards the recombinant ApoE fragment L198-HIS, the target peptide SEQ ID NO:54 conjugated to BSA, and ApoE4 full-length protein were performed as described in Example 10. Clones that still bound L198-HIS fragment but not full-length ApoE4 and continued to grow were considered especially interesting for further characterization. Antibodies were produced from these clones and purified to generate purified monoclonal antibodies (Innovagen AB), and the clones were sent for sequencing (Absolute Antibodies).
Results
[0512] Generation of monoclonal antibodies by hybridoma technology: Antibodies that bind selectively to the N-terminal neo-epitope starting at amino acid L198 of the ApoE protein were generated by immunizations using an ApoE specific sequence consisting of the eight first amino acids following the N-terminal in the 198-299 ApoE fragment. The shortness of the immunization peptide was considered necessary in order to enable generation of antibodies that bind selectively to the N-terminal neo-epitope starting at amino acid L198 of the ApoE protein, without any binding to the linear epitope found in full-length ApoE protein. The ApoE-specific sequence peptide 198-205, conjugated to keyhole limpet haemocyanin (KLH) via an Acp linker and a cysteine residue, was used in the immunizations. The plasma samples were analyzed by ELISA for reactivity against the corresponding peptide conjugated to BSA (to avoid detecting reactivity towards KLH), and against recombinant ApoE fragment. The best responder of the immunized mice (a C57BL/6 mouse) was chosen for hybridoma generation.
[0513] ELISA screening for antibodies that bind selectively to the N-terminal neo-epitope of ApoE fragment starting at L198: Generated hybridoma clones were screened for reactivity towards the recombinant ApoE fragment L198-HIS, as well as reactivity towards the target peptide SEQ ID NO:54 conjugated to BSA. In addition, lack of reactivity towards recombinant full-length ApoE4, recombinant ApoE fragment 1-272-HIS, and negative control peptide SEQ ID NO:53 conjugated to BSA was evaluated. Twenty clones were identified as antibodies selective for the N-terminal neo-epitope of ApoE fragments starting at amino acid L198 and were evaluated further.
[0514] Determination of IgG concentration: The range of IgG concentration was between 0.3-11.3 μg/ml. Antibody concentration was normalized in cell medium, so that the starting concentration in ELISA experiments would be the same.
[0515] ELISA screening of top twenty antibodies that bind selectively to the N-terminal neo-epitope of ApoE fragment starting at L198: All antibodies were reactive towards the target peptide SEQ ID NO:52 conjugated to BSA and the recombinant ApoE fragment L198-HIS, but not towards recombinant full-length ApoE4. The top ten responders were further evaluated by Western blot.
[0516] Selectivity evaluation and human target binding in Alzheimer's disease brain extracts by Western blot analysis: All antibodies were able to bind to the recombinant ApoE fragment L198-HIS, but only 9 of 10 bound to fragments in a human brain extract.
[0517] Of the twenty top responders, five were chosen based on IgG concentration, direct ELISA, and binding to human target. These clones were subjected to limiting dilution assay to ensure monoclonality and continued reactivity towards the recombinant ApoE fragment L198-HIS, and the target peptides SEQ ID NO:54 and SEQ ID NO:52 conjugated to BSA, but not towards recombinant full-length ApoE4. All five clones were identified as antibodies selective for the N-terminal neo-epitope of ApoE fragments starting at amino acid L198, and denoted 6F4, 8B3, 12B1, 15F8 and 15H11. All were produced and purified as monoclonal antibodies and clones were sent for sequencing.
Example 14
Hybridoma Sequencing and Isotype Determination of Antibodies to the N-Terminal ApoE Fragment Neo-Epitope L198
Materials and Methods
[0518] Hybridoma sequencing: Hybridoma clones producing the monoclonal antibodies generated and characterized in Example 13, having a demonstrated selectivity for the N-terminal neo-epitope of ApoE fragment starting at amino acid L198, and a proven human target binding in brain extracts from Alzheimer's disease, were sent to Absolute Antibody for sequencing. Briefly, hybridoma sequencing was performed by whole transcriptome shotgun sequencing. The DNA and protein sequences of the mature VH and VL regions were identified.
Results
[0519] Hybridoma sequencing: Hybridoma clones with a demonstrated selectivity for the N-terminal neo-epitope of ApoE fragment starting at amino acid L198, in addition to a demonstrated binding to human target in brain extracts from Alzheimer's disease, were sequenced.
[0520] The following hybridoma clones were sequenced: 6F4, 8B3, 12B1, 15F8 and 15H11. The amino acid sequences of the entire antibodies were obtained. Amino acid sequences obtained for the respective variable heavy (VH) and variable light (VL) chains are given in Table 7 below.
TABLE-US-00007 TABLE 7 Variable region sequences SEQ ID Region Antibody NO: 6F4 VH EVNLEESGGDLVQPGRSLKLSCVASGFTFSDYWMNWVRQSPEKGLE 82 WVAQIRLKSDNYVTHYVESLKGRFTISRDDSRSCVYLQMNNLRAEDTG IYYCTGHILLRRRYFDVWGTGTTVTVSS VL DIVMTQSQKFMSTSVGDRVSVTCEASQNVGTNVAWYQQKPGQSPKG 83 LIYSASYRYSGVPDRFTGSGSGTDFTLTISTVOSEDLAEYFCHQFNTYP YTFGGGTTLEII 8B3 VH EVKVEESGGGVVQPGGSMKLSCLASGFTFRNYWMNWVRQSPEKGL 84 EWVAQIRLKSDNYATRYAESVKGRFTISRDDSKSSVYLQMNNLRAEDT GTYYCSGHILLRYYALDFWGQGTSVTVSS VL DIVLTQSQKFMSTSVGDRVSVTCKASQNVYTDVAWYQQKPGQSPKG 85 MIYSASYRYSGVPDRFTGSGSGTDFTLKISNVQSEDLAEYFCQQYNSF PYTFGGGTKLEIK 12B1 VH EVKLEESGGGLVQPGGSMKLSCVASGITFSKYWMNWVRQCPEKGLE 86 WVAQIRLRSDNYATHYAESVKGRFTISRDDSKSSVYLQMNTLRAEDTG IYYCTHHYYGSSGYVDVWGTGTTVTVSS VL DIVMTQSQKFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQCPKG 87 MILSASQRYSGVPDRFTGSGFGTEFTLTISNVQSEDLAEYFCQQYNSY PYTFGGGTKLERK 15F8 VH EVKLEESGGGLVHPGGSMKLSCVGSGFTFSNYWMNWVRQSPEKGLE 88 WVAQIKLRSDNYATHYAESVKGKFTISRDDAKSSVYLQMDNLRAEDTG IYYCSHHYLDSGGYFDVWGTGTSVTVSS VL DIVMTQSQKFMSTSVGDRVSVTCKASQNVGINVAWYQDKPGQSPKGL 89 ILSASYRYSGVPDRFTGSGSGTDFTLTISNVQSEDLAEYFCQQYNSYP YTFGGGTKLEIK 15H11 VH EVKLEESGGGLVQPGGAMKLSCVASGITFSNYWMNWVRQCPEKGLE 90 WVAQIRLKSDNYATHYAESVKGRFTISRDDSKSSVYLQMNTLRAEDTG IYYCTHHYYGSSGYVDVWGTGTTVTVSS VL DIVMTQSQKFMSTSVGDRVSVTCKASQNVGNNVAWYQKKPGQCPKG 91 MILSASQRYSGVPDRFTGSGFGTEFTLIISNVQSEDLAEYFCHQYNSYP YTFGGGTKLERK
[0521] The complementarity determining regions (CDRs) were identified using the Kabat definition for the primary VH and VL sequences and are given in Table 8 below.
TABLE-US-00008 TABLE 8 CDR region sequences Antibody CDR H1 CDR H2 CDR H3 6F4 DYWMN QIRLKSDNYVTHYVESLKG HILLRRRYFDV (SEQ ID NO: 59) (SEQ ID NO: 60) (SEQ ID NO: 61) 8B3 NYWMN QIRLKSDNYATRYAESVKG HILLRYYALDF (SEQ ID NO: 62) (SEQ ID NO: 63) (SEQ ID NO: 64) 12B1 KYWMN QIRLRSDNYATHYAESVKG HYYGSSGYVDV (SEQ ID NO: 65) (SEQ ID NO: 66) (SEQ ID NO: 67) 15F8 NYWMN QIKLRSDNYATHYAESVKG HYLDSGGYFDV (SEQ ID NO: 62) (SEQ ID NO: 68) (SEQ ID NO: 69) 15H11 NYWMN QIRLKSDNYATHYAESVKG HYYGSSGYVDV (SEQ ID NO: 62) (SEQ ID NO: 70) (SEQ ID NO: 67) CDR L1 CDR L2 CDR L3 6F4 EASQNVGTNVA SASYRYS HQFNTYPYT (SEQ ID NO: 71) (SEQ ID NO: 72) (SEQ ID NO: 73) 8B3 KASQNVYTDVA SASYRYS QQYNSFPYT (SEQ ID NO: 74) (SEQ ID NO: 72) (SEQ ID NO: 75) 12B1 KASQNVGTNVA SASQRYS QQYNSYPYT (SEQ ID NO: 76) (SEQ ID NO: 77) (SEQ ID NO: 78) 15F8 KASQNVGINVA SASYRYS QQYNSYPYT (SEQ ID NO: 79) (SEQ ID NO: 72) (SEQ ID NO: 78) 15H11 KASQNVGNNVA SASQRYS HQYNSYPYT (SEQ ID NO: 80) (SEQ ID NO: 77) (SEQ ID NO: 81)
[0522] The antibodies were isotyped based on their sequences, and their respective sub-class and light chain are summarized in Table 9 below.
TABLE-US-00009 TABLE 9 Isotyping results Clone Sub-class Light chain 6F4 IgG1 κ 8B3 IgG2b κ 12B1 IgG2c κ 15F8 IgG2c κ 15H11 IgG1 κ
Example 15
Characterization of Purified Monoclonal Antibodies to the N-Terminal ApoE Fragment Neo-Epitope L198
[0523] This example describes the characterization of the purified monoclonal antibodies described in Examples 13 and 14 by various methods, including direct ELISA, inhibition ELISA, surface plasmon resonance, Western blot on human brain extract and immunoprecipitation on human brain extract.
Materials and Methods
[0524] Selectivity evaluation of purified monoclonal antibodies by direct ELISA: The direct ELISA described below was used to evaluate the binding selectivity of the purified monoclonal antibodies produced in Example 14. The ability to selectively bind to the L198 N-terminal neo-epitope ApoE peptide (BSA-conjugated SEQ ID NO:52) and to the recombinant L198-HIS C-terminal ApoE fragment resulting from cleavage in the hinge region (SEQ ID NO:57) was compared with binding to the A199, G200 and negative control peptides (BSA-conjugated SEQ ID NO:51, 50 and 53, respectively), and to recombinant full-length ApoE4 (ApoE sequence aa 1-299; SEQ ID NO:45).
[0525] The screening was performed according to standard ELISA protocols. Briefly, 1 μg/ml solutions of BSA-conjugated neo-epitope peptides and negative control peptide, and 0.1 μM recombinant C-terminal ApoE fragment and full-length ApoE (Abcam, cat. no. ab50243) were prepared by dilution in PBS. 50 μl/well were added to an ELISA half-area 96 well microtiter plate, and the plate was sealed with adhesive sealer and incubated over night at 4° C. After discarding the solution, the plates were blocked with 150 μl/well of protein-free blocking solution (Pierce) for 1 h at room temperature with shake (600-900 rpm). The plates were washed four times with washing buffer containing 0.28 mM NaH.sub.2PO.sub.4, 2.5 mM Na.sub.2HPO.sub.4, 150 mM NaCl, 0.1% TWEEN®-20 and 0.0075% Kathon CG. Purified monoclonal antibodies of interest were 3-fold serially diluted with a starting dilution at 3 μg/ml (mixed 1:2 with dilution buffer (PBS with 0.1% BSA and 0.05% TWEEN®-20)). An anti-ApoE C-terminal antibody was used as a reference antibody (ApoE E-8 mouse monoclonal, Santa Cruz Biotechnology, cat. no. sc-393302). 50 μl/well were added into the ELISA plates and incubated for 2 h at room temperature with shake (600-900 rpm). The plates were washed four times as described previously. Detection antibody (HRP-conjugated anti-mouse IgG, Southern Biotech, cat. no. 1030-05, diluted 1:10000 in dilution buffer) was added 50 μl/well, and the plates were incubated for 1 h at room temperature with shake (600-900 rpm). After another wash (as described previously), 50 μl/well of K-Blue® aqueous substrate (Neogen) were added, and the reaction was stopped after 5-15 min with 50 μl/well of 0.5 M H2504. The optical density at 450 nm was read using an ELISA reader (Tecan). The optical density was plotted against the antibody concentration to generate concentration-response curves (
[0526] Selectivity evaluation and IC50 determination of purified monoclonal antibodies by inhibition ELISA: The inhibition ELISA described below was used to evaluate the binding strength and selectivity for the purified monoclonal antibodies described in Examples 13 and 14. The ability of the purified monoclonal antibodies to bind to the N-terminal neo-epitope of synthetic ApoE peptides starting at amino acid L198 was evaluated in comparison with their ability to bind to synthetic ApoE peptides starting at amino acids A199 and G200, as well as to the negative control peptide (aa 192-206) in solution.
[0527] In brief, the purified monoclonal antibody to be tested was allowed to interact with the N-terminal neo-epitope of synthetic ApoE peptides conjugated to BSA and starting at amino acid L198, A199 or G200, or to BSA-conjugated negative control peptide (SEQ ID NO:52, 51, 50 and 53, respectively). Thereafter, the mix was added to a microtiter plate coated with the BSA-coupled L198 synthetic ApoE peptide. If the purified monoclonal antibody binds to any of the antigens in the pre-incubation step (the synthetic ApoE peptides), the antibody is prevented from binding to the synthetic L198 ApoE peptide immobilized on the microtiter plate. This leads to inhibition of the ELISA detection signal.
[0528] 0.5 μg/ml solution of N-terminal neo-epitope peptide L198 (SEQ ID NO:52) conjugated to BSA was prepared by dilution in PBS. 50 μl/well were added to an ELISA half-area 96 well microtiter plate, the plate was sealed with adhesive sealer and incubated over night at 4° C. After discarding the solution, the plates were blocked with protein-free blocking solution (Pierce) (150 μl/well) at room temperature for 90 min with shaking (900 rpm). The blocked plate was washed four times with washing buffer containing 0.28 mM NaH.sub.2PO.sub.4, 2.5 mM Na.sub.2HPO.sub.4, 150 mM NaCl, 0.1% TWEEN®-20 and 0.0075% Kathon CG.
[0529] Serial dilutions of each synthetic ApoE peptide were prepared by 4-fold dilution starting from 10000 ng/ml in 96 well storage plates (30 μl final volume). Each recombinant antibody to be tested was added (30 μl) to the serial dilutions of each of the synthetic ApoE peptides at a final concentration of 0.05 μg/ml per well. Samples were pre-incubated for 45 min at room temperature with shaking (900 rpm).
[0530] The pre-incubated samples were transferred (50 μl/well) to the blocked ELISA plates, and plates were incubated for 10 min at room temperature without shaking. Plates were washed as described above. Alkaline phosphatase conjugated anti-mouse IgG detection antibody (Mabtech, cat. no. 3310-4) was diluted 1:1000 and added to each plate (50 μl/well). The plate was sealed and incubated with shaking (900 rpm) for 45 min at room temperature and subsequently washed as described above. Alkaline phosphatase substrate (50 μl/well) was added to the plate and the optical density was read every 10 min at a wavelength of 405 nm for up to 120 min. The IC50 values were determined from a log inhibitor concentration response curve (
[0531] Selectivity evaluation and K.sub.D determination of purified monoclonal antibodies by surface plasmon resonance: Binding interactions between the antigens and antibodies were evaluated by surface plasmon resonance (SPR) using a Biacore 8K instrument (GE Healthcare) according to standard procedures.
[0532] To determine the binding affinity of the monoclonal antibodies for N-terminal neo-epitopes compared to full-length ApoE, single-cycle kinetics experiments were conducted. The recombinant fragments were immobilized onto a CM5 Sensor Chip (GE Healthcare, cat. no. 29104988) using an amine coupling kit (GE Healthcare, cat. no. BR100050) according to the manufacturer's instructions. Reference (no immobilized antigen) and active surfaces were treated with the same conditions using the amine coupling reagents on flow cell 1 (Fc1) and flow cell 2 (Fc2) respectively. The immobilization level for the active surfaces was kept at approximately 150-200 response units (RU). The same protocol setup was used to immobilize full-length ApoE on the CM5 chip surface.
[0533] Purified antibodies were prepared in 2-fold serial dilution from 14 to 0.3 nM (in 5-7 steps). Next, the prepared serial dilution of purified antibodies was injected (30 μl/min, contact time 360 s, dissociation time 2500 s) over both flow cells of the sensor chip. The interaction series was done in triplets. Values were blank subtracted, and a bivalent analyte binding kinetics fit model was used for the evaluation.
[0534] In all SPR experiments, 1xPBS-P+(GE Healthcare, cat. no. 28995084) was used to dilute antibodies and target antigens. Experiments were performed at 25° C.
[0535] Selectivity evaluation and human target binding in Alzheimer's disease brain extracts by Western blot analysis: The Western blot analysis described below was used to evaluate selective binding of monoclonal antibodies with affinity for the N-terminal neo-epitope of ApoE fragments 2 kDa, starting at L198, without binding to ApoE full-length protein, in human brain extracts from an Alzheimer's disease patient. Fresh frozen brain tissue from the Alzheimer's disease patient was homogenized in RIPA 2% SDS extraction buffer, followed by centrifugation at 16000×g for 1 h. The subsequent supernatant was subjected to standard protein concentration determination.
[0536] RIPA 2% SDS brain extract containing approximately 60 μg total protein was mixed with 2× Laemmli sample buffer, boiled for 5 min at 95° C. and loaded onto SDS-PAGE gels (Bolt™ 12% Bis-Tris Plus 10 well, Thermo Fisher, cat. no. NW00120BOX). Gels were run for 30-40 min at 180 V, after which proteins were transferred from the gels onto nitrocellulose membranes using the Trans-Blot® Turbo™ system (Bio-Rad). Membranes were blocked in Intercept® PBS Blocking Buffer (LI-COR) for 1 h and incubated over night at room temperature with monoclonal antibodies with affinity for the N-terminal neo-epitope of ApoE fragments 2 kDa starting at L198 (2 μg/ml in Intercept® PBS Blocking Buffer (LI-COR) with 0.1% TWEEN®-20). Membranes were washed and incubated for 1 h at room temperature with the detection antibody anti-mouse-800CW (LI-COR, cat. no. 925-32210) diluted 1:25000 in Intercept® PBS Blocking Buffer (LI-COR) with 0.1% TWEEN®-20. Membranes were washed and images acquired using Odyssey® FC (LI-COR).
[0537] To confirm that the obtained bands on the Western blot membranes were of ApoE origin, the membranes were re-stained over night with a polyclonal anti-ApoE antibody (Calbiochem, cat. no. 178479; immunogen ApoE aa 1-299), diluted 1:2000 in Intercept® PBS Blocking Buffer (LI-COR) with 0.1% TWEEN®-20. Membranes were washed and incubated for 1 h at room temperature with detection antibody anti-goat-680RD (LI-COR, cat. no. 925-68074) diluted 1:25000 in Intercept® PBS Blocking Buffer (LI-COR) with 0.1% TWEEN®-20. Membranes were washed and images acquired using Odyssey® FC (LI-COR).
[0538] Selectivity evaluation and human target binding in Alzheimer's disease brain extracts by immunoprecipitation and Western blot analysis: The immunoprecipitation/Western blot analysis described below was used to evaluate selective binding of monoclonal antibodies with affinity for the N-terminal neo-epitope of ApoE fragments 2 kDa starting at L198, without binding to ApoE full-length protein, in human brain extracts from Alzheimer's disease patients. Fresh frozen brain tissue from Alzheimer's disease patients was homogenized in RIPA 2% SDS extraction buffer, followed by centrifugation at 16000×g for 1 h. The subsequent supernatants were subjected to standard protein concentration determination.
[0539] RIPA 2% SDS brain extract containing approximately 75 μg total protein was mixed with monoclonal antibody with affinity for the N-terminal neo-epitope of ApoE fragments 12 kDa starting at L198, in IP buffer (PBS, 0.05% TWEEN®-20, 1% TritonX-100 and cOmplete™ Protease Inhibitor Cocktail) and incubated for 2 h (room temperature with head-to-tail rotation). Dynabeads™ Protein A beads (Invitrogen) were added and the extract-antibody-dynabeads mixture was incubated for 1 h (room temperature with head-to-tail rotation). The supernatant was removed and the magnetic beads were washed. The immunoprecipitate was eluted from the beads by addition of 2×Laemmli sample buffer and boiling for 5 min at 95° C. The eluate was loaded onto a SDS-PAGE gel (Bolt™ 12% Bis-Tris Plus 10 well, Thermo Fisher, cat. no. NW00120BOX) and run for 30-40 min at 180 V, after which proteins were transferred from the gels to nitrocellulose membranes using the Trans-Blot® Turbo™ system (Bio-Rad). Membrane was blocked in Intercept® PBS Blocking Buffer (LI-COR) for 1 h and incubated over night at room temperature with anti-ApoE C-terminal antibody (Sigma, cat. no. sab2701946) diluted 1:1000 in Intercept® PBS Blocking Buffer (LI-COR) with 0.1% TWEEN®-20. Membrane was washed and incubated for 1 h at room temperature with the detection antibody anti-rabbit-800CW (LI-COR, cat. no. 925-32211) diluted 1:25000 in Intercept® PBS Blocking Buffer (LI-COR) with 0.1% TWEEN®-20. Membrane was washed and image acquired using Odyssey® FC (LI-COR).
Results
[0540] Selectivity evaluation of purified monoclonal antibodies by direct ELISA: The five purified monoclonal antibodies 6F4, 8B3, 1261, 15F8 and 15H11 were screened for reactivity towards the BSA-conjugated peptides 198-203, 199-204 or 200-205 and the ApoE recombinant fragment aa 198-299. In addition, absence of reactivity towards recombinant full-length ApoE (ApoE4 1-299) and the negative control peptide (SEQ ID NO:53) conjugated to BSA was studied.
[0541] All purified monoclonal antibodies demonstrated strong binding to the N-terminal neo-epitope peptide L198 (SEQ ID NO:52) and to the recombinant C-terminal ApoE fragment L198-HIS (aa 198-299; SEQ ID NO:57). At the highest concentration of antibody, four of the five antibodies (all except 6F4) showed some binding to recombinant ApoE4 full-length protein (SEQ ID NO:49), the negative control peptide (SEQ ID NO:53), and the 198-203 or 199-204 BSA-conjugated peptides (SEQ ID NO:51 and 52, respectively) (
[0542] As expected, the reference antibody directed to the ApoE C-terminal could detect and bind both the recombinant L198 fragment (aa 198-299) and the recombinant ApoE4 full-length protein (aa 1-299). Also as expected, because the epitope for the reference antibody is ApoE aa 274-299, no binding to the L198-BSA peptide was detected (
[0543] Selectivity evaluation and 1050 determination of purified monoclonal antibodies by inhibition ELISA: The five purified monoclonal antibodies 6F4, 8B3, 12131, 15F8 and 15H11 were screened for binding strength and binding selectivity towards the N-terminal neo-epitope peptide L198-BSA (aa 198-203). In addition, antibodies were screened for lack of reactivity towards BSA-conjugated peptides 199-204, 200-205 and the negative control peptide 192-206.
[0544] All purified monoclonal antibodies demonstrated strong binding and selectivity for the L198-BSA peptide (aa 198-203), whereas there was no binding to 199-204, 200-205 or negative control BSA-conjugated peptides (
TABLE-US-00010 TABLE 10 Summary of results from direct ELISA and inhibition ELISA of purified monoclonal anti-L198 antibodies EC50 (ng/ml) IC50 (ng/ml) L198-BSA L198-HIS L198-BSA Clone peptide fragment peptide 6F4 13.5 18.5 8.2 8B3 8.4 1.3 3.1 12B1 15.2 8.7 4.8 15F8 24.7 15.0 6.5 15H11 3.2 3.6 4.5
[0545] Selectivity evaluation and K.sub.D determination of purified monoclonal antibodies by surface plasmon resonance: The five purified monoclonal antibodies 6F4, 8B3, 12B1, 15F8 and 15H11 were evaluated for selectivity, and K.sub.D values for the target antigen were determined by surface plasmon resonance. All purified monoclonal antibodies demonstrated binding to the L198-HIS fragment (
TABLE-US-00011 TABLE 11 Summary of results from surface plasmon resonance of purified monoclonal anti-L198 antibodies Biacore: L198-HIS fragment ka kd K.sub.D Clone (×10.sup.4 1/Ms) (×10.sup.−6 1/s) (nM) 6F4 51 7.1 2.2 8B3 4.2 302 12 12B1 77 128 20 15F8 74 205 40 15H11 61 7.2 1.6
[0546] Selectivity evaluation and human target binding in Alzheimer's disease brain extracts by Western blot analysis: The purified monoclonal antibodies selective for the N-terminal neo-epitope of ApoE fragments starting at amino acid L198 (6F4, 8B3, 12B1, 15F8 and 15H11) were tested for their ability to bind selectively to ApoE fragments 2 kDa in human brain extracts from an Alzheimer's disease patient, and without any binding to full-length ApoE. Western blot analysis demonstrated binding of three of the monoclonal antibodies (6F4, 8B3 and 12B1) to two ApoE fragments approximately 12 kDa and 10 kDa in size, without any visual binding to full-length ApoE (
[0547] Selectivity evaluation and human target binding in Alzheimer's disease brain extracts by immunoprecipitation/Western blot analysis: The monoclonal antibodies selective for the N-terminal neo-epitope of ApoE fragments starting at amino acid L198 (6F4, 8B3, 12B1, 15F8 and 15H11) were tested for their ability to find and bind selectively to ApoE fragments 2 kDa in solution, in human brain extracts from Alzheimer's disease patients.
[0548] Immunoprecipitation (IP) of brain extracts from Alzheimer's disease patients using the monoclonal anti-L198 antibodies, followed by Western blot using an anti-ApoE C-terminal antibody, demonstrated immunoprecipitation of a 12 kDa ApoE fragment by two of the monoclonal anti-L198 antibodies; 12131 and 15F8 (
Example 16
Generation and Screening of Antibodies to the N-Terminal ApoE Fragment Neo-Epitope A199
[0549] This Example describes the immunization of BALB/c and C57BI/6 mice and subsequent generation and screening of hydridoma cell lines.
Materials and Methods
[0550] Peptide synthesis: The immunogen used in this experiment was designed to incorporate one of the N-terminal neo-epitopes of the neurotoxic ApoE fragment identified in Examples 1-7. As its N-terminal sequence, the immunogen comprised the amino acid residues corresponding to amino acid residues 199-205 in full-length ApoE. This N-terminal sequence was coupled C-terminally to a 6-aminocaproic acid linker (Acp; also denoted aminohexanoic acid linker (Ahx)), followed by a cysteine residue for the purposes of conjugation to for example keyhole limpet hemocyanin (KLH) or bovine serum albumin (BSA) as indicated. The entire immunogen sequence used was AGQPLQE-Acp-C(SEQ ID NO:55). SEQ ID NO:55 was prepared by Innovagen AB and delivered at 96.9% purity. In addition, a shorter peptide AGQPLQ-Acp-C(SEQ ID NO:51), corresponding to amino acids 199-204, was used for screening for positive clones against the neo-epitope. SEQ ID NO:51 was prepared by Innovagen AB and delivered at 96.7% purity.
[0551] Additionally, as in Examples 9 and 13, ApoE-derived peptides were prepared which incorporated the other two identified putative N-terminal neo-epitopes of the neurotoxic ApoE fragment, as well as a negative control peptide without any of the identified neo-epitopes. These peptides were LAGQPL-Acp-C(SEQ ID NO:52, prepared by Innovagen AB and delivered at 95.2% purity), GQPLQE-Acp-C(SEQ ID NO:50, prepared by Innovagen AB and delivered at 95.5% purity) and the negative control peptide AATVGSLAGQPLQER-Acp-C(SEQ ID NO:53, prepared by Innovagen AB and delivered at 97.8% purity).
[0552] Immunization: 6-8 weeks old BALB/c or C57131/6 mice were immunized with SEQ ID NO:55 conjugated to KLH. In the first injection (s.c.), the immunogen was given together with Freund's complete adjuvant. In subsequent injections (s.c.) except the last one, the immunogen was given in Freund's incomplete adjuvant. Plasma samples were collected three weeks and five weeks after the first immunization. Every mouse received between 2-3 injections. The final immunization (booster dose) was administered intraperitoneally (i.p.) without adjuvant.
[0553] Plasma screening by direct ELISA: Plasma samples were analyzed by ELISA for reactivity against the target peptide SEQ ID NO:55 conjugated to bovine serum albumin, BSA, and against the recombinant ApoE fragment A199-HIS (SEQ ID NO:58) to determine when to stop immunizations and initiate hybridoma generation. In addition, negative control peptide (SEQ ID NO:53) and ApoE 1-272 (SEQ ID NO:56) were tested for reactivity. Briefly, 96-well full area plates were coated with 1 μg/ml antigen, i.e. A199 N-terminal neo-epitope peptide (ApoE sequence 199-206 incorporated in SEQ ID NO:55) coupled to BSA, negative control peptide (ApoE sequence 192-206 incorporated in SEQ ID NO:53) coupled to BSA, or purified recombinant C-terminal ApoE fragment A199-HIS (SEQ ID NO:58) or ApoE 1-272-HIS (SEQ ID NO:56). ELISA was run according to a standard protocol and a peroxidase-conjugated goat anti-mouse IgG antibody was used as detection antibody. Only mice that responded well to immunizations and gave positive responses towards the target peptide SEQ ID NO:55 conjugated to BSA and the recombinant ApoE fragment A199-HIS (SEQ ID NO:58), and a negative response to ApoE 1-272 (SEQ ID NO:56) were considered interesting for fusion to hybridomas.
[0554] Generation of hybridomas: Two selected mice received a final booster dose of immunogen i.p. (no adjuvant) 4 days before generation of hybridomas. Generation of hybridomas was performed by fusion with Sp2/0 cells and the fused cells were plated in 96-well plates. Primary screening was performed by ELISA using BSA-conjugated peptide and ApoE fragment, and positive clones were then screened against the negative control peptide and ApoE 1-272 fragment. Supernatant from the best responders (20 clones) were characterized further for selection of clones to be processed for limiting dilution assay to ensure monoclonality. After a limiting dilution assay, unpurified supernatant was subjected to further characterization. The clones of interest were cryopreserved and expanded for production and purification of antibody (Innovagen AB) and subjected to sequencing (Absolute Antibodies).
[0555] Hybridoma screening by direct ELISA: ELISA experiments to identify hybridoma clones that produced antibodies with reactivity against the target epitope were performed according to standard protocols as described above under “Plasma screening by direct ELISA” and in the corresponding sections of Examples 9 and 13. During screening of hybridomas, and to reach monoclonality, six different antigens were used at a concentration of 1 μg/ml. These were the two A199 N-terminal neo-epitope peptides (ApoE sequence 199-205 incorporated in SEQ ID NO:55 and ApoE sequence 199-204 incorporated in SEQ ID NO:51) coupled to BSA, negative control peptide (SEQ ID NO:53) coupled to BSA, recombinant C-terminal ApoE fragment A199-HIS (SEQ ID NO:58), recombinant ApoE4 1-272 fragment (SEQ ID NO:56), and recombinant full-length ApoE4 (SEQ ID NO:45, Abcam, cat. no. ab50243).
[0556] For the hybridoma screening ELISAs, “positive” wells were selected based on positive response towards the target peptide SEQ ID NO:55 conjugated to BSA and the recombinant ApoE fragment A199-HIS (SEQ ID NO:58) and the presence of clone(s). The identified positive clones were then subjected to negative screenings using the same ELISA protocol, with negative control peptide (SEQ ID NO:53) coupled to BSA, and ApoE fragment 1-272 (SEQ ID NO:56) as coat for the plates. Supernatants from the top 20 clones that showed no binding in the negative screening were further characterized by determination of IgG concentration, by establishing concentration-response curves towards the A199 N-terminal neo-epitope peptide coupled to BSA, the recombinant ApoE fragment A199-HIS and ApoE4 full-length protein (performed as in Examples 9 and 13), and by studying human target engagement by Western blot.
[0557] Determination of IqG concentration by direct ELISA: A standard ELISA protocol was used to determine the IgG concentration in the hybridoma supernatants. To be able to measure IgG concentration, plates were coated with a 0.5 μg/ml solution of an α-mouse IgG, F(ab′).sub.2 specific antibody, and a reference antibody with a known IgG concentration was used as standard. The optical density at 450 nm was plotted against the antibody concentration to generate concentration-response curves. IgG concentrations for the hybridoma supernatants were calculated from the curve fit.
[0558] Selectivity evaluation and human target binding in Alzheimer's disease brain extracts by Western blot analysis: Western blot analysis was used to evaluate selective binding of monoclonal antibodies with affinity for the N-terminal neo-epitope of ApoE fragments 2 kDa, starting at A199, without binding to ApoE full-length protein, in a human brain extract from an Alzheimer's disease patient. The same protocol as in Examples 10 and 13 was used, and a total protein content of 60 μg in the RIPA 2% SDS brain extract was mixed with 2×Laemmli sample buffer.
[0559] Based on the result from IgG concentration, ELISA and Western blot, the top four candidate clones were subjected to at least two rounds of limiting dilution assay to ensure monoclonality, and screened for binding to the A199-HIS fragment (SEQ ID NO:58) and the target peptide SEQ ID NO:55 conjugated to BSA. Clones that still bound A199-HIS fragment and continued to grow were considered especially interesting for further characterization. Antibodies were produced from these clones and purified to generate purified monoclonal antibodies (Innovagen AB), and the clones were sent for sequencing (Absolute Antibodies).
Results
[0560] Generation of monoclonal antibodies by hybridoma technology: Antibodies that bind selectively to the N-terminal neo-epitope starting at amino acid A199 of the ApoE protein were generated by immunizations using an ApoE specific sequence consisting of the seven first amino acids following the N-terminal in the 199-299 ApoE fragment. The shortness of the immunization peptide was considered necessary in order to enable generation of antibodies that bind selectively to the N-terminal neo-epitope starting at amino acid A199 of the ApoE protein, without any binding to the linear epitope found in full-length ApoE protein. The ApoE-specific sequence peptide 199-205, conjugated to keyhole limpet haemocyanin (KLH) via an Acp linker and a cysteine residue, was used in the immunizations. The plasma samples were analyzed by ELISA for reactivity against the corresponding peptide conjugated to BSA (to avoid detecting reactivity towards KLH), and against recombinant ApoE fragment. The best responders of the immunized mice (one C57BL/6 mouse and one BALB/c mouse) were chosen for hybridoma generation.
[0561] ELISA screening for antibodies that bind selectively to the N-terminal neo-epitope of ApoE fragment starting at A199: Generated hybridoma clones were screened for reactivity towards the recombinant ApoE fragment A199-HIS, as well as reactivity towards the target peptide SEQ ID NO:55 conjugated to BSA. In addition, lack of reactivity towards recombinant full-length ApoE4, recombinant ApoE fragment 1-272-HIS, and negative control peptide SEQ ID NO:53 conjugated to BSA was evaluated. Twenty clones were identified as antibodies selective for the N-terminal neo-epitope of ApoE fragments starting at amino acid A199 and were evaluated further.
[0562] Determination of IgG concentration: The range of IgG concentration was between 2.9-26.6 μg/ml. Antibody concentration was normalized in cell medium, so that the starting concentration in ELISA experiments would be the same.
[0563] ELISA screening of top twenty antibodies that bind selectively to the N-terminal neo-epitope of ApoE fragment starting at A199: All antibodies were reactive towards the target peptide SEQ ID NO:51 conjugated to BSA and the recombinant ApoE fragment A199-HIS, but not towards recombinant full-length ApoE4. The top eight responders based on ELISA and IgG concentration were further evaluated by Western blot.
[0564] Selectivity evaluation and human target binding in Alzheimer's disease brain extracts by Western blot analysis: All antibodies were able to bind to the correct fragments in a human brain extract. Of the twenty top responders, four were chosen based on IgG concentration, direct ELISA, and binding to human target. These clones were subjected to limiting dilution assay to ensure monoclonality and continued reactivity towards the recombinant ApoE fragment A199-HIS and the target peptide SEQ ID NO:55 conjugated to BSA, but not towards recombinant full-length ApoE4. All four clones were identified as antibodies selective for the N-terminal neo-epitope of ApoE fragments starting at amino acid A199, and denoted 36A12, 38G9, 63F6 and 67G3. All were produced and purified as monoclonal antibodies and clones were sent for sequencing.
Example 17
Hybridoma Sequencing and Isotype Determination of Antibodies to the N-Terminal ApoE Fragment Neo-Epitope A199
Materials and Methods
[0565] Hybridoma sequencing: Hybridoma clones producing the monoclonal antibodies generated and characterized in Example 16, having a demonstrated selectivity for the N-terminal neo-epitope of ApoE fragment starting at amino acid A199, and a proven human target binding in brain extracts from Alzheimer's disease, were sent to Absolute Antibody for sequencing. Briefly, hybridoma sequencing was performed by whole transcriptome shotgun sequencing. The DNA and protein sequences of the mature VH and VL regions were identified.
Results
[0566] Hybridoma sequencing: Hybridoma clones with a demonstrated selectivity for the N-terminal neo-epitope of ApoE fragment starting at amino acid A199, in addition to a demonstrated binding to human target in brain extracts from Alzheimer's disease, were sequenced.
[0567] The following hybridoma clones were sequenced: 36A12, 38G9, 63F6 and 67G3. The amino acid sequences of the entire antibodies were obtained. Amino acid sequences obtained for the respective variable heavy (VH) and variable light (VL) chains are given in Table 12 below.
TABLE-US-00012 TABLE 12 Variable region sequences SEQ ID Region Antibody NO: 36A12 VH EVKLEESGGGLVQPGGSMKLSCVASGFTFSNYWMNWVRQSPEKGLE 109 WIGEIKLKSNNYGTHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGI YYCTRDTEVVAGAHWGQGTLVTVSA VL NIMMTQSPSSLAVSAGEKVTMSCKSSQSVLYNSNQKNYLAWYQQKP 110 GQSPKLLIYWASTRDSGVPDRFTGSGSGTDFTLTISSVRAEDLAVYFC QQYLSSLTFGAGTKLELK 38G9 VH EVKLEESGGGLVQPGGSMKLSCVASGFTFSNYWMNWVRQSPEKGLE 111 WVGEIKLKSNNYGTHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDT GIYYCTRDTEVVAGAHWGQGTLVTVSA VL NIMMTQSPSSLAVSAGEKVTMSCKSSQSVLYSSNQKNYLAWYQQKP 112 GQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYFC QQYLSSLTFGAGTKLELK 63F6 VH QVQLQQPGTELVKPGASVKLSCKASGYTFTNYWMHWVKQRPGQGLE 113 WIGNINPRNGGTNYNEKFKSKATLTVDKSSSTDYMQLSSLTSEDSAVY YCARGLYDYDFDYWGQGTTLTVSS VL DVLMTQTPLSLPVSLGDQASISCRSSQSIVHGNGNTYLQWFLQKPGQ 114 SPKLLIYKVSSRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQ GSHVPFTFGSGTKLEIK 67G3 VH QVQLQQPGTELVKPGASVKLSCKASGYTFTRYWLHWVKQRPGQGLE 115 WIGNINPTNGGANYNEKFKNKATLTVDKSSSTAYMQLSSLTSEDSAVY YCSRGAYDYDCDYWGQGTTLTVSS VL DVLMTQTPLSLPVSLGDQASISCRSSQRIVHSNGNIYLQWYLQKPGQS 116 PKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQG SHVPYTFGGGTKLEIK
[0568] The complementarity determining regions (CDRs) were identified using the Kabat definition for the primary VH and VL sequences and are given in Table 13 below.
TABLE-US-00013 TABLE 13 CDR region sequences Antibody CDR H1 CDR H2 CDR H3 36A12 NYWMN EIKLKSNNYGTHYAESVKG DTEVVAGAH (SEQ ID NO: 62) (SEQ ID NO: 92) (SEQ ID NO: 93) 38G9 NYWMN EIKLKSNNYGTHYAESVKG DTEVVAGAH (SEQ ID NO: 62) (SEQ ID NO: 92) (SEQ ID NO: 93) 63F6 NYWMH NINPRNGGTNYNEKFKS GLYDYDFDY (SED ID NO: 94) (SEQ ID NO: 95) (SEQ ID NO: 96) 67G3 RYWLH NINPTNGGANYNEKFKN GAYDYDCDY (SEQ ID NO: 97) (SEQ ID NO: 98) (SEQ ID NO: 99) CDR L1 CDR L2 CDR L3 36A12 KSSQSVLYNSNQKNYLA WASTRDS QQYLSSLT (SEQ ID NO: 100) (SEQ ID NO: 101) (SEQ ID NO: 102) 38G9 KSSQSVLYSSNQKNYLA WASTRES QQYLSSLT (SEQ ID NO: 103) (SEQ ID NO: 104) (SEQ ID NO: 102) 63F6 RSSQSIVHGNGNTYLQ KVSSRFS FQGSHVPFT (SEQ ID NO: 105) (SEQ ID NO: 106) (SEQ ID NO: 107) 67G3 RSSQRIVHSNGNIYLQ KVSNRFS FQGSHVPYT (SEQ ID NO: 108) (SEQ ID NO: 25) (SEQ ID NO: 28)
[0569] The antibodies were isotyped based on their sequences, and their respective sub-class and light chain are summarized in Table 14 below.
TABLE-US-00014 TABLE 14 Isotyping results Clone Sub-class Light chain 36A12 IgG1 κ 38G9 IgG1 κ 63F6 IgG2b κ 67G3 IgG2b κ
Example 18
Characterization of Purified Monoclonal Antibodies to the N-Terminal ApoE Fragment Neo-Epitope A199
[0570] This example describes the characterization of the purified monoclonal antibodies described in Examples 16 and 17 by various methods, including direct ELISA, inhibition ELISA, surface plasmon resonance and Western blot on human brain extract.
Materials and Methods
[0571] Selectivity evaluation of purified monoclonal antibodies by direct ELISA: The direct ELISA described below was used to evaluate the binding selectivity of the purified monoclonal antibodies produced in Example 17. The ability to selectively bind to the A199 N-terminal neo-epitope ApoE peptide (BSA-conjugated SEQ ID NO:51) and to the recombinant A199-HIS C-terminal ApoE fragment resulting from cleavage in the hinge region (SEQ ID NO:58) was compared with binding to the L198, G200 and negative control peptides (BSA-conjugated SEQ ID NO:52, 50 and 53, respectively), and to recombinant full-length ApoE4 (ApoE sequence aa 1-299; SEQ ID NO:45).
[0572] The screening was performed according to standard ELISA protocols. Briefly, 1 μg/ml solutions of BSA-conjugated neo-epitope peptides and negative control peptide, and 0.1 μM recombinant C-terminal ApoE fragment and full-length ApoE (Abcam, cat. no. ab50243) were prepared by dilution in PBS. 50 μl/well were added to an ELISA half-area 96 well microtiter plate, and the plate was sealed with adhesive sealer and incubated over night at 4° C. After discarding the solution, the plates were blocked with 150 μl/well of protein-free blocking solution (Pierce) for 1 h at room temperature with shake (600-900 rpm). The plates were washed four times with washing buffer containing 0.28 mM NaH.sub.2PO.sub.4, 2.5 mM Na.sub.2HPO.sub.4, 150 mM NaCl, 0.1% TWEEN®-20 and 0.0075% Kathon CG. Purified monoclonal antibodies of interest were 3-fold serially diluted with a starting dilution at 3 μg/ml (mixed 1:2 with dilution buffer (PBS with 0.1% BSA and 0.05% TWEEN®-20)). An anti-ApoE C-terminal antibody was used as a reference antibody (ApoE E-8 mouse monoclonal, Santa Cruz Biotechnology, cat. no. sc-393302). 50 μl/well were added into the ELISA plates and incubated for 2 h at room temperature with shake (600-900 rpm). The plates were washed four times as described previously. Detection antibody (HRP-conjugated anti-mouse IgG, Southern Biotech, cat. no. 1030-05, diluted 1:10000 in dilution buffer) was added 50 μl/well, and the plates were incubated for 1 h at room temperature with shake (600-900 rpm). After another wash (as described previously), 50 μl/well of K-Blue® aqueous substrate (Neogen) were added, and the reaction was stopped after 5-15 min with 50 μl/well of 0.5 M H.sub.2SO.sub.4. The optical density at 450 nm was read using an ELISA reader (Tecan). The optical density was plotted against the antibody concentration to generate concentration-response curves (
[0573] Selectivity evaluation and IC50 determination of purified monoclonal antibodies by inhibition ELISA: The inhibition ELISA described below was used to evaluate the binding strength and selectivity for the purified monoclonal antibodies described in Examples 16 and 17. The ability of the purified monoclonal antibodies to bind to the N-terminal neo-epitope of synthetic ApoE peptides starting at amino acid A199 was evaluated in comparison with their ability to bind to synthetic ApoE peptides starting at amino acids L198 and G200, as well as to the negative control peptide (aa 192-206) in solution.
[0574] In brief, the purified monoclonal antibody to be tested was allowed to interact with the N-terminal neo-epitope of synthetic ApoE peptides conjugated to BSA and starting at amino acid A199, L198 or G200, or to BSA-conjugated negative control peptide (SEQ ID NO:51, 52, 50 and 53, respectively). Thereafter, the mix was added to a microtiter plate coated with the BSA-coupled A199 synthetic ApoE peptide. If the purified monoclonal antibody binds to any of the antigens in the pre-incubation step (the synthetic ApoE peptides), the antibody is prevented from binding to the synthetic A199 ApoE peptide immobilized on the microtiter plate. This leads to inhibition of the ELISA detection signal.
[0575] 0.5 μg/ml solution of N-terminal neo-epitope peptide A199 (SEQ ID NO:51) conjugated to BSA was prepared by dilution in PBS. 50 μl/well were added to an ELISA half-area 96 well microtiter plate, the plate was sealed with adhesive sealer and incubated over night at 4° C. After discarding the solution, the plates were blocked with protein-free blocking solution (Pierce) (150 μl/well) at room temperature for 90 min with shaking (900 rpm). The blocked plate was washed four times with washing buffer containing 0.28 mM NaH.sub.2PO.sub.4, 2.5 mM Na.sub.2HPO.sub.4, 150 mM NaCl, 0.1% TWEEN®-20 and 0.0075% Kathon CG.
[0576] Serial dilutions of each synthetic ApoE peptide were prepared by 4-fold dilution starting from 10000 ng/ml in 96 well storage plates (30 μl final volume). Each purified monoclonal antibody to be tested was added (30 μl) to the serial dilutions of each of the synthetic ApoE peptides at a final concentration of 0.05 μg/ml per well. Samples were pre-incubated for 45 min at room temperature with shaking (900 rpm).
[0577] The pre-incubated samples were transferred (50 μl/well) to the blocked ELISA plates, and plates were incubated for 10 min at room temperature without shaking. Plates were washed as described above. Alkaline phosphatase conjugated anti-mouse IgG detection antibody (Mabtech, cat. no. 3310-4) was diluted 1:1000 and added to each plate (50 μl/well). The plate was sealed and incubated with shaking (900 rpm) for 45 min at room temperature and subsequently washed as described above. Alkaline phosphatase substrate (50 μl/well) was added to the plate and the optical density was read every 10 min at a wavelength of 405 nm for up to 120 min. The IC50 values were determined from a log inhibitor concentration response curve (
[0578] Selectivity evaluation and K.sub.D determination of antibodies by surface plasmon resonance: Binding interactions between the antigens and antibodies were evaluated by surface plasmon resonance (SPR) using a Biacore 8K instrument (GE Healthcare) according to standard procedures.
[0579] To determine the binding affinity of the monoclonal antibodies for N-terminal neo-epitopes compared to full-length ApoE, single-cycle kinetics experiments were conducted. The recombinant fragments were immobilized onto a CM5 Sensor Chip (GE Healthcare, cat. no. 29104988) using an amine coupling kit (GE Healthcare, cat. no. BR100050) according to the manufacturer's instructions. Reference (no immobilized antigen) and active surfaces were treated with the same conditions using the amine coupling reagents on flow cell 1 (Fc1) and flow cell 2 (Fc2) respectively. The immobilization level for the active surfaces was kept at approximately 150-200 response units (RU). The same protocol setup was used to immobilize full-length ApoE on the CM5 chip surface.
[0580] Purified antibodies were prepared in 2-fold serial dilution from 14 to 0.3 nM (in 5-7 steps). Next, the prepared serial dilution of purified antibodies was injected (30 μl/min, contact time 360 s, dissociation time 2500 s) over both flow cells of the sensor chip. The interaction series was done in triplets. Values were blank subtracted, and a bivalent analyte binding kinetics fit model was used for the evaluation.
[0581] In all SPR experiments, 1xPBS-P+(GE Healthcare, cat. no. 28995084) was used to dilute antibodies and target antigens. Experiments were performed at 25° C.
[0582] Selectivity evaluation and human target binding in Alzheimer's disease brain extracts by Western blot analysis: The Western blot analysis described below was used to evaluate selective binding of monoclonal antibodies with affinity for the N-terminal neo-epitope of ApoE fragments 2 kDa, starting at A199, without binding to ApoE full-length protein, in human brain extracts from an Alzheimer's disease patient. Fresh frozen brain tissue from the Alzheimer's disease patient was homogenized in RIPA 2% SDS extraction buffer, followed by centrifugation at 16000×g for 1 h. The subsequent supernatant was subjected to standard protein concentration determination.
[0583] RIPA 2% SDS brain extract containing approximately 60 μg total protein was mixed with 2×Laemmli sample buffer, boiled for 5 min at 95° C. and loaded onto SDS-PAGE gels (Bolt™ 12% Bis-Tris Plus 10 well, Thermo Fisher, cat. no. NW00120BOX). Gels were run for 30-40 min at 180 V, after which proteins were transferred from the gels onto nitrocellulose membranes using the Trans-Blot® Turbo™ system (Bio-Rad). Membranes were blocked in Intercept® PBS Blocking Buffer (LI-COR) for 1 h and incubated over night at room temperature with monoclonal antibodies with affinity for the N-terminal neo-epitope of ApoE fragments 2 kDa starting at A199 (2 μg/ml in Intercept® PBS Blocking Buffer (LI-COR) with 0.1% TWEEN®-20). Membranes were washed and incubated for 1 h at room temperature with the detection antibody anti-mouse-800CW (LI-COR, cat. no. 925-32210) diluted 1:25000 in Intercept® PBS Blocking Buffer (LI-COR) with 0.1% TWEEN®-20. Membranes were washed and images acquired using Odyssey® FC (LI-COR).
[0584] To confirm that the obtained bands on the Western blot membranes were of ApoE origin, the membranes were re-stained over night with a polyclonal anti-ApoE antibody (Calbiochem, cat. no. 178479; immunogen ApoE aa 1-299), diluted 1:2000 in Intercept® PBS Blocking Buffer (LI-COR) with 0.1% TWEEN®-20. Membranes were washed and incubated for 1 h at room temperature with detection antibody anti-goat-680RD (LI-COR, cat. no. 925-68074) diluted 1:25000 in Intercept® PBS Blocking Buffer (LI-COR) with 0.1% TWEEN®-20. Membranes were washed and images acquired using Odyssey® FC (LI-COR).
Results
[0585] Selectivity evaluation of purified monoclonal antibodies by direct ELISA: The four purified monoclonal antibodies 36A12, 38G9, 63F6 and 67G3 were screened for reactivity towards the BSA-conjugated peptides 198-203, 199-204 or 200-205 and the ApoE recombinant fragment aa 199-299. In addition, absence of reactivity towards recombinant full-length ApoE (ApoE4 1-299) and the negative control peptide (SEQ ID NO:53) conjugated to BSA was studied.
[0586] All purified monoclonal antibodies demonstrated strong binding to the N-terminal neo-epitope peptide A199 (SEQ ID NO:51) and to the recombinant C-terminal ApoE fragment A199-HIS (aa 199-299; SEQ ID NO:58). At the highest concentration of antibody, antibodies 63F6 and 67G3 showed some binding to the negative control peptide (SEQ ID NO:53), and the 200-205 BSA-conjugated peptide (SEQ ID NO:50) (
[0587] As expected, the reference antibody directed to the ApoE C-terminal could detect and bind both the recombinant A199 fragment (aa 199-299) and the recombinant ApoE4 full-length protein (aa 1-299). Also as expected, because the epitope for the reference antibody is ApoE aa 274-299, no binding to the A199-BSA peptide was detected (
[0588] Selectivity evaluation and IC50 determination of purified monoclonal antibodies by inhibition ELISA: The four purified monoclonal antibodies 36A12, 38G9, 63F6 and 67G3 were screened for binding strength and binding selectivity towards the N-terminal neo-epitope peptide A199-BSA (aa 199-204). In addition, antibodies were screened for lack of reactivity towards BSA-conjugated peptides 198-203, 200-205 and the negative control peptide 192-206.
[0589] All purified monoclonal antibodies demonstrated strong binding and selectivity for the A199-BSA peptide (aa 199-204), whereas there was no binding to 198-203, 200-205 or negative control BSA-conjugated peptides (
TABLE-US-00015 TABLE 15 Summary of results from direct ELISA and inhibition ELISA of purified monoclonal anti-A199 antibodies EC50 (ng/ml) IC50 (ng/ml) A199-BSA A199-HIS A199-BSA Clone peptide fragment peptide 36A12 5.1 20.2 27.7 38G9 4.6 39.7 52.6 63F6 3.8 1.8 2.5 67G3 4.4 3.5 2.9
[0590] Selectivity evaluation and K.sub.D determination of purified monoclonal antibodies by surface plasmon resonance: The four purified monoclonal antibodies 36A12, 38G9, 63F6 and 67G3 were evaluated for selectivity, and K.sub.D values for the target antigen were determined by surface plasmon resonance.
[0591] All purified monoclonal antibodies demonstrated binding to the A199-HIS fragment (
TABLE-US-00016 TABLE 16 Summary of results from surface plasmon resonance of purified monoclonal anti-A199 antibodies Biacore: A199-HIS fragment ka kd K.sub.D Clone (×10.sup.5 1/Ms) (×10.sup.−4 1/s) (nM) 36A12 34.0 3.4 10 38G9 944 25 1450 63F6 1.5 207 137 67G3 1.8 172 83
[0592] Selectivity evaluation and human target binding in Alzheimer's disease brain extracts by Western blot analysis: The monoclonal antibodies selective for the N-terminal neo-epitope of ApoE fragments starting at amino acid A199 (36A12, 38G9, 63F6 and 67G3) were tested for their ability to bind selectively to ApoE fragments 2 kDa in human brain extracts from an Alzheimer's disease patient, and without any binding to full-length ApoE. Western blot analysis demonstrated binding of all of the monoclonal antibodies to two ApoE fragments approximately 12 kDa and 10 kDa in size, without any visual binding to full-length ApoE (
SEQUENCE LISTING
[0593] Table 17 below lists the sequences referred to in this application.
TABLE-US-00017 SEQ Description/ ID NO: occurrence Sequence 1 ApoE 200-299 GQPLQERAQAWGERLRARMEEMGSRTRDRLDEV KEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFE PLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH 2 ApoE 199-299 AGQPLQERAQAWGERLRARMEEMGSRTRDRLDE VKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWF EPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDN H 3 ApoE 198-299 LAGQPLQERAQAWGERLRARMEEMGSRTRDRLD EVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSW FEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDN H 4 Hexamer ag 198 LAGQPL 5 Hexamer ag 199 AGQPLQ 6 Hexamer ag 200 GQPLQE 7 Heptamer ag 198 LAGQPLQ 8 Heptamer ag 199 AGQPLQE 9 Octamer ag 198 LAGQPLQE 10-23 G200 HC CDRs Table 4 24-33 G200/A199 LC Tables 4 and 13 CDRs 34-44 G200 VH and VL Table 3 45 Human ApoE4 KVEQAVETEPEPELRQQTEWQSGQRWELALGRF WDYLRWVQTLSEQVQEELLSSQVTQELRALMDET MKELKAYKSELEEQLTPVAEETRARLSKELQAAQA RLGADMEDVRGRLVQYRGEVQAMLGQSTEELRV RLASHLRKLRKRLLRDADDLQKRLAVYQAGAREG AERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQ ERAQAWGERLRARMEEMGSRTRDRLDEVKEQVA EVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVED MQRQWAGLVEKVQAAVGTSAAPVPSDNH 46 158-233 of FL RLAVYQAGAREGAERGLSAIRERLGPLVEQGRVR ApoE AATVGSLAGQPLQERAQAWGERLRARMEEMGSR TRDRLDEVK 47 200-233 of FL GQPLQERAQAWGERLRARMEEMGSRTRDRLDEV ApoE K GQPLQERAQAWGERLRARMEEMGSRTRDRLDEV 48 200-299-10xHIS KEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFE PLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH HHHHHHHHHH 49 10xHIS-ApoE4- HHHHHHHHHHKVEQAVETEPEPELRQQTEWQSG FL QRWELALGRFWDYLRWVQTLSEQVQEELLSSQVT QELRALMDETMKELKAYKSELEEQLTPVAEETRAR LSKELQAAQARLGADMEDVRGRLVQYRGEVQAML GQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAV YQAGAREGAERGLSAIRERLGPLVEQGRVRAATV GSLAGQPLQERAQAWGERLRARMEEMGSRTRDR LDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKS WFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPS DNH 50 G200 GQPLQE-Acp-C immunogen 51 A199 AGQPLQ-Acp-C immunogen 52 L198 immunogen LAGQPL-Acp-C 53 Neg ctrl peptide AATVGSLAGQPLQER-Acp-C 54 L198 new imm LAGQPLQE-Acp-C 55 A199 new imm AGQPLQE-Acp-C 56 10xHIS-ApoE4- HHHHHHHHHHKVEQAVETEPEPELRQQTEWQSG 1-272 QRWELALGRFWDYLRWVQTLSEQVQEELLSSQVT QELRALMDETMKELKAYKSELEEQLTPVAEETRAR LSKELQAAQARLGADMEDVRGRLVQYRGEVQAML GQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAV YQAGAREGAERGLSAIRERLGPLVEQGRVRAATV GSLAGQPLQERAQAWGERLRARMEEMGSRTRDR LDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKS WFEPLVEDM LAGQPLQERAQAWGERLRARMEEMGSRTRDRLD 57 198-299-10xHIS EVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSW FEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDN HHHHHHHHHHH AGQPLQERAQAWGERLRARMEEMGSRTRDRLDE 58 199-299-10xHIS VKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWF EPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDN HHHHHHHHHHH 59-70 L198/A199 HC Tables 8 and 13 CDRs 71-81 L198 LC CDRs Table 8 82-91 L198 VH and VL Table 7 92-99 A199 HC CDRs Table 13 100-108 A199 LC CDRs Table 13 109-116 A199 VH and VL Table 12