Methods and compositions for treating obesity and/or diabetes and for identifying candidate treatment agents
11376242 · 2022-07-05
Assignee
Inventors
Cpc classification
G01N2800/042
PHYSICS
A61K31/44
HUMAN NECESSITIES
A61K9/0019
HUMAN NECESSITIES
G01N2800/044
PHYSICS
A61P1/16
HUMAN NECESSITIES
International classification
A61K9/00
HUMAN NECESSITIES
G01N33/50
PHYSICS
A61P1/16
HUMAN NECESSITIES
A61K31/44
HUMAN NECESSITIES
Abstract
Provided are methods and compositions for identifying candidate agents for treatment of obesity, liver disease, and/or diabetes. Such methods include, e.g., contacting a mammalian cell or cell population with a test agent, and measuring an expression level and/or activity level of ClpP in the mammalian cell or in cells of the cell population. Also provided are methods and compositions for treating an individual (e.g., one who is obese and/or has diabetes). Treatment methods include administering an inhibitor of ClpP to the individual (e.g., to prevent or reduce weight gain, to increase insulin sensitivity, and/or to increase glucose tolerance).
Claims
1. A method of identifying a candidate agent for treating obesity, liver disease, and/or diabetes, the method comprising: (a) obtaining an expression level and/or activity level of ClpP in a sample of mammalian cells derived from a subject to obtain a reference value; (b) contacting a sample of cells from said subject of (a) with a test agent; (c) measuring an expression level and/or activity level of ClpP in the sample of cells of (b) following the contacting; (d) determining that the test agent caused a decrease in the expression level and/or activity level of ClpP in the sample of cells of (b) as compared to the reference value of (a); and (e) administering to said subject a composition comprising the test agent, wherein the test agent is an inhibitor of ClpP, wherein the test agent is a β-Lactone.
2. The method according to claim 1, wherein the mammalian cell is a mouse cell.
3. The method according to claim 1, wherein the mammalian cell is a human cell.
4. The method according to claim 1, wherein the mammalian cell is in vitro.
5. The method according to claim 1, wherein the mammalian cell is ex vivo.
6. The method according to claim 1, wherein the mammalian cell is in vivo.
7. The method according to claim 1, wherein the mammalian cell is a hepatocyte.
8. The method according to claim 1, further comprising, after administering the identified candidate agent to the individual, measuring one or more features of the individual selected from: insulin sensitivity, blood glucose level, glucose tolerance, body fat mass, an amount of fat tissue, an amount of white adipose tissue; percent fat mass, body weight, visceral adipose adipocyte size, plasma leptin level, growth hormone level, basal energy expenditure, a level of phosphorylated AKT (p-AKT) in muscles and/or fibroblasts, percent lean mass, mitochondrial number in hepatocytes, mitochondrial mass in hepatocytes, mitochondrial morphology in hepatocytes, fibroblast respiratory capacity, fibroblast maximal oxygen consumption rate (OCR), and fibroblast resistance to H.sub.2O.sub.2-induced cytotoxicity.
9. The method according to claim 1, comprising measuring an expression level of ClpP, wherein the expression level is an RNA expression level and the measuring comprises the use of quantitative RT-PCR, a microarray, or RNA sequencing.
10. The method according to claim 1, comprising measuring an expression level of ClpP, wherein the expression level is a protein expression level and the measuring comprises detecting ClpP protein using an anti-ClpP antibody, mass spectrometry, and/or an enzymelinked immunosorbent assay (ELISA) assay.
11. The method of claim 1, wherein the expression level and/or activity level is reduced by 10% or more compared to the reference value.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) The invention is best understood from the following detailed description when read in conjunction with the accompanying drawings. It is emphasized that, according to common practice, the various features of the drawings are not to-scale. On the contrary, the dimensions of the various features are arbitrarily expanded or reduced for clarity. Included in the drawings are the following figures.
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
(36)
(37)
DETAILED DESCRIPTION
(38) Provided are methods and compositions for identifying candidate agents for the treatment of obesity, liver disease, and/or diabetes. In some embodiments, such methods include (a) contacting a mammalian cell or cell population with a test agent, and (b) measuring an expression level (e.g., protein and/or mRNA) and/or activity level of ClpP in the mammalian cell (the agent-contacted cell) or in cells of the agent-contacted cell population. If the compound (the test agent) reduces ClpP expression (e.g., as can be show by measuring levels of ClpP protein and/or ClpP-encoding mRNA) and/or activity level, it is then considered to be a “candidate agent” (e.g., a candidate agent for treatment). Also provided are methods and compositions for treating an individual (e.g., one who is obese and/or has diabetes or who has been diagnosed as such). Treatment methods include administering an inhibitor of ClpP (e.g., an RNAi agent or a gene editing agent that targets ClpP) to the individual (e.g., to prevent or reduce weight gain, to increase insulin sensitivity, and/or to increase glucose tolerance).
(39) Before the present methods and compositions are described, it is to be understood that this invention is not limited to the particular methods or compositions described, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.
(40) Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limits of that range is also specifically disclosed. Each smaller range between any stated value or intervening value in a stated range and any other stated or intervening value in that stated range is encompassed within the invention. The upper and lower limits of these smaller ranges may independently be included or excluded in the range, and each range where either, neither or both limits are included in the smaller ranges is also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the invention.
(41) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, some potential and preferred methods and materials are now described. All publications mentioned herein are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited. It is understood that the present disclosure supersedes any disclosure of an incorporated publication to the extent there is a contradiction.
(42) As will be apparent to those of skill in the art upon reading this disclosure, each of the individual embodiments described and illustrated herein has discrete components and features which may be readily separated from or combined with the features of any of the other several embodiments without departing from the scope or spirit of the present invention. Any recited method can be carried out in the order of events recited or in any other order that is logically possible.
(43) It must be noted that as used herein and in the appended claims, the singular forms “a”, “an”, and “the” include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to “a cell” includes a plurality of such cells and reference to “the peptide” includes reference to one or more peptides and equivalents thereof, e.g., polypeptides, known to those skilled in the art, and so forth.
(44) The publications discussed herein are provided solely for their disclosure prior to the filing date of the present application. Nothing herein is to be construed as an admission that the present invention is not entitled to antedate such publication. Further, the dates of publication provided may be different from the actual publication dates which may need to be independently confirmed.
(45) ClpP Protein
(46) Mammalian ClpXP is a protein complex (a protease) that has a catalytic subunit (the ClpP protein) and a regulatory subunit (the ClpX protein). As described herein, it has been discovered that the ClpP protein plays an important biological role in mitochondrial function in mammalian cells, and that altering the expression/function of ClpP has wide-ranging physiological consequences.
(47) The wild type mouse and human ClpP protein amino acid sequences (and their encoding mRNAs) are depicted here.
(48) TABLE-US-00001 Wild type human ClpP (NP_006003.1) *also known as “caseinolytic mitochondrial matrix peptidase proteolytic subunit”, DFNB81, and PRLTS3 (SEQ ID NO: 1) MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHAT ATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFL QSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLL AAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHT KQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVE AAPAAEPVPAST DNA version of the mRNA encoding human ClpP (above) (NM_006012.2) *ORF is underlined (SEQ ID NO: 3) CCTTAATGGCGCCCGCCCAGACTCCTGGAAGTGAGCGGCCTAGCGAGCG AGCTCCCAGGCGCAAAGCACGCCGGAAGCTGTAGTTCCGCCATCGGACG GAAGCCGACCGGGGCGTGCGGAGGGATGTGGCCCGGAATATTGGTAGG GGGGGCCCGGGTGGCGTCATGCAGGTACCCCGCGCTGGGGCCTCGCCT CGCCGCTCACTTTCCAGCGCAGCGGCCGCCGCAGCGGACACTCCAGAAC GGCCTGGCCCTGCAGCGGTGCCTGCACGCGACGGCGACCCGGGCTCTC CCGCTCATTCCCATCGTGGTGGAGCAGACGGGTCGCGGCGAGCGCGCCT ATGACATCTACTCGCGGCTGCTGCGGGAGCGCATCGTGTGCGTCATGGG CCCGATCGATGACAGCGTTGCCAGCCTTGTTATCGCACAGCTCCTCTTCC TGCAATCCGAGAGCAACAAGAAGCCCATCCACATGTACATCAACAGCCCT GGTGGTGTGGTGACCGCGGGCCTGGCCATCTACGACACGATGCAGTACA TCCTCAACCCGATCTGCACCTGGTGCGTGGGCCAGGCCGCCAGCATGGG CTCCCTGCTTCTCGCCGCCGGCACCCCAGGCATGCGCCACTCGCTCCCC AACTCCCGTATCATGATCCACCAGCCCTCAGGAGGCGCCCGGGGCCAAG CCACAGACATTGCCATCCAGGCAGAGGAGATCATGAAGCTCAAGAAGCAG CTCTATAACATCTACGCCAAGCACACCAAACAGAGCCTGCAGGTGATCGA GTCCGCCATGGAGAGGGACCGCTACATGAGCCCCATGGAGGCCCAGGA GTTTGGCATCTTAGACAAGGTTCTGGTCCACCCTCCCCAGGACGGTGAGG ATGAGCCCACGCTGGTGCAGAAGGAGCCTGTAGAAGCAGCGCCGGCAGC AGAACCTGTCCCAGCTAGCACCTGAGAGCTGGGCCTCCTCTCCAGAATCA TGTGGAGGGGCCAGAGGCCTGCCAGACCCCCAGCTGGGCCCTGCTCAC CCCTTGTTGCTGGGCTTGGAGGGGCCTCTTGAGGAACTTTTAATTTGCAG GGGTGCCCGCTATGGACGGGGCATTCCAGCTGAGACACTGTGATTTTAAA TTAAATCTTTGTGGTCTTTGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAA Wild type mouse ClpP (NP_059089.1) *also known as “caseinolytic mitochondrial matrix peptidase proteolytic subunit”, AU019820, and D17Wsu160e (SEQ ID NO: 2) MWPRVLLGEARVAVDGCRALLSRLAVHFSPPWTAVSCSPLRRSLHGTATRA FPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSES NKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGS PGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSL QVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPELVQKETATAPTD PPAPTST DNA version of the mRNA encoding mouse ClpP (above) (NM_017393.2) *ORF is underlined (SEQ ID NO: 4) AGTGACTCCCGCAAAGCACGCCGGGTGTTGTAGTTCCGGAAGCCAAGCC GGAGTGCGCGTCGTCATGTGGCCCAGAGTGCTGCTGGGGGAGGCCCGG GTGGCTGTGGACGGATGTCGCGCTCTGTTGTCTCGCCTTGCCGTGCATTT CTCCCCGCCATGGACTGCTGTGAGCTGCTCACCCCTGCGGAGGAGCCTG CATGGAACTGCGACGCGAGCTTTCCCGCTCATCCCCATAGTGGTGGAGC AGACGGGTCGAGGCGAGCGCGCTTATGACATATACTCGAGGCTGTTGCG GGAACGCATCGTGTGCGTCATGGGCCCGATTGACGACAGTGTGGCCAGT CTGGTCATTGCCCAGCTGTTGTTCTTACAGTCTGAAAGCAACAAGAAGCC CATTCATATGTATATCAACAGCCCAGGTGGTGTGGTAACTGCGGGCCTGG CCATCTACGACACAATGCAGTACATCCTGAACCCCATCTGCACGTGGTGT GTTGGACAGGCTGCCAGCATGGGCTCCCTGCTCCTCGCTGCTGGCAGCC CGGGCATGCGCCATTCACTGCCCAATTCCAGAATCATGATCCACCAGCCC TCTGGAGGAGCCAGGGGCCAAGCCACAGACATCGCCATCCAGGCAGAGG AAATCATGAAGCTGAAAAAGCAGCTATACAACATCTACGCCAAACACACCA AGCAGAGCCTACAGGTGATCGAGTCAGCAATGGAGAGGGACCGCTACAT GAGCCCCATGGAGGCCCAAGAGTTTGGCATCTTGGACAAGGTCTTGGTC CACCCACCTCAGGACGGGGAGGATGAGCCAGAACTGGTACAGAAGGAGA CTGCCACAGCGCCGACGGATCCTCCTGCCCCGACAAGCACCTAAGGAGT GGAGACCAGACTGAAACTTCCTCTGCTGGGCCCAAGAACAACCCCTAGAG GAGATGTGGATTGAGGTTGCCCTCAGAGCAGGGCAGACTGCCTGAGACA CTGTGATTTAAATTAAATCTTTGTAGTCTTTGTCCCATGTCTGAAGCACCTT CCATTACTTCTCCAAGACAGCAGGCCTCCTTCACCTTGACAAACCACTTCA GTAAGCAAACCCTGGCTCTCCTGGAACTAAACCAATCTAGCCTCAGACTC AGGTACCCACCTGCCTCACCTCCTGAGTGCTAGGATTAAAGGTGTACACC ACCACACCTGACTTCAA
Screening Methods
(49) Provided are screening methods for identifying candidate agents for treating obesity, liver disease, and/or diabetes. By way of example, such candidate agents may include candidate agents for decreasing an amount of fat tissue in an individual, preventing or reducing weight gain of an individual, increasing insulin sensitivity of an individual, and/or increasing glucose tolerance of an individual. In some embodiments, screening methods provided herein include (a) contacting a mammalian cell or cell population (e.g., a mouse cell, a rat cell, a non-human primate cell, a human cell, or a cell population thereof) with a test agent, and (b) measuring an expression level and/or activity level of ClpP (e.g., a protein and/or mRNA expression level or an activity level of ClpP) in the mammalian cell (the agent-contacted cell) or in cells of the agent-contacted cell population to determine whether the test agent caused a reduction of ClpP expression and/or activity level in the cell or cells of the cell population.
(50) Test agents that reduce ClpP expression (e.g., protein and/or mRNA) and/or activity level, can be identified as candidate agents for use in the treatment of obesity, liver disease, and/or diabetes. Thus, a compound is considered to be a “test agent” prior to contact with a cell or cell population (e.g., in vitro, ex vivo, or in vivo), and if the compound (the test agent) reduces ClpP expression (e.g., as can be show by measuring levels of ClpP protein and/or ClpP-encoding mRNA) and/or activity level, it is then considered to be a “candidate agent” (e.g., a candidate agent for the treatment of diseases in which ClpP reduction is beneficial, such as obesity, liver disease, and/or diabetes). Thus, the provided screening methods can also be referred to as methods of identifying an inhibitor of ClpP, methods of identifying an agent that reduces ClpP expression and/or activity level, methods of identifying an inhibitor of ClpP expression and/or activity level, and the like.
(51) In some embodiments, a subject method (e.g., a method as described above) includes (a) contacting a mammalian cell (e.g., a mouse cell, a rat cell, a non-human primate cell, a human cell) with a test agent; (b) measuring a decrease in the expression level and/or activity level of ClpP caused by the contacting step (e.g., relative to a reference value, e.g., an expression level and/or activity level of ClpP prior to contact with the test agent, an expression level and/or activity level of ClpP after contact with a control agent that is known not to reduce ClpP expression, and the like); (c) determining that the test agent caused a decrease in the expression level and/or activity level relative to the reference value; and (d) identifying the test agent as a candidate agent for treating obesity, liver disease, and/or diabetes.
(52) In some cases, the contacting is in vitro (e.g., the cell is in culture and is contacted in vitro). In some cases, the contacting is ex vivo (e.g., the cell is in culture and is a primary cell isolated from an individual).
(53) A subject screening method includes a step of contacting a cell (or cell population) with a test agent. When a test agent reduces a ClpP expression level (e.g., at the level of ClpP protein or mRNA encoding the ClpP protein) and/or activity level, that agent is determined to be a candidate agent (e.g., for treating obesity, liver disease, and/or diabetes). Thus, the contacting will generally be for a period of time such that a change in an expression level and/or activity level of ClpP (e.g., protein and/or mRNA expression level) can potentially be detected. In other words, the period of contact will be for a suitable period of time after which one may reasonably expect that if a test agent is in fact a candidate agent for treatment, a change in ClpP expression and/or activity level will be detectable. In some cases, the contacting is for a period of time of 2 or more minutes (e.g., 5 or more minutes, 10 or more minutes, 15 or more minutes, 30 or more minutes, 1 or more hours, 2 or more hours, 5 or more hours, 6 or more hours, 12 or more hours 18 or more hours, etc.). In some cases, the contacting is for a period in a range of from 2 minutes to 48 hours (e.g., 5 minutes to 24 hours, 5 minutes to 6 hours, 5 minutes to 2 hours, 15 minutes to 24 hours, 15 minutes to 6 hours, 15 minutes to 2 hours, 1 hour to 24 hours, 1 hour to 6 hours, or 1 hour to 2 hours).
(54) In some cases, the contacting is in vivo. For example, in some cases, a subject method (e.g., a screening method) includes a step of administering an agent (e.g., a test agent or a candidate agent) to an individual. A step of administering can serve a number of different purposes. For example, in some cases a subject method includes a step of administering a test agent to an individual (e.g., a mouse or a rat), and then measuring an expression level and/or activity level of ClpP in order to determine whether the test agent is a candidate agent for treatment. Such administration can be performed as part of the screen for identifying those test agents that are candidate agents for treatment.
(55) As another example, in some cases a subject method (e.g., a screening method) includes a step of administering a candidate agent (i.e., an agent that has already been determined to reduce an expression level and/or activity level of ClpP, e.g., using a subject method and contacting a cell in vitro, ex vivo, or in vivo). Such administration can be performed as a treatment step, or for example, in order to determine whether the candidate agent causes a measurable change in features associated with obesity, liver disease, and/or diabetes (e.g., decrease in an amount of fat tissue, prevention or reduction of weight gain, increase in insulin sensitivity, increase in glucose tolerance, and the like).
(56) Target Cells
(57) Any suitable mammalian cell or cell population can be used in the provided screening methods as a target cell or cell population (i.e., a cell or cell population that is contacted with a test agent). For example, in some cases, the target cell or cell population (the cell or cell population contacted with the test agent) is a mammalian cell, a rodent cell (e.g., a mouse cell, a rat cell), a rabbit cell, a non-human primate cell, a human cell, etc. As noted above, the target cell or cell population can be in vitro (e.g., from an establish cell line), ex vivo (e.g., primary cells), or in vivo. The target cell can be any suitable type of cell (e.g., a stem cell, a progenitor cell, an adipocyte, a neuron, a cell of the pancreas, a fibroblast, an epithelial cells, a kidney cell, an embryonic cell, and the like), and in some cases, the contacted cell (the target cell) is a hepatocyte.
(58) Examples of suitable mammalian cells for the subject screening methods include, but are not limited to: monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary cells/-DHFR(CHO, Urlaub et al., Proc. Natl. Acad. Sci. USA 77:4216 (1980)); mouse sertoli cells (TM4, Mather, Biol. Reprod. 23:243-251 (1980)); monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1587); human cervical carcinoma cells (HELA, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TR1 cells (Mather et al., Annals N.Y. Acad. Sci. 383:44-68 (1.982)); MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2).
(59) Test Agents
(60) A “test agent” (e.g., “test compound”) to be used in the provided screening methods can be any suitable agent (e.g., including, but not limited to, organic molecules, small molecules, polynucleotides, RNA, DNA, proteins, antibodies, peptides, lipids, carbohydrates, and the like). A test agent can also be a mixture of chemical compounds. In some cases, an array of spatially localized test agents can be used (e.g., a peptide array, polynucleotide array, and/or combinatorial small molecule array; where “array” refers to a collection of different molecular species immobilized on a surface). In some cases, a small molecule library is screened (i.e., a test agent can be a member of a small molecule library). Test agents can be biological macromolecules, can be part of a bacteriophage peptide display library, can be part of a bacteriophage antibody (e.g., scFv) display library, a polysome peptide display library, and the like. A test agent can be an extract made from biological materials such as bacteria, plants, fungi, or animal (e.g., mammalian) cells and/or tissues. As provided in the subject screening methods, test agents are evaluated for potential activity as agents for treating obesity, liver disease, and/or diabetes (e.g., candidate agents for decreasing an amount of fat tissue in an individual, preventing or reducing weight gain of an individual, increasing insulin sensitivity of an individual, and/or increasing glucose tolerance of an individual). In some cases, a subject method is for screening a plurality of test agents. Test agents can be evaluated (screened) individually (sequentially), or in parallel.
(61) In some cases, a test agent (e.g., a test compound) can have a formula weight of less than 10,000 grams per mole (e.g., less than 5,000 grams per mole, less than 1,000 grams per mole, or less than 500 grams per mole). A test agent can be naturally occurring (e.g., an herb or a natural product), synthetic, or can include both natural and synthetic components. Examples of small molecules include peptides, peptidomimetics (e.g., peptoids), amino acids, amino acid analogs, polynucleotides, polynucleotide analogs, nucleotides, nucleotide analogs, and small molecules, such as organic or inorganic compounds, e.g., heteroorganic or organometallic compounds.
(62) ClpP Expression Level and/or Activity Level
(63) In some cases, a subject screening method includes a step of measuring a ClpP expression level and/or activity level. Because reduction of ClpP mRNA can result in reduced ClpP protein level, either assay (one to measure ClpP-encoding mRNA or one to measure ClpP protein) can be used for measuring an expression level. For example, in some cases, a test agent that reduces the level of ClpP protein in the target cell (or in cells of the target cell population) will be identified as a candidate agent for use in treating obesity, liver disease, and/or diabetes. In some cases, a test agent that reduces the level of ClpP-encoding mRNA in the target cell (or in cells of the target cell population) will be identified as a candidate agent for use in treating obesity, liver disease, and/or diabetes.
(64) The terms “assaying” and “measuring” are used herein to include the physical steps of manipulating a biological sample (e.g., cell sample) to generate data related to the sample (e.g., measuring an expression level and/or activity level in a biological sample). In practicing the subject methods, the expression level of a ClpP expression product (e.g., mRNA or protein) and/or an activity level of ClpP can be measured. The expression level may be the expression level in a cell, in a population of cells, in a biological sample from an individual, and the like. The expression level(s) and/or activity level(s) can be measured by any suitable method. For example, an RNA expression level can be measured by measuring the levels/amounts of one or more nucleic acid transcripts, e.g. mRNAs, of ClpP. Protein expression levels of ClpP can be detected by measuring the levels/amounts of the ClpP protein.
(65) “Measuring” can be used to determine whether the measured expression level and/or activity level is less than, greater than, “less than or equal to”, or “greater than or equal to” a particular threshold, (the threshold can be pre-determined or can be determined by assaying a control sample). On the other hand, “measuring to determine the expression level” (and/or activity level) or simply “measuring expression levels” (and/or activity levels) can mean determining a quantitative value (using any suitable metric) that represents the level of expression (e.g., the amount of protein and/or RNA, e.g., mRNA) of a particular expression product (e.g., a ClpP expression product) and/or the activity level of ClpP. The level of expression and/or activity can be expressed in arbitrary units associated with a particular assay (e.g., fluorescence units, e.g., mean fluorescence intensity (MFI), threshold cycle (C.sub.t), quantification cycle (C.sub.q), and the like), or can be expressed as an absolute value with defined units (e.g., number of mRNA transcripts, number of protein molecules, concentration of protein, amount of substrate cleaved, etc.).
(66) An expression level and/or activity level can be a raw measured value, or can be a normalized and/or weighted value derived from the raw measured value. The terms “expression level” and “measured expression level” are used herein to encompass raw measured values as well as values that have been manipulated in some way (e.g., normalized and/or weighted). In some cases, a normalized expression level and/or activity level is a measured expression level of an expression product and/or an activity level from a sample where the raw measured value for the expression product and/or activity level has been normalized. For example, the expression level of an expression product (e.g., an RNA encoding ClpP, a ClpP protein) can be compared to the expression level of one or more other expression products (e.g., the expression level of a housekeeping gene, the averaged expression levels of multiple genes, etc.) to derive a normalized value that represents a normalized expression level. Methods of normalization will be known to one of ordinary skill in the art and any suitable normalization method can be used. The specific metric (or units) chosen is not crucial as long as the same units are used (or conversion to the same units is performed) when evaluating multiple markers and/or multiple biological samples (e.g., samples from multiple individuals or multiple samples from the same individual).
(67) A reduction of a ClpP expression level and/or activity level can be determined in a number of different ways. For example, in some cases, a ClpP expression level and/or activity level is measured in a cell (or in an individual, e.g., in a biological sample from the individual) prior to and after contact with a test agent (or prior to and after administration of an agent to an individual), and a determination is made as to whether a reduction was caused by the contacting (or the administration). In some cases, some cells of a cell population are not contacted with an agent (e.g., a test agent) and other cells of the cell population are contacted with an agent (e.g., a test agent) and a comparison can be made among the contacted and non-contacted cells. In some cases, some cells of a cell population are not contacted with an agent (e.g., a test agent) and other cells of the cell population are contacted with a mock agent (e.g., an agent known not to cause a change) and a comparison can be made among the cells contacted with the test agent and those (control cells) contacted with the mock agent (control agent).
(68) Such comparisons can generally be referred to as comparing a measured value to a reference value, or determining that an agent caused a reduction in a ClpP expression level and/or activity level as compared to a reference value. A reference value can be a level of ClpP (protein and/or mRNA) and/or activity level of ClpP measured prior to contact with an agent, a level of ClpP (protein and/or mRNA) and/or activity level of ClpP measured after contact with a mock agent (control agent), a level of ClpP (protein and/or mRNA) and/or activity level of ClpP measured in the absence of contact with an agent, etc. A reference value can also be in some cases a pre-determined (threshold) value.
(69) In some cases, a subject method includes determining that a test agent or a candidate agent caused a decrease in the expression level and/or activity level of ClpP. In some cases, the expression level and/or activity level is reduced by 10% or more (e.g., 20% or more, 30% or more, 40% or more, 50% or more, 60% or more, 70% or more, 80% or more, or 90% or more) compared to a reference value (e.g., an activity level and/or expression level, e.g., of ClpP protein and/or mRNA, prior to contact with the agent; an activity level and/or expression level, e.g., of ClpP protein and/or mRNA, in mock-treated cells or in mock-treated control individuals; etc.). In some cases, the measured expression level and/or activity level is 95% of a reference value or less (e.g., 90% of the reference value or less, 85% of the reference value or less, 80% of the reference value or less, 75% of the reference value or less, 70% of the reference value or less, 65% of the reference value or less, 60% of the reference value or less, 55% of the reference value or less, 50% of the reference value or less, 45% of the reference value or less, 40% of the reference value or less, 35% of the reference value or less, 30% of the reference value or less, 25% of the reference value or less, 20% of the reference value or less, 15% of the reference value or less, 10% of the reference value or less, or 5% of the reference value or less). In some cases, the reference value of the expression level and/or activity level of ClpP is 1.1-fold or more (e.g., 1.2-fold or more, 1.3-fold or more, 1.4-fold or more, 1.5-fold or more, 2-fold or more, 2.5-fold or more, 3-fold or more, 4-fold or more, 5-fold or more, 7.5-fold or more, or 10-fold or more) greater than the measured value.
(70) Measuring RNA
(71) An expression level of an expression product of ClpP may be measured by detecting the amount or level of one or more RNA transcripts or a fragment thereof encoded by the gene of interest (ClpP). Such detection may include detecting the level of one or more RNA transcripts or a fragment thereof encoded by the ClpP gene in a cell extract, in a fixed cell, in a living cell, in a biological sample, etc. For measuring RNA levels, the amount or level of an RNA in the sample is determined, e.g., the expression level of an mRNA. In some instances, the expression level of one or more additional RNAs may also be measured, and the level of ClpP RNA expression compared to the level of the one or more additional RNAs to provide a normalized value for the ClpP expression level.
(72) The expression level of nucleic acids in a sample (e.g., the expression level of a ClpP mRNA) may be detected using any suitable protocol. A number of exemplary methods for measuring RNA (e.g., mRNA) expression levels in a sample are known by one of ordinary skill in the art, such as those methods employed in the field of differential gene expression analysis, and any suitable method can be used. Exemplary methods include, but are not limited to: hybridization-based methods (e.g., Northern blotting, array hybridization (e.g., microarray); in situ hybridization; in situ hybridization followed by FACS; and the like) (Parker & Barnes, Methods in Molecular Biology 106:247-283 (1999)); RNAse protection assays (Hod, Biotechniques 13:852-854 (1992)); PCR-based methods (e.g., reverse transcription PCR (RT-PCR), quantitative RT-PCR (qRT-PCR), real-time RT-PCR, etc.) (Weis et al., Trends in Genetics 8:263-264 (1992)); nucleic acid sequencing methods (e.g., Sanger sequencing, Next Generation sequencing (i.e., massive parallel high throughput sequencing, e.g., Illumina's reversible terminator method, Roche's pyrosequencing method (454), Life Technologies' sequencing by ligation (the SOLiD platform), Life Technologies' Ion Torrent platform, single molecule sequencing, etc.); nanopore based sequencing methods; and the like.
(73) In some embodiments, the biological sample can be assayed directly. In some embodiments, nucleic acid of the biological sample is amplified (e.g., by PCR) prior to assaying. As such, techniques such as PCR (Polymerase Chain Reaction), RT-PCR (reverse transcriptase PCR), qRT-PCR (quantitative RT-PCR, real time RT-PCR), etc. can be used prior to the hybridization methods and/or the sequencing methods discussed above.
(74) Examples of some of the methods listed above are described in the following references: Margulies et al (Nature 2005 437: 376-80); Ronaghi et al (Analytical Biochemistry 1996 242: 84-9); Shendure (Science 2005 309: 1728); Imelfort et al (Brief Bioinform. 2009 10:609-18); Fox et al (Methods Mol Biol. 2009; 553:79-108); Appleby et al (Methods Mol Biol. 2009; 513:19-39); Soni et al Clin Chem 53: 1996-2001 2007; and Morozova (Genomics. 2008 92:255-64), which are herein incorporated by reference for the general descriptions of the methods and the particular steps of the methods, including starting products, reagents, and final products for each of the steps.
(75) Measuring Protein
(76) An expression level of an expression product of ClpP may be measured by detecting the amount or level of one or more proteins (e.g., ClpP) or a fragment thereof. Such detection may include detecting the level of a ClpP protein or a fragment thereof in a cell extract, in a fixed cell, in a living cell, in a biological sample, etc. For measuring a protein level, the amount or level of protein the sample (e.g., in a cell, in a population of cells, in a cell extract, etc.) is determined. In some instances, the concentration of one or more additional proteins may also be measured, and the measured expression level compared to the level of the one or more additional proteins to provide a normalized value for the measured expression level. In some embodiments, the measured expression level is a relative value calculated by comparing the level of one protein relative to another protein. In other embodiments the concentration is an absolute measurement (e.g., weight/volume or weight/weight).
(77) The expression level of a protein (e.g., ClpP) may be measured by detecting in a sample the amount or level of one or more proteins/polypeptides or fragments thereof. The terms “polypeptide,” “peptide” and “protein” are used interchangeably herein to refer to a polymer of amino acid residues. “Polypeptide” refers to a polymer of amino acids (amino acid sequence) and does not refer to a specific length of the molecule. Thus peptides and oligopeptides are included within the definition of polypeptide. In some cases, cells are removed from a biological sample (e.g., via centrifugation, via adhering cells to a dish or to plastic, etc.) prior to measuring the expression level. In some cases, the intracellular protein level is measured by lysing cells of the sample to measure the level of protein in the cellular contents. In some cases, a level of protein can be measured without disrupting cell morphology (e.g., a protein level can be visualized, e.g., via fluorescent antibody staining, etc.)
(78) When protein levels are to be detected, any suitable protocol for measuring protein levels may be employed. Examples of methods for assaying protein levels include but are not limited to antibody-based methods as well as methods that are not antibody based. Examples of suitable methods include but are not limited to: enzyme-linked immunosorbent assay (ELISA), mass spectrometry, proteomic arrays, xMAP™ microsphere technology, flow cytometry, western blotting, immunofluorescence, and immunohistochemistry.
(79) Some protein detection methods are antibody-based methods. The term “antibody” is used in the broadest sense and specifically covers monoclonal antibodies (including full length monoclonal antibodies), polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired biological activity. Examples of antibody fragments include Fab, Fab′, Fab′-SH, F(ab′).sub.2, and Fv fragments; scFvs, diabodies; and multispecific or multivalent structures formed from antibody fragments.
(80) ClpP Activity Level
(81) As noted above, ClpP functions as part of a complex (ClpXP) that includes both ClpP and ClpX, and requires ATP to unfold and hydrolyze protein substrates. As such, any agent that disrupts the interaction between ClpP and ClpX, or that reduces the activity of the ClpP/ClpX complex (e.g., reduces the hydrolysis of protein substrates) can be considered an agent that reduces an activity level of ClpP. An activity level of ClpP can be measured using any suitable method. For example, an enzymatic assay can be used to measure ClpP activity. Parameters such as the kinetics of hydrolysis of ATP by ClpXP and/or degradation of substrate by ClpXP can be measured using any suitable method. For examples of various ways to measure ClpP activity level, see, e.g., Burton et al., Protein Sci. 2003 May; 12(5):893-902; Joshi et al., Nat Struct Mol Biol. 2004 May; 11(5):404-11; Kang et al., J Biol Chem. 2005 Oct. 21; 280(42):35424-32; Baker et al., Biochim Biophys Acta. 2012 January; 1823(1):15-28, and Al-Furoukh et al. (2014) PLoS ONE 9(7): e103141, the disclosure of each of which are incorporated by reference herein.
(82) Furthermore, as demonstrated in the examples below, a decrease in ClpP activity level (in this case caused by an absence of ClpP in knockout mice) results in an increase in the amounts of the following proteins: TNF receptor-associated protein 1 (TRAP1) (mitochondrial Hsp90), heat shock protein family A (Hsp70) member 9 (Grp75) (mitochondrial Hsp70), leucine rich pentatricopeptide repeat containing (LRPPRC), caseinolytic mitochondrial matrix peptidase chaperone subunit (ClpX) (mitochondrial Hsp100), ornithine aminotransferase (OAT), and Ion peptidase 1, mitochondrial (LonP1) (a mitochondrial protease). As such, in some cases, measuring an activity level of ClpP can include measuring an amount of one or more (e.g., two or more, three or more, four or more, 5 or more, or all 6) of the following proteins: TRAP1, Grp75, LRPPRC, ClpX, OAT, and LonP. For example, a decrease in ClpP activity can be detected by measuring an increase in the levels of one or more (e.g., two or more, three or more, four or more, 5 or more, or all 6) of: TRAP1, Grp75, LRPPRC, ClpX, OAT, and LonP, e.g., relative to a suitable control, such as a level of one or more of TRAP1, Grp75, LRPPRC, ClpX, OAT, and LonP prior to contacting with a test agent as described herein.
(83) Evaluation Steps
(84) As described in the examples below, the inventors have discovered that mice with decreased ClpP expression (due to knockout in the genome of the ClpP gene, designated ClpP.sup.(−/−)) exhibit a number of phenotypes, including but not limited to decreased: white adipose tissue, body fat (as measured by total body fat mass or body fat content (% fat mass)), body weight, visceral adipose adipocyte size, levels of plasma leptin, and blood glucose level (e.g., after fasting); and increased: insulin sensitivity, glucose tolerance, growth hormone levels, energy consumption (e.g., increased basal energy expenditure), levels of phosphorylated AKT (p-AKT) in muscles and/or fibroblasts, and lean content (% lean mass). ClpP.sup.−/− mice gained less weight and generated less fat while consuming more food, and ClpP.sup.−/− mice were resistant to high fat diet (HFD)-induced weight gain (e.g., the increase in fat mass and body weight due to HFD was less than the increase seen in wild type controls).
(85) In some cases, a subject method (e.g. a screening method or a treatment method) includes, after administration of an agent to an individual (e.g., a candidate agent for treatment as identified with a subject screening method, an inhibitor of ClpP such as an RNAi agent or a genome editing agent specific for ClpP, etc.), a step of measuring one or more features of the individual (e.g., to verify that the agent produces a desired outcome). Suitable features that can be measured include, but are not limited to insulin sensitivity, blood glucose level, glucose tolerance, body fat mass, an amount of fat tissue, an amount of white adipose tissue, percent fat mass, body weight, visceral adipose adipocyte size, plasma leptin level, growth hormone level, basal energy expenditure, a level of phosphorylated AKT (p-AKT) in muscles and/or fibroblasts, percent lean mass, mitochondrial number in hepatocytes, mitochondrial mass in hepatocytes, mitochondrial morphology in hepatocytes, fibroblast respiratory capacity, fibroblast maximal oxygen consumption rate (OCR), and fibroblast resistance to H.sub.2O.sub.2-induced cytotoxicity. An evaluation step (e.g., a step of measuring one or more of the above features), can be included as part of a subject screening method (e.g., a method of identifying a candidate agent). An evaluation step (e.g., a step of measuring one or more of the above features), can also be included as part of a subject treatment method.
(86) Generating a Report
(87) In some cases, a subject method (e.g., any of the screening methods described above) includes a step of generating a report (e.g., a report that the test agent is a candidate agent for treating obesity, liver disease, and/or diabetes). A “report,” as described herein, is an electronic or tangible document which includes report elements that provide information of interest relating to the results and/or assessments of such results of a subject method (e.g., a screening method). In some embodiments, a subject report includes a measured expression level and/or activity level as discussed in greater detail above (e.g., a raw value, a normalized value, a normalized and weighted value, etc.) (e.g., an activity level of ClpP or an expression level of a ClpP expression product, such as a ClpP protein and/or a ClpP-encoding mRNA). In some embodiments, a subject report includes a ClpP expression level and/or activity level. In some cases, a subject report includes an assessment (e.g. a determination of whether one or more test agents caused a reduction in a ClpP expression level and/or activity level). For example, a report can state whether a given test agent or list of test agents caused a reduction in a ClpP expression level and/or activity level (e.g., at the level of protein and/or mRNA), and/or whether a given test agent or list of test agents is a candidate agent for treatment.
(88) Treatment Methods
(89) Provided are methods that include administering to an individual an inhibitor of ClpP (such as an RNAi agent or gene editing agent specific for ClpP), where the inhibitor of ClpP reduces an activity level and/or expression level of ClpP (e.g., as can be detected at the level of protein and/or mRNA). Such methods can be referred to as methods of reducing an expression level and/or activity level of ClpP, and/or methods of treating an individual with obesity, liver disease, and/or diabetes. A discussion of ClpP activity levels and expression levels (e.g., at the level of protein and/or mRNA), and methods for measuring such levels can be found elsewhere herein.
(90) In some embodiments, such methods are methods of treating an individual with obesity, liver disease, and/or diabetes, methods of increasing energy output, methods of reducing an amount of adipose tissue (e.g., white adipose tissue), methods of preventing or reducing weight gain, methods of increasing insulin sensitivity, and/or methods of increasing glucose tolerance. For example, in some cases, a subject method is a method of increasing energy output, reducing an amount of adipose tissue, increasing insulin sensitivity, increasing glucose tolerance, and/or preventing or reducing weight gain, and the method includes administering to the individual a ClpP inhibitor (such as an RNAi agent or gene editing agent specific for ClpP) that reduces the expression level and/or activity level of ClpP. In some embodiments, a subject method is a method of treating an individual with obesity, liver disease, and/or diabetes, and the method includes administering to the individual an inhibitor of ClpP (such as an RNAi agent or gene editing agent specific for ClpP) that reduces the expression level and/or activity level of ClpP.
(91) In some embodiments, a subject method is a method of administering an inhibitor of ClpP to an individual (e.g., an individual who has obesity, liver disease, and/or diabetes) in an amount effective for decreasing an amount of fat tissue in the individual, preventing or reducing weight gain of the individual, increasing insulin sensitivity of the individual, and/or increasing glucose tolerance of the individual.
(92) In some cases, any of the above subject treatment methods can include a step of measuring a ClpP expression level and/or activity level in a biological sample from the individual that is being treated (e.g., in a hepatocyte of/from the individual to whom a ClpP inhibitor was administered). In some cases, a subject treatment method includes a step of obtaining a biological sample from the individual and measuring a ClpP expression level and/or activity level of the sample. In some cases, such a step is performed before and after treatment (e.g., to verify that administration had the desired outcome).
(93) In some cases, an inhibitor of ClpP (e.g., an RNAi agent or a gene editing agent that targets ClpP) is administered to an individual (e.g., an individual who is obese and/or has diabetes), in an amount effective for decreasing an amount of fat tissue in the individual, preventing or reducing weight gain of the individual, increasing insulin sensitivity of the individual, and/or increasing glucose tolerance of the individual.
(94) RNAi Agents and Genome Editing Agents
(95) In some cases, an inhibitor of ClpP (e.g., an agent that reduces an expression level and/or activity level of ClpP) is an RNAi agent or a genome editing agent that targets ClpP (e.g., is specific for ClpP). The term “RNAi agent” is used herein to mean any agent that can be used to induce a gene specific RNA interference (RNAi) response in a cell. Suitable examples of RNAi agents include, but are not limited to short interfering RNAs (siRNAs) and short hairpin RNAs (shRNAs), and micro RNAs (miRNA). An RNAi agent (e.g., shRNA, siRNA, miRNA) specific for ClpP is an agent that targets the mRNA encoding the ClpP protein. RNAi agents can readily be designed to specifically target any desired mRNA (e.g., one encoding ClpP) by choosing an appropriate nucleotide sequence.
(96) Various RNAi agent designs (RNAi agents with various features) are known in the art and any suitable RNAi agent that targets ClpP can be used. For example, various designs of RNAi agents (as well as methods of their delivery) can be found in numerous patents, including, but not limited to U.S. Pat. Nos. 7,022,828; 7,176,304; 7,592,324; 7,667,028; 7,718,625; 7,732,593; 7,772,203; 7,781,414; 7,807,650; 7,879,813; 7,892,793; 7,910,722; 7,947,658; 7,973,019; 7,973,155; 7,981,446; 7,993,925; 8,008,271; 8,008,468; 8,017,759; 8,034,922; 8,399,653; 8,415,319; 8,426,675; 8,466,274; 8,524,679; 8,524,679; 8,569,065; 8,569,256; 8,569,258; 9,233,102; 9,233,170; and 9,233,174; all of which are incorporated herein by reference. Where appropriate, an RNAi agent may be provided in the form of a DNA encoding the agent (e.g., an expression vector encoding a shRNA). shRNAs targeting the ClpP (accession no. NM_003321) coding sequence are provided for example in Cole et al., 2015, Cancer Cell 27, 864-876, the disclosure of which is incorporated by reference herein in its entirety and for all purposes. These shRNAs include 5′-GCCCATCCACATGTACATCAA-3′ (SEQ ID NO:5); 5′-CACGATGCAGTACATCCTCAA-3′ (SEQ ID NO:6); and 5′-GCTCAAGAAGCAGCTCTATAA-3′ (SEQ ID NO:7).
(97) The terms “genome editing agent” and “genome targeting composition” are used interchangeably herein to mean a composition that includes a genome editing nuclease. In some embodiments, the genome editing nuclease binds a native or endogenous recognition sequence. In some embodiments, the genome editing nuclease is a modified endonuclease that binds a non-native or exogenous recognition sequence and does not bind a native or endogenous recognition sequence.
(98) Examples of suitable genome editing nucleases include but are not limited to zinc finger nucleases (ZFNs), TAL-effector DNA binding domain-nuclease fusion proteins (transcription activator-like effector nucleases (TALENs)), CRISPR/Cas endonucleases (e.g., class 2 CRISPR/Cas endonucleases such as a type II, type V, or type VI CRISPR/Cas endonucleases), and recombinases (e.g., Cre recombinase, Hin recombinase, RecA, RAD51, Tre, FLP, and the like). Thus, in some embodiments, a genome editing agent is a composition that can include one or more genome editing nucleases selected from: a ZFN, a TALEN, a recombinase (e.g., Cre recombinase, Hin recombinase, RecA, RAD51, Tre, FLP, and the like), and a CRISPR/Cas endonuclease (e.g., a class 2 CRISPR/Cas endonuclease such as a type II, type V, or type VI CRISPR/Cas endonuclease).
(99) Recombinases include but are not limited to Cre recombinase, Hin recombinase, RecA, RAD51, Tre, and FLP.
(100) Information related to class 2 type II CRISPR/Cas endonuclease Cas9 proteins and Cas9 guide RNAs (as well as methods of their delivery) (as well as information regarding requirements related to protospacer adjacent motif (PAM) sequences present in targeted nucleic acids) can be found in the art, for example, see Jinek et al., Science. 2012 Aug. 17; 337(6096):816-21; Chylinski et al., RNA Biol. 2013 May; 10(5):726-37; Ma et al., Biomed Res Int. 2013; 2013:270805; Hou et al., Proc Natl Acad Sci USA. 2013 Sep. 24; 110(39):15644-9; Jinek et al., Elife. 2013; 2:e00471; Pattanayak et al., Nat Biotechnol. 2013 September; 31(9):839-43; Qi et al, Cell. 2013 Feb. 28; 152(5):1173-83; Wang et al., Cell. 2013 May 9; 153(4):910-8; Auer et. al., Genome Res. 2013 Oct. 31; Chen et. al., Nucleic Acids Res. 2013 Nov. 1; 41(20):e19; Cheng et. al., Cell Res. 2013 October; 23(10):1163-71; Cho et. al., Genetics. 2013 November; 195(3):1177-80; DiCarlo et al., Nucleic Acids Res. 2013 April; 41(7):4336-43; Dickinson et. al., Nat Methods. 2013 October; 10(10):1028-34; Ebina et. al., Sci Rep. 2013; 3:2510; Fujii et. al, Nucleic Acids Res. 2013 Nov. 1; 41(20):e187; Hu et. al., Cell Res. 2013 November; 23(11):1322-5; Jiang et. al., Nucleic Acids Res. 2013 Nov. 1; 41(20):e188; Larson et. al., Nat Protoc. 2013 November; 8(11):2180-96; Mali et. at., Nat Methods. 2013 October; 10(10):957-63; Nakayama et. al., Genesis. 2013 December; 51(12):835-43; Ran et. al., Nat Protoc. 2013 November; 8(11):2281-308; Ran et. al., Cell. 2013 Sep. 12; 154(6):1380-9; Upadhyay et. al., G3 (Bethesda). 2013 Dec. 9; 3(12):2233-8; Walsh et. al., Proc Natl Acad Sci USA. 2013 Sep. 24; 110(39):15514-5; Xie et. al., Mol Plant. 2013 Oct. 9; Yang et. al., Cell. 2013 Sep. 12; 154(6):1370-9; Briner et al., Mol Cell. 2014 Oct. 23; 56(2):333-9; and U.S. patents and patent applications: U.S. Pat. Nos. 8,906,616; 8,895,308; 8,889,418; 8,889,356; 8,871,445; 8,865,406; 8,795,965; 8,771,945; 8,697,359; 20140068797; 20140170753; 20140179006; 20140179770; 20140186843; 20140186919; 20140186958; 20140189896; 20140227787; 20140234972; 20140242664; 20140242699; 20140242700; 20140242702; 20140248702; 20140256046; 20140273037; 20140273226; 20140273230; 20140273231; 20140273232; 20140273233; 20140273234; 20140273235; 20140287938; 20140295556; 20140295557; 20140298547; 20140304853; 20140309487; 20140310828; 20140310830; 20140315985; 20140335063; 20140335620; 20140342456; 20140342457; 20140342458; 20140349400; 20140349405; 20140356867; 20140356956; 20140356958; 20140356959; 20140357523; 20140357530; 20140364333; and 20140377868; all of which are hereby incorporated by reference in their entirety. Examples and guidance related to type V or type VI CRISPR/Cas endonucleases and guide RNAs (as well as information regarding requirements related to protospacer adjacent motif (PAM) sequences present in targeted nucleic acids) can be found in the art, for example, see Zetsche et al, Cell. 2015 Oct. 22; 163(3):759-71; Makarova et al, Nat Rev Microbiol. 2015 November; 13(11):722-36; and Shmakov et al., Mol Cell. 2015 Nov. 5; 60(3):385-97.
(101) Useful designer zinc finger modules include those that recognize various GNN and ANN triplets (Dreier, et al., (2001) J Biol Chem 276:29466-78; Dreier, et al., (2000) J Mol Biol 303:489-502; Liu, et al., (2002) J Biol Chem 277:3850-6), as well as those that recognize various CNN or TNN triplets (Dreier, et al., (2005) J Biol Chem 280:35588-97; Jamieson, et al., (2003) Nature Rev Drug Discov 2:361-8). See also, Durai, et al., (2005) Nucleic Acids Res 33:5978-90; Segal, (2002) Methods 26:76-83; Porteus and Carroll, (2005) Nat Biotechnol 23:967-73; Pabo, et al., (2001) Ann Rev Biochem 70:313-40; Wolfe, et al., (2000) Ann Rev Biophys Biomol Struct 29:183-212; Segal and Barbas, (2001) Curr Opin Biotechnol 12:632-7; Segal, et al., (2003) Biochemistry 42:2137-48; Beerli and Barbas, (2002) Nat Biotechnol 20:135-41; Carroll, et al., (2006) Nature Protocols 1:1329; Ordiz, et al., (2002) Proc Natl Acad Sci USA 99:13290-5; Guan, et al., (2002) Proc Natl Acad Sci USA 99:13296-301.
(102) For more information on ZFNs and TALENs (as well as methods of their delivery), refer to Sanjana et al., Nat Protoc. 2012 Jan. 5; 7(1):171-92 as well as international patent applications WO2002099084; WO00/42219; WO02/42459; WO2003062455; WO03/080809; WO05/014791; WO05/084190; WO08/021207; WO09/042186; WO09/054985; WO10/079430; and WO10/065123; U.S. Pat. Nos. 8,685,737; 6,140,466; 6,511,808; and 6,453,242; and US Patent Application Nos. 2011/0145940, 2003/0059767, and 2003/0108880; all of which are hereby incorporated by reference in their entirety.
(103) Small Molecule ClpP Inhibitors
(104) Small molecule inhibitors of ClpP are known which may find use in one or more of the screening or treatment methods described herein. For example β-Lactones, such as (3RS,4RS)-3-(non-8-en-1-yl)-4-(2-(pyridin-3-yl)ethyl)oxetan-2-one (also known as A2-32-01 and referred to herein interchangeably as A2-32-01 and A2-32) have been identified as inhibitors of both bacterial and mammalian ClpP. See, e.g., Cole et al., 2015, Cancer Cell 27, 864-876, the disclosure of which is incorporated by reference herein in its entirety and for all purposes.
(105) Beta-lactones are described, for example, in U.S. Patent Application Publication 2014/0243255, the disclosure of which is incorporated by reference herein in its entirety and for all purposes, and can include, but are not limited to, trans-beta-lactones, beta-propiolactone, saturated aliphatic beta-lactones, beta-butyrolactone, beta-isobutyrolactone, beta-valerolactone, beta-isovalerolactone, beta-n-caprolactone, alpha-ethylbeta-propiolactone, alpha-isopropyl-beta-propiolactone, alpha-butyl-beta-propiolactone, alpha isopropyl-beta-propiolactone, beta isopropyl-beta-propiolactone, alpha-methyl-beta-butyrolactone, beta-ethyl-beta-butyrolactone, alpha-ethyl-beta-butyrolactone, alpha-methyl beta-propiolactone, lactones of betahydroxy-mono-carboxylic acids containing cycloalkyl, aryl and aralkyl substituents such as betacyclohexyl-beta-propiolactone, beta-phenyl-betapropiolactone, alpha-phenyl-beta-propiolactone, beta-taenzyl-beta-propiolactone and derivatives thereof.
(106) β-Lactones inhibitors of ClpP, which may be utilized in the context of the disclosed methods, include those described in U.S. Patent Application Publication No. 2016/0221977, the disclosure of which is incorporated by reference herein in its entirety and for all purposes. Such β-Lactones inhibitors of ClpP include compounds of the following structures:
(107) ##STR00001##
wherein R.sub.2 is a single substitution of a hydrogen at any position on the benzene ring where the substituted moiety is selected from the group consisting of alkyl, substituted alkyl, alkynyl, substituted alkyl, vinyl, nitro, halo (e.g., includes bromine, chlorine, fluorine and iodine), cyano, aryl, hetero aryl, alkoxy; and C.sub.n is carbon and n is a number of from 1 to 5.
(108) ##STR00002##
wherein R.sub.1 is selected from the group consisting of alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, alkoxy, substituted alkoxy, alkoxyalkyl, substituted alkoxyalkyl, NH2, NHR, NR2, mono- or polyhydroxy-substituted alkyl, aryl, substituted aryl, heteroaryl, and substituted heteroaryl; R.sub.2 is a single substitution of a hydrogen at any position on the benzene ring where the substituted moiety is selected from the group consisting of alkyl, substituted alkyl, alkynyl, substituted alkyl, vinyl, nitro, halo, cyano, aryl, heteroaryl, alkoxy; and, C.sub.n is carbon and n is a number of from 1 to 5. Specific forms of the above structure are provided below:
(109) ##STR00003##
(110) Small molecule phenyl esters have also been shown to inhibit bacterial ClpP. See, e.g., Hackl et al., J. Am. Chem. Soc., 137, 8475-8483 (2015), the disclosure of which is incorporated by reference herein in its entirety and for all purposes. Such small molecule inhibitors include, e.g.:
(111) ##STR00004##
(112) In addition to the compounds described above, pharmaceutically acceptable salts and pro-drugs thereof may be utilized in the methods disclosed herein.
(113) Agent Delivery
(114) In some embodiments, a subject method (e.g., a screening method or a treatment method as described herein) includes a step of administering an agent to an individual (e.g., a test agent, a candidate agent, a ClpP inhibitor that reduces an expression level and/or activity level of ClpP, e.g., an RNAi agent or a gene editing agent that specifically reduces expression of ClpP, and the like). Depending on context, the individual can be of any suitable species (e.g., a mammal, a rodent, a mouse, a rat, a non-human primate, a human, etc.). For example, in some cases a test agent is administered to a mouse. In some cases, a candidate agent (e.g., as identified by a subject screening method) is administered to a mouse, a rat, a non-human primate, or a human (e.g., an individual with obesity, diabetes, reduced insulin sensitivity, reduced glucose tolerance, etc. In some cases, a ClpP inhibitor that reduces an expression level and/or activity level of ClpP as described herein is administered to a mouse, a rat, a non-human primate, or a human.
(115) In some cases, an agent as described herein is administered systemically. In some cases, an agent as described herein is administered locally (e.g., directly to a desired tissue such as the liver). In some cases, an agent as described herein is administered by parenteral, topical, intravenous, intratumoral, oral, subcutaneous, intraarterial, intracranial, intraperitoneal, intranasal or intramuscular means. A typical route of administration is intravenous or intratumoral, although other routes can be equally effective. In some cases, an agent as described herein is administered via injection. In some cases, an agent as described herein is administered in a tissue-specific manner (e.g., administration is directed to a specific tissue such as the liver).
(116) Those of skill in the art will readily appreciate that dose levels can vary as a function of the specific compound, the severity of the symptoms and the susceptibility of the subject to side effects. Preferred dosages for a given compound are readily determinable by those of skill in the art by a variety of means.
(117) In some embodiments, a single dose of a ClpP inhibitor is administered. In other embodiments, multiple doses of a ClpP inhibitor are administered. Where multiple doses are administered over a period of time, a ClpP inhibitor is administered twice daily (qid), daily (qd), every other day (qod), every third day, three times per week (tiw), or twice per week (biw) over a period of time. For example, a ClpP inhibitor is administered qid, qd, qod, tiw, or biw over a period of from one day to about 2 years or more. For example, a ClpP inhibitor is administered at any of the aforementioned frequencies for one week, two weeks, one month, two months, six months, one year, or two years, or more, depending on various factors.
(118) In some cases, a small molecule inhibitor of ClpP as described herein, e.g., a β-Lactone, such as (3RS,4RS)-3-(non-8-en-1-yl)-4-(2-(pyridin-3-yl)ethyl)oxetan-2-one or a pharmaceutically acceptable salt or pro-drug thereof is administered to a subject in need thereof, e.g., a subject as described herein, in an amount from about 50 mg/kg to about 1000 mg/kg per day, e.g., from about 100 mg/kg to about 900 mg/kg per day, from about 200 mg/kg to about 800 mg/kg per day, from about 300 mg/kg to about 700 mg/kg per day, or from about 400 mg/kg to about 600 mg/kg per day. In some cases, a small molecule inhibitor of ClpP as described herein, e.g., a β-Lactone, such as (3RS,4RS)-3-(non-8-en-1-yl)-4-(2-(pyridin-3-yl)ethyl)oxetan-2-one or a pharmaceutically acceptable salt or pro-drug thereof is administered to a subject as a once daily dose or a twice daily dose.
(119) In some cases, a RNAi agent or genome editing agent is configured such that the reduction of ClpP expression brought about by the agent is limited to a particular tissue type (e.g., the liver). For example, the components of an RNAi agent (e.g., shRNA, siRNA) or genome editing agent (CRISPR/Cas protein plus guide RNA) can be active only in a particular tissue, e.g., the components can be delivered to the particular tissue, the components can be operably linked to a tissue-specific promoter, etc. For example, as described in the examples below, delivery of the Cre recombinase to the liver in mice that harbor a floxed allele of the ClpP gene in their genome, recapitulates the increase in insulin sensitivity exhibited by ClpP knockout mice. Thus, reduction of ClpP expression in the liver can result in an increase in insulin sensitivity without the potential side effects of reducing ClpP expression throughout the whole individual. In some cases, the inhibitor of ClpP that reduces ClpP expression and/or activity (e.g., a small molecule inhibitor, an RNAi agent or gene editing agent specific for ClpP) is administered systemically, and in some cases locally (e.g., to the liver, e.g., see U.S. Pat. Nos. 8,524,679; and 8,008,468, both of which are incorporated by reference in their entirety).
(120) In some cases, the effect of an agent as described herein is substantially liver-specific (e.g., the genome editing nuclease such as Cre recombinase, a CRISPR/Cas endonuclease, a ZFN, a TALEN, etc., can be delivered in a tissue specific manner or can be under the control of a tissue specific promoter). By “substantially liver-specific” it is meant that the majority of the reduction of ClpP expression is in the liver. Such can be achieved in a number of different ways. It is understood that the reduction of ClpP expression may not be limited only to the liver, but that one or more other tissues may exhibit reduction of ClpP expression as well. For example, if a promoter is used (e.g., as part of an expression vector to drive expression of a ClpP inhibitor, e.g., a genome editing nuclease, or a component of a ClpP inhibitor, e.g., a CRISPR/Cas guide RNA), that promoter need not be perfectly limited only to the liver. Such a promoter may exhibit ‘leaky’ expression in other tissues or may be limited to tissues other than just the liver (e.g., the liver plus one or more additional tissues, but not all tissues, i.e., the promoter is not constitutive). As another example, if an agent is locally delivered (e.g., via direct injection), it is understood that some of the agent may also affect tissues in addition to the liver (e.g., neighboring organs, the blood, etc.). Thus, when the term “substantially liver-specific” is used, it is meant that global ClpP expression (e.g., throughout the whole body) is not reduced, while liver ClpP expression is reduced.
(121) For example, when the agent is an RNAi agent, liver-specificity can be accomplished by delivering the agent directly to the liver (e.g., injection into the liver etc.). On the other hand, liver-specificity can be accomplished by expressing the RNAi agent from a DNA encoding the agent (e.g., an expression vector encoding an shRNA) where the promoter driving expression of the agent drives expression of the agent in the liver (e.g., a liver-specific promoter). Likewise, genome editing agents can be delivered directly to the liver, or can be functional in the liver (e.g., by expressing one or more of the components from an expression vector that has a promoter that drives expression in the liver, e.g., a liver-specific promoter). In some cases, the inhibitor of ClpP is administered such that reduction of ClpP expression is substantially liver-specific, and the amount administered is effective for increasing insulin sensitivity of the individual.
(122) Liver-specificity can also be accomplished when the inhibitor of ClpP that reduces ClpP expression and/or activity is in an inactive form unless converted to an active form by a liver-specific enzyme. For example, the inhibitor of ClpP can be delivered in the form of a prodrug, which is then converted to an active form in the liver, for example by a carboxylesterase such as human liver carboxylesterase 1 (hCE1), a paraoxonase such as PON3, an alkaline phosphatase, human valacyclovirase (VACVase), a purine-nucleosidephosphorylase (PNP), and the like). See, e.g., Yang, et. al., Enzyme-mediated hydrolytic activation of prodrugs, Acta PharmaceuticaSinica B 2011; 1(3):143-159.
(123) Agents can be prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection can also be prepared. The preparation also can be emulsified or encapsulated in liposomes or micro particles such as polylactide, polyglycolide, or copolymer for enhanced adjuvant effect, as discussed above. Langer, Science 249: 1527, 1990 and Hanes, Advanced Drug Delivery Reviews 28: 97-119, 1997. Subject agents can be administered in the form of a depot injection or implant preparation which can be formulated in such a manner as to permit a sustained or pulsatile release of the active ingredient. The agents can be formulated as sterile, substantially isotonic and are in full compliance with all Good Manufacturing Practice (GMP) regulations of the U.S. Food and Drug Administration.
(124) Also within the scope of the disclosure are kits. For example, in some cases a subject kit can include (i) a detection reagent for detecting a ClpP activity level and/or expression level (e.g., protein, mRNA), e.g., an anti-ClpP antibody, and (ii) a control agent (e.g. a positive control agent that is known to reduce a ClpP activity level and/or expression level, and/or a negative control agent that is known not to reduce a ClpP activity level and/or expression level). In some cases, a subject kit can include instructions for use. Kits typically include a label indicating the intended use of the contents of the kit. The term label includes any writing, or recorded material supplied on or with the kit, or which otherwise accompanies the kit.
(125) Exemplary Non-Limiting Aspects of the Disclosure
(126) Aspects, including embodiments, of the present subject matter described above may be beneficial alone or in combination, with one or more other aspects or embodiments. Without limiting the foregoing description, certain non-limiting aspects of the disclosure numbered 1-26 are provided below. As will be apparent to those of skill in the art upon reading this disclosure, each of the individually numbered aspects may be used or combined with any of the preceding or following individually numbered aspects. This is intended to provide support for all such combinations of aspects and is not limited to combinations of aspects explicitly provided below: 1. A method of identifying a candidate agent for treating obesity, liver disease, and/or diabetes, the method comprising: (a) contacting a mammalian cell with a test agent; (b) measuring the expression level and/or activity level of ClpP in the mammalian cell relative to a reference value following the contacting; (c) determining that the test agent caused a decrease in the expression level and/or activity level relative to the reference value; and (d) identifying the test agent as a candidate agent for treating obesity, liver disease, and/or diabetes. 2. The method according to 1, wherein the mammalian cell is a mouse cell. 3. The method according to 1, wherein the mammalian cell is a human cell. 4. The method according to any of 1-3, wherein the mammalian cell is in vitro. 5. The method according to any of 1-3, wherein the mammalian cell is ex vivo. 6. The method according to any of 1-3, wherein the mammalian cell is in vivo. 7. The method according to any of 1-6, wherein the mammalian cell is a hepatocyte. 8. The method according to 2, wherein the contacting comprises administering the test agent to a mouse. 9. The method according to 8, further comprising, measuring an expression level and/or activity level of ClpP in the mouse prior to the contacting of step (a) in order to obtain the reference value. 10. The method according to any of 1-9, further comprising, after step (d), administering the identified candidate agent to an individual that has obesity, liver disease, and/or diabetes. 11. The method according to 10, wherein the individual is a mouse, a non-human primate, or a human. 12. The method according to 10 or 11, further comprising, after administering the identified candidate agent to the individual, measuring one or more features of the individual selected from: insulin sensitivity, blood glucose level, glucose tolerance, body fat mass, an amount of fat tissue, an amount of white adipose tissue; percent fat mass, body weight, visceral adipose adipocyte size, plasma leptin level, growth hormone level, basal energy expenditure, a level of phosphorylated AKT (p-AKT) in muscles and/or fibroblasts, percent lean mass, mitochondrial number in hepatocytes, mitochondrial mass in hepatocytes, mitochondrial morphology in hepatocytes, fibroblast respiratory capacity, fibroblast maximal oxygen consumption rate (OCR), and fibroblast resistance to H.sub.2O.sub.2-induced cytotoxicity. 13. The method according to any of 1-12, wherein in the test agent is a small molecule or a polypeptide. 14. The method according to any of 1-13, comprising measuring an expression level of ClpP, wherein the expression level is an RNA expression level and the measuring comprises the use of quantitative RT-PCR, a microarray, or RNA sequencing. 15. The method according to any of 1-13, comprising measuring an expression level of ClpP, wherein the expression level is a protein expression level and the measuring comprises detecting ClpP protein using an anti-ClpP antibody, mass spectrometry, and/or an enzyme-linked immunosorbent assay (ELISA) assay. 16. The method according to any of 1-13, comprising measuring a decrease in an activity level of ClpP by measuring an increase in an amount of one or more proteins selected from: TNF receptor-associated protein 1 (TRAP1), heat shock protein family A (Hsp70) member 9 (Grp75), leucine rich pentatricopeptide repeat containing (LRPPRC), caseinolytic mitochondrial matrix peptidase chaperone subunit (ClpX), ornithine aminotransferase (OAT), and Ion peptidase 1(LonP1). 17. The method according to any of 1-16, wherein the method comprises screening a plurality of test agents to identify one or more candidate agents for treating obesity, liver disease, and/or diabetes. 18. A method of treating an individual with obesity, liver disease, and/or diabetes, the method comprising: administering an inhibitor of ClpP to the individual in an amount effective for decreasing an amount of fat tissue in the individual, preventing or reducing weight gain of the individual, increasing insulin sensitivity of the individual, and/or increasing glucose tolerance of the individual. 19. The method according to 18, wherein the inhibitor of ClpP is an RNAi agent or a gene editing agent that specifically reduces expression of ClpP. 20. The method according to 18 or 19, wherein the inhibitor of ClpP is administered such that reduction of ClpP expression is substantially liver-specific, and the amount administered is effective for increasing insulin sensitivity of the individual. 21. The method according to 18, wherein the inhibitor of ClpP is a small molecule. 22. The method according to 21, wherein the small molecule is a β-Lactone. 23. The method according to 22, wherein the β-Lactone is (3RS,4RS)-3-(non-8-en-1-yl)-4-(2-(pyridin-3-yl)ethyl)oxetan-2-one or a pharmaceutically acceptable salt thereof. 24. The method according to any of 18-23, wherein the inhibitor of ClpP is delivered directly to the individual's liver, and the amount administered is effective for increasing insulin sensitivity of the individual. 25. The method according to any of 18-24, wherein the administering comprises local injection. 26. The method according to any of 18-25, further comprising a step of measuring insulin sensitivity of the individual.
(127) It will be apparent to one of ordinary skill in the art that various changes and modifications can be made without departing from the spirit or scope of the invention.
EXPERIMENTAL
(128) The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the present invention, and are not intended to limit the scope of the invention nor are they intended to represent that the experiments below are all or the only experiments performed. Efforts have been made to ensure accuracy with respect to numbers used (e.g., amounts, temperature, etc.) but some experimental errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, molecular weight is weight average molecular weight, temperature is in degrees Centigrade, and pressure is at or near atmospheric.
(129) All publications and patent applications cited in this specification are herein incorporated by reference as if each individual publication or patent application were specifically and individually indicated to be incorporated by reference.
(130) The present invention has been described in terms of particular embodiments found or proposed to comprise preferred modes for the practice of the invention. It will be appreciated by those of skill in the art that, in light of the present disclosure, numerous modifications and changes can be made in the particular embodiments exemplified without departing from the intended scope of the invention. For example, due to codon redundancy, changes can be made in the underlying DNA sequence without affecting the protein sequence. Moreover, due to biological functional equivalency considerations, changes can be made in protein structure without affecting the biological action in kind or amount. All such modifications are intended to be included within the scope of the appended claims.
Materials and Methods
(131) The following methods were utilized in the examples described herein:
(132) Animals. All mice were maintained on a 12-h light/dark cycle in a pathogen-free animal facility. Mice were separately housed by their genotypes for all metabolic studies. For high-fat diet (HFD)-induced obesity studies, animals were fed a HFD (21% by weight, 42% kcal from fat, 0.2% total cholesterol; TD.01064, Harlan-Teklad) for specified periods. Anesthesia was induced with isoflurane (survival procedures) or with avertin (terminal procedures). All procedures were approved by the UCSF Animal Research Committee and followed NIH guidelines. Animal sample sizes for different assays were chosen based on previous literature. Animals were grouped according to genotype; no randomization was used. For all behavior tests, all animal IDs were blinded to tester. Testers were not blinded for other assays.
(133) Generation and maintenance of ClpP knockout (ClpP.sup.−/−) and ClpP conditional knockout (ClpP-cKO) mice. Frozen ClpP.sup.+/− sperm was recovered and ClpP.sup.+/− mice were generated. ClpP.sup.−/− mice were back-crossed into a C57BL/6 genetic background for three or more generations. Since ClpP.sup.−/− mice were infertile, ClpP.sup.+/− mice were bred with each other to generate littermates with three different genotypes (WT, ClpP.sup.+/−, ClpP.sup.−/−) and used to maintain the line.
(134) Generation and maintenance of ClpP conditional knockout (Clp-cKO) mice. A ClpP-cKO construct was made by flanking ClpP gene with a long arm of homology (5′ terminal, about 6 Kb) and a short arm of homology (3′ terminal, about 3 Kb). LoxP sites were added to both ends of the region containing ClpP exons 1-3 for future removal. A puromycin resistant gene flanked by F3 sites were inserted right before the 3′ terminal loxP site. A mouse ES cell clone carrying the targeted ClpP allele was selected and used for microinjection. Resulting chimeras were bred with Flp mice to generate offspring carrying the targeted ClpP allele. Heterozygous ClpP-cKO mice were then bred to generate homozygous ClpP-cKO mice. The ClpP-cKO mice were generated on a C57BL/6 genetic background. Homozygous ClpP-cKO mice were used to maintain the line.
(135) Body composition analysis. Body composition of mice after a 4-h fast was analyzed under isoflurane anesthesia by dual-energy X-ray absorpitometry (DEXA) with a PIXImus2 scanner (GE Healthcare Lunar).
(136) Food intake study. Mice were separately housed by their genotypes. For each cage, food was weighted every day at 10:00 a.m. for 4 days. The daily food intake for each cage was calculated by subtracting the food weight at the end of a 24-h period from the food weight at the starting time. The daily food intake is normalized by either animal number or body weight.
(137) Fasting-refeeding study. Mice fasted for 24 h and then returned to free feeding. The body weights of mice were measured before and after the fasting. The food intake and body weight gain were monitored after refeeding periods of 8 and 24 h.
(138) Body temperature measurement. The core body temperatures of mice were taken with a rodent rectal thermometer.
(139) Measurement of blood glucose and plasma insulin. Blood glucose was measured with a glucometer and glucose test strips (Free Style Lite). Plasma insulin was quantified with an insulin Elisa kit (Crystal Chem).
(140) Glucose, insulin, and pyruvate tolerance tests. Glucose, insulin, and pyruvate tolerance tests were performed by intraperitoneal injection of glucose (2 g/kg), insulin (0.5 units/kg) or pyruvate (2 g/kg) after an overnight fast for glucose and pyruvate or a 4-h fast for insulin. Blood glucose levels were measured before injection and at different time points after injection. To assess glucose-stimulated insulin release, mice fasted overnight (for 16 h) and were then injected intraperitoneally with glucose (2 g/kg). Blood samples were collected from tail veins before injection and at different time points after injection.
(141) Behavior tests. The general neurological behavior profiles of ClpP.sup.−/− mice were assessed by the grip strength, incline, and tail suspense tests. The motor function of these mice was determined by the rotarod test. Anxiety levels were determined by elevated plus maze. Activity levels were studied by an open field test. The learning and memory of these mice were examined using the Morris water maze. The auditory functions were tested by prepulse inhibition test.
(142) Histological analysis. Tissues (liver, visceral adipose, gastrocnemius muscle, interscapular brown adipose, and pancreas) were fixed in 4% paraformaldehyde (pH 7.4) overnight, embedded in paraffin, and serially sectioned at 7-8 μm. Standard haematoxylin and eosin staining was performed.
(143) Adipocyte size measurement. Haematoxylin and eosin staining of adipose tissue sections was performed and images were analyzed with image J.
(144) Electron microscopic analysis of liver sections. WT or ClpP.sup.−/− mice were perfused with EM fixative. The liver tissues were collected and fixed in the EM fixative for 2 days. The tissues were processed and electron microscopy images were collected using a JEOL JEM-1230 transmission electron microscope. The mitochondrial number, area, and roundness were measured by Image J software at 13,600 magnifications.
(145) Generation of adipocyte-specific ClpP-cKO mice. Adipocyte-specific ClpP knockout mice were generated through breeding ClpP-cKO mice with ap2Cre mice. The Cre.sup.+ mice had greatly reduced ClpP protein levels in adipose tissues and the Cre-littermates were served as controls in metabolic assays.
(146) Tail vein injection of AAV-CMV-Cre. AAV8.2-CMV-Cre and control AAV8.2 were utilized. These viruses were injected into 3-5 month-old ClpP-cKO mice through tail vein at a dose of 5×10.sup.9 genome copies/gram (gc/gram) body weight. The body weights of the injected mice were measured once every week. The blood glucose and plasma insulin levels were measured before and 3 weeks after injection. The glucose tolerance test was performed on these mice 4 weeks after injection. HFD was given to these mice 6 weeks after injection. The body weight gain in response to HFD was followed and the glucose tolerance test was performed after two weeks on HFD.
(147) Western blot. Tissues or cells were lysated in low-detergent buffer (50 mM Tris/HCl, pH 8.0, 150 mM NaCl, 0.1% SDS, 0.5% Nonidet P-40, 0.5% sodium deoxycholate) with a mixture of protease inhibitors. Phosphatase inhibitors were also included in the lysate buffer. The lysates were centrifuged at 13,000 rpm for 10 min to remove the pellets. SDS-PAGE was performed with a NuPAGE bis-tris system from Invitrogen, following the vendor's protocol. A standard western blot protocol was used with IRDye-labeled secondary antibodies (Li-cor). A Li-cor image system was used to scan the western blot images.
(148) 2D fluorescence difference gel electrophoresis. Organs from ClpP.sup.−/−, ClpP.sup.+/−, or WT mice were submitted for 2D fluorescence difference gel electrophoresis analysis. The most dramatically changed spots were cut from the gel for mass spectrometry analysis to identify the proteins, which was done by the same company.
(149) Mouse fibroblast preparation. Mouse fibroblasts were prepared from skin tissue collected from new-born pups. The tissue was cut into small pieces and placed on a 100-mm cell culture dish with the skin side up. After 5-10 min, 10 ml of fibroblast medium (DMEM with 10% FBS) was slowly added to the dishes. The implants were cultured in a humidified 37° C., 5% CO.sub.2 incubator. Fibroblasts eventually proliferated after 7-10 day in culture. Mouse fibroblasts were maintained in the same medium for multiple passages.
(150) Overexpression of ClpP in ClpP.sup.−/− fibroblasts. Lentiviral overexpression vector for human ClpP was constructed with pLenti7.3TOPO TA Cloning Kit from Life Technologies. The lentiviruses were packed with ViraPower™ lentiviral packaging mix from Life Technologies. Lentivirus carrying either empty vector (control) or human ClpP cDNA were added to ClpP−/− fibroblasts and incubated for 48 hr before further experiments.
(151) shRNA knockdown of different genes in ClpP.sup.−/− fibroblasts. Lentiviral shRNA constructs were obtained. The lentiviruses were packed with ViraPower™ lentiviral packaging mix from Life Technologies. Lentivirus carrying either empty vector (control) or different shRNAs were added to ClpP.sup.−/− fibroblasts and incubated for 48 hr before further experiments.
(152) Cell viability assay. Mouse fibroblasts were plated on black clear-bottomed 96-well plates at 10,000 cells per well. After incubating for 24 h, the cells were cultured in OPTI-MEM medium overnight. The cells were treated with H.sub.2O.sub.2 at various doses for 4 h. Alamar blue reagent (Invitrogen) was then added to the wells (1:10 ratio). After a 2-h incubation, the fluorescence intensity was measured at 590 nm emission (560 nm excitation).
(153) Seahorse OCR assay. Mouse fibroblasts were maintained in fibroblast growth medium until confluence. The day before the assay, fibroblasts were trypsinized and plated on a 96-well Seahorse culture plate at 40,000 cells per well. Before the assay, the culture medium was changed to a CO.sub.2-independent medium supplied by Seahorse Bioscience. The cells were then incubated at 37° C. without CO.sub.2 for 0.5-1 h. The oxygen consumption rate (OCR) assay was performed with an XF Cell mito-stress test kit and XF Extracellular Flux Analyzers (Seahorse Bioscience) following the vendor's protocol.
(154) Growth hormone (GH) and leptin level determination. The GH and leptin levels in mouse plasma were determine by a mouse GH ELISA kit and ultra sensitive mouse insulin ELISA kit from Crystal Chem, Inc.
(155) Antibodies. The antibodies used were anti-ClpP (rabbit, Novus Biologicals), anti-ClpX (SDI, custom made), anti-Akt (rabbit, Cell Signaling), anti-phospho-Akt (rabbit, Cell Signaling), anti-Grp75 (rabbit, Cell Signaling), anti-TRAP1 (moue mAb, AbCam), anti-LRPPRC (rabbit, Proteintech Group), anti-LonP (rabbit, Sigma-Aldrich), anti-OAT (mouse, Abcam), anti-SDH2 (rabbit, aric antibodies), anti-ATP6V1A (rabbit, Proteintech Group), anti-CPS1 (mouse, Lifespan), anti-Hsp70 (rabbit, Cell Signaling), anti-GAPDH (mouse mAb, Millipore), anti Hsp60 (rabbit, Abcam), anti-VDAC (mouse mAb, EMD Chemical), and anti-actin (rabbit, Sigma-Aldrich).
(156) Statistical analyses. Data are presented as mean±SD unless otherwise specified. All statistical analyses were done using Prism 6 software (GraphPad). Differences between means were assessed by t-test, one-way ANOVA, or repeated measures ANOVA, followed by Bonferroni or Tukey-Kramer post hoc tests. In all cases, P<0.05 was considered statistically significant.
(157) Mammalian ClpXP, an ATPase complex consisting of the catalytic subunit ClpP and the regulatory subunit ClpX, is a mitochondrial protease with unclear physiological functions. The data presented in the following examples show that ClpP knockout (ClpP.sup.−/−) mice expended more energy and had reduced adipose tissue and enhanced insulin sensitivity compared to wild type controls. Drastic increases in mitochondrial chaperones were detected in various organs of ClpP.sup.−/− mice, accompanied with increased mitochondrial numbers. Eliminating ClpP increased mitochondrial function and anti-stress capacity of cells by elevating LRPPRC and/or TRAP1 levels (both of which are proteins with roles in mitochondrial function), which were reversed by knocking down either protein. Hepatic ClpP was responsible for regulating insulin sensitivity while adipocytic ClpP was not. Thus, ClpP is a master regulator of mitochondrial function and stress response, which in turn modulate energy homeostasis, lipid storage, and insulin sensitivity. These data highlight ClpP as a therapeutic target for treating obesity and diabetes.
Example 1
Absence of ClpP in Mice Reduced Adipose Tissue on a Chow or High Fat Diet
(158) To understand the physiological roles of mammalian ClpXP protease, a ClpP knockout (ClpP.sup.−/−) mouse model was generated through a gene-trapping strategy (
(159) However, both male and female adult ClpP.sup.−/− mice were significantly smaller in weight and size than WT and ClpP.sup.+/− littermates (
(160) ClpP.sup.−/− mice had dramatically lower body fat, as measured by total body fat mass or body fat content (% fat mass) (
(161) Next, mice were fed a high-fat diet (HFD) for 2 months to determine the effect of eliminating ClpP on HFD-induced obesity. ClpP.sup.−/− mice were resistant to HFD-induced weight gain, and ClpP.sup.+/− mice showed delayed weight gain within the first 10 days (
(162) Also consistent with lower body fat content, ClpP.sup.−/− mice had much lower levels of plasma leptin than other groups of mice (ClpP.sup.−/−, 0.409±0.224 ng/ml; ClpP.sup.+/−, 1.927±1.928 ng/ml; WT, 2.056±2.022; n=11-12 mice at 5-6 months of age; one way ANOVA, p<0.05). Interestingly, ClpP.sup.−/− mice were infertile, as observed in leptin depleted animal models. While not intending to be bound by any particular theory, it is possible that low leptin levels are responsible for the reproductive defect in ClpP.sup.−/− mice.
Example 2
Absence of ClpP in Mice Altered the Energy Expenditure Profiles
(163) Low leptin levels lead to feeding behavior and adipose deposition in WT mice. Consistent with lower serum leptin levels, the food intake normalized to body weight was significantly higher in ClpP.sup.−/− mice than in WT and ClpP.sup.+/− mice (
(164) A fasting-refeeding approach was used to dissect these two possibilities (
(165) Higher energy consumption may be attributable to hyperactivity or high thermogenesis. The open field test showed similar activity levels among all groups (
Example 3
Absence of ClpP in Mice Improved Insulin Sensitivity
(166) Blood glucose levels and plasma insulin levels in ClpP.sup.−/− mice were analyzed. Blood glucose levels were significantly lower in ClpP.sup.−/− mice than in ClpP.sup.+/− and WT mice (
(167) ClpP.sup.−/− mice were cross-bred with db/db mice (a model of obesity, diabetes, and dyslipidemia) to determine whether and how depleting ClpP affects the obese and diabetic phenotypes of db/db mice. Knocking out ClpP led to a small but significant decrease in body weight of db/db mice (
Example 4
Absence of ClpP in Mice Upregulates Mitochondrial Chaperon Levels
(168) To identify downstream effectors of ClpP, two dimensional (2D) fluorescence difference gel electrophoresis (2D-DIGE) was employed to compare the protein profiles of various organs from mice with different ClpP genotypes (
(169) Strikingly, many of the potential ClpP downstream effectors are related to mitochondrial protein homeostasis, including the molecular chaperones ClpX (mitochondrial Hsp100), TRAP1 (mitochondrial Hsp90), and Grp75 (mitochondrial Hsp70) as well as mitochondrial protease LonP (
Example 5
Absence of ClpP Increased Mitochondrial Numbers and Enhanced Mitochondrial Function and Anti-Stress Capacity
(170) Mitochondrial number and function were analyzed in ClpP.sup.−/− mice. Electron microscopic (EM) study of ClpP.sup.−/− liver sections showed that depletion of ClpP increased mitochondrial numbers and altered mitochondrial morphology in hepatocytes (
(171) To determine whether ClpP regulates mitochondrial function, the respiratory capacity of fibroblasts from ClpP.sup.−/− and WT mice were compared using a Seahorse XF analyzer. ClpP.sup.−/− fibroblasts had a similar basal oxygen consumption rate (OCR) but a significantly higher maximal OCR compared with WT fibroblasts (
Example 6
Mitochondrial Effectors TRAP1, Grp75, and LRPPRC Mediated the Effects of ClpP Absence on Mitochondrial Function and Anti-Stress Capacity
(172) To determine whether and which of the mitochondrial effectors regulated by ClpP mediated the enhanced mitochondrial function seen in ClpP.sup.−/− fibroblasts, lentiviral shRNAs were used to knock down each of them in ClpP.sup.−/− fibroblasts. This was followed by functional assays (
Example 7
Hepatic ClpP Was Responsible For Regulating Insulin Sensitivity
(173) Multiple tissues can affect insulin sensitivity through different mechanisms. ClpP conditional knockout mice (ClpP-cKO) were employed to further dissect the tissue specific mechanism(s) underlying the phenotypes of ClpP.sup.−/− mice. In this mouse model, LoxP sites were inserted to flank the mouse genomic region containing ClpP exons 1-3 for future removal. To delete ClpP specifically in the liver, AAV-CMV-Cre was injected through the tail vein into ClpP-cKO mice. The ClpP levels in livers, detected by immunostaining, were dramatically reduced in Cre-injected mice compared to control AAV-injected mice (
(174) ClpP-cKO mice were also crossed with ap2-Cre mice to establish adipocyte-specific ClpP-KO mice. The ClpP levels in adipose tissues of ClpP-cKO/ap2-Cre mice were about a quarter of those in control mice (
Example 8
In-Vitro Analysis of Small Molecule ClpP Inhibitors in Mouse Embryonic Fibroblast (MEF) Cells
(175) Wild type mouse MEF cells were seeded at 200,000 cells per well at 6 well plates the day before treatment. Cells were treated with the small molecule ClpP inhibitors A2-32-01, AV167, and AV179 (described previously herein) at 10 μM in OPTI-MEM twice a day for 2 days (48 hr). For each treatment, the old medium will be removed and fresh medium added to the wells. After 48 hr treatment, the cells were harvested for western blot analysis or qPCR assay of ClpP substrates.
(176) As shown in
(177) Based on these in vitro data, further in vivo testing of A2-32-01 in high fat diet (HFD)-induced obesity and diabetes mouse models was performed as described in Example 9 below.
Example 9
In-Vivo Analysis of Small Molecule ClpP Inhibitor A2-32-01 in High Fat Diet (HFD)-Induced Obesity and Diabetes Mouse Models
(178) 7-9 month old WT female (20 mice), were fed with high fat diet for 3 weeks. Body weight change and blood glucose/plasma insulin levels in response to HFD were measured. At the beginning of the 4.sup.th week, for treatment group, A2-32-01 was injected peritoneally twice daily at 300 mg/kg for 8 days. For the control group, corn oil (vehicle) was injected. The mice were maintained on HFD. The body weight change was followed every day. At the 8.sup.th day of A2-32-01 injection, blood glucose levels were measured, and a glucose tolerance test was applied to measure insulin sensitivity. Body weight data from the first seven days of in vivo A2-32-01 treatment is provided in
Example 10
Continued In-Vivo Analysis of Small Molecule ClpP Inhibitor A2-32-01 in High Fat Diet (HFD)-Induced Obesity and Diabetes Mouse Models (Prophetic)
(179) The in-vivo analysis of Example 9 is continued, with collection of the blood and multiple organs (liver/muscle/brain) at day 9 of A2-32-01 injection. Mitochondria are isolated from mouse liver and ClpP activity is tested using peptide substrates, e.g., as described herein. Western blot analysis is performed to detect ClpP substrate levels.
Example 11
Continued In-Vivo Analysis of Small Molecule ClpP Inhibitor A2-32-01 in High Fat Diet (HFD)-Induced Obesity and Diabetes Mouse Models
(180) The in-vivo analysis described in Examples 9 and 10 was continued in accordance with the experimental protocol shown in
Example 12
In-Vivo Analysis of Small Molecule ClpP Inhibitor A2-32-01 in db/db Mice
(181) The following in-vivo analysis of db/db mice (a model of obesity, diabetes, and dyslipidemia—see, e.g., Kobayashi et al. Metabolism. 2000 January; 49(1):22-31.) was conducted according to the experimental scheme set forth in