IMMUNOGEN

20220249649 · 2022-08-11

    Inventors

    Cpc classification

    International classification

    Abstract

    Polypeptides useful in the preparation of vaccine compositions against RSV are provided. Also disclosed are methods of enhancing subdominant antibody responses in a subject.

    Claims

    1. A vaccine composition against a target pathogen, the composition comprising a plurality of non-naturally occurring immunogenic polypeptides; at least a first of said immunogenic polypeptides comprising a mimic peptide having an amino acid sequence having a tertiary structure which, when folded, mimics a complex and/or discontinuous neutralisation epitope from said target pathogen.

    2. The vaccine composition of claim 1, wherein each of said plurality of non-naturally occurring immunogenic polypeptides comprises a mimic peptide having an amino acid sequence which, when folded, mimics a complex and/or discontinuous neutralisation epitope from said target pathogen.

    3. The vaccine composition of claim 2, wherein each of said complex and/or discontinuous neutralisation epitopes are non-overlapping.

    4. The vaccine composition of any preceding claim, wherein said target pathogen is RSV.

    5. The vaccine composition of claim 4, wherein said complex and/or discontinuous neutralisation epitopes are selected from the group consisting of RSV site 0, site II, and site IV.

    6. The vaccine composition of claim 5, wherein said immunogenic peptides are selected from the peptides described in tables 3 to 6, and preferably from tables 5 or 6.

    7. The vaccine composition of any preceding claim wherein said immunogenic peptide comprises a scaffold, preferably a peptide scaffold, which presents the mimic peptide so as to assist the mimicking of the complex and/or discontinuous neutralisation epitope.

    8. The vaccine composition of claim 7 wherein said scaffold is selected from RSVN and ferritin.

    9. The vaccine composition of any preceding claim, in combination with a vaccine composition comprising a native immunogen from the target pathogen.

    10. A vaccine composition comprising the S0_2.126 peptide sequence as described herein, and the S4_2.45 peptide sequence as described herein, and optionally further comprising the FFL_001 or FFLM peptides.

    11. A vaccine composition of any preceding claim, wherein said target pathogen is RSV, for use in a method for immunising a subject against RSV, the method comprising a) administering said vaccine composition to a subject; and b) prior to said administration, administering a further vaccine composition comprising an RSV-derived protein or glycoprotein, preferably the RSVF glycoprotein, or wherein the vaccine composition of any preceding claim is administered to a subject who has previously been exposed to RSV infection.

    12. A method for designing a peptide to mimic a complex and/or discontinuous structural configuration of a target peptide, the method comprising the steps of: determining a complex and/or discontinuous structural configuration of a target peptide to mimic; identifying a preliminary mimic peptide having an amino acid sequence; determining likely structural configuration of said preliminary mimic peptide amino acid sequence by in silico analysis of said sequence; performing directed evolution on said preliminary mimic peptide to generate a range of variants of said peptide; (preferably wherein directed evolution may be performed by mutagenesis to generate variants and expression of said variants); and selecting for variants of said peptide which display an improvement in a desired characteristic seen in said target peptide (said characteristic may be, for example, binding affinity to a target such as an antibody; thermal stability; susceptibility or resistance to an enzyme).

    13. The method of claim 12 further comprising the steps of identifying a plurality of said variants having improvements, and providing a further peptide having a combination of variations from said plurality of variants.

    14. The method of claim 12 or 13 wherein said step of identifying a preliminary mimic peptide comprises selecting a peptide from a peptide database having a structural similarity to the desired target peptide; or wherein said step comprises combining an amino acid sequence from said target peptide with one or more structural peptide elements such that said preliminary mimic peptide sequence has a structural similarity to the desired target peptide.

    Description

    BRIEF SUMMARY OF THE FIGURES

    [0034] These and other aspects of the invention will now be described in detail, and with reference to the following figures.

    [0035] FIG. 1—Conceptual overview of the computational design of synthetic immunogens to elicit RSV neutralizing antibodies focused on three distal epitopes. (A) Prefusion RSVF structure (PDB 4JHVV) with sites 0, II and IV highlighted. An immunogen for site II was previously reported (11). (B) Computational protein design strategies. Approach 1: Design templates were identified in the PDB based on loose structural similarity to site Oily, followed by in silico folding and design, and sequence optimization through directed evolution. Approach 2: A motif-centric design de novo design approach was developed to tailor the protein topology to the motif's structural constraints. Bottom: Computational models of designed immunogens with the different approaches. (C) Cocktail formulations of three synthetic immunogen nanoparticles elicit neutralizing antibodies (nAbs) focused on three non-overlapping epitopes.

    [0036] FIG. 2—Templated computational design and biophysical characterization of RSVF synthetic immunogen. (A) Protein design strategy. Templates with structural similarity to sites 0 and IV were identified in the PDB, followed by in silico folding, design and directed evolution optimization. An additional in silico folding and design step was necessary to install site 0 on a truncated template sequence revealed by directed evolution. Computational models of intermediates and final designs (S0_1.39 and S4_1.5) are shown. (B) CD spectra measured at 20° C. of S0_1.39 (top) and S4_1.5 (bottom), are in agreement with the expected secondary structure content of the design model. (C) Thermal melting curves measured by CD at 208 nm in presence of 5 mM TCEP reducing agent. (D) Binding affinity measured by SPR against target antibodies D25 (top) and 101F (bottom). CD=Circular dichroism, T.sub.m=melting temperature. SPR=Surface plasmon resonance.

    [0037] FIG. 3—Motif-centric de novo design of epitope-focused immunogens. (A) Ideal secondary structure elements (SSE) are assembled around RSVF epitopes, sampling different orientations within the same topology, followed by a single round of in silico folding and design. See FIG. 12 for further details. Rosetta abinitio simulations are performed for each topology to assess its propensity to fold into the designed structures, returning a foldability score. Selected designs are then displayed on yeast surface and sorted under two different selection pressures for subsequent deep sequencing. (B) Enrichment analysis of sorted populations under high and low selective pressures. Sequences highly enriched for both D25 and 5C4 binding show convergent sequence features in critical core positions of the site 0 scaffold. (C) All three designed topological variations were screened for high affinity binding and resistance to chymotrypsin to select stably folded proteins. Enrichment analysis revealed a strong preference for one of the designed helix orientations (S4_2_ bb2) to resist to protease digestion and bind with high affinity to 101F (green). (D) Thermal melting curves measured by CD for best designs (S0_2.126, top and S4_2.45, bottom) showing high thermostability. (E) Dissociation constants (K.sub.D) of S0_2.126 to D25 (top) and S4_2.45 to 101F antibodies measured by SPR.

    [0038] FIG. 4—Structural characterization of de novo designed immunogens. (A) Crystal structure of S4_2.45 (orange) bound to 101F Fab closely matches design model (grey, RMSD=1.5 Å). (B) NMR structural ensemble of S0_2.126, D25 epitope highlighted in purple. The NMR structure is well in agreement with the design model (backbone RMSD of 2.8 Å). (C) Crystal structure of S0_2.126 (purple) bound to D25 Fab closely resembles the design model (grey, RMSD=1.3 Å). (D) Superposition of the native preRSVF site 0/IV and designed immunogens shows sub-angstrom mimicry of the epitopes. Designed scaffolds are compatible with the shape constraints of preRSVF (surface representation). (E) Close-up view of the interfacial side-chain interactions between D25 (top) and 101F (bottom) with designed immunogens as compared to the starting epitope structures (preRSVF, site IV peptide).

    [0039] FIG. 5—Synthetic immunogens elicit neutralizing serum responses in mice and NHPs and focus pre-existing immunity on sites 0 and II. (A-C) Trivax2 immunization study in mice. (A) PreRSVF cross-reactive serum levels following three immunizations with single immunogens or Trivax2 cocktail (day 56). (B) Serum specificity shown for 5 representative mice immunized with Trivax2, as measured by an SPR competition assay with D25, Motavizumab and 101F IgGs as competitors, shows an equally balanced response towards all sites. (C) RSV neutralization titer of mice at day 56, immunized with Trivax2 components individually and as cocktail. Dotted line (IC.sub.50=100) indicates protective threshold. (D-K) Trivax1 immunization study in NHPs. (D) NHP immunization scheme. (E) PreRSVF cross-reactive serum levels for group 1. (F) Serum antibodies target all three antigenic sites in all 7 animals as measured by an SPR competition assay. (G) RSV neutralization titers of group 1. (H) PreRSVF titer in group 2 (grey) and 3 (blue). (I) RSV neutralization titer of group 2 and 3. (J) Site-specific antibody levels measured by SPR competition assay. Site 0 and site II-specific titers were significantly higher in group 3 compared to 2 following Trivax1 boosting (p<0.05, Mann-Whitney U test). (K) RSV neutralization curves upon depletion of day 91 sera with site 0, II, IV-specific scaffolds. 60% of the neutralizing activity is competed in group 3, whereas no significant decrease is observed in the control group 2.

    [0040] FIG. 6—The increase in structural complexity of the functional motifs determine the number of designable templates that are found in known structures. A MASTER search {Zhou, 2015 #1431} was performed over the nrPDB30 database containing a total of 17539 structures, querying the number of matches for different neutralization epitopes (colored in blue in the structures) of increasing structural complexity. The fraction of the database recovered is plotted on the y-axis. Matches were filtered for protein size <180 residues. The vertical line (orange) indicates the RMSD cutoff for the first 10 scaffold identified. Secondary structure composition of the motifs is represented by: E—strand; L—Loop; H—helix; x—chain break.

    [0041] FIG. 7—Computational design and experimental optimization of S4_1 design series. A) Template identification and computational design of S4_1.1. RSVF antigenic site IV is located in a small contained domain of preRSVF. This excised domain failed to show a folding funnel in Rosetta abinitio predictions, and failed to express recombinantly in E. coli. Using the excised domain as template, we folded and sequence-designed this topology using Rosetta FunFolDes, yielding design S4_1.1 which showed a strong funnel-shape energy landscape in abinitio folding simulation. B) Experimental optimization of S4_1.1 through saturation mutagenesis. A saturation mutagenesis library was constructed using overhang PCR for 11 positions proximal to the site IV epitope, allowing one position at a time to mutate to any of the 20 amino acids, encoded by the degenerate codon ‘NNK’. The library (size 11 positions×32 codons=352) was transformed in yeast, and designs were displayed on the cell surface. The selection was done by labeling the cells with 125 nM of 101F antibody. The top 1% of clones binding with high affinity to 101F antibody were then sorted, as well as the bottom 99% as shown. Following next-generation sequencing of the two populations, the enrichment values were computed for each sequence variant. C) Bioinformatic analysis of deep mutational scanning data. The log(enrichment) is shown as heatmap for each sequence variant. White indicates missing data. Position 20 showed the highest enrichment for arginine and lysine, together with other less pronounced enrichments seen for other positions.

    [0042] FIG. 8—Experimental characterization of S4_1 design series. A) Top: Surface plasmon resonance measurement for the initial computational design S4_1.1 against 101F antibody revealed a dissociation constant of >85 μM. Middle: Despite low affinity, an R29S mutant revealed that binding was specific to the epitope of interest. Bottom: Circular dichroism spectrum of S4_1.1. B) Top: Dissociation constants for single and combined mutations of S4_1.1 that were identified in the deep mutational scanning screen. K20/E24 double mutant (named S4_1.5) showed a binding affinity of 35 nM (middle). Bottom: Circular dichroism spectrum of S4_1.5.

    [0043] FIG. 9—Computational design and experimental optimization of S0_1 design series. A) Template identification and design. Using MASTER, we identified a designed helical repeat protein (PDB ID: SCWJ) to serve as design template to present and stabilize antigenic site 0 (see methods for details). The Nterminal 29 residues were truncated to avoid clashing with the D25 antibody, and Rosetta FunFolDes was used to design S0_ 1.1. See methods for details on the design process. B) Based on S0_1.1, a combinatorial sequence library was constructed and screened using yeast surface display. After three consecutive sorts of high-affinity binding clones, individual colonies were sequenced. Position 100 was frequently found to be mutated to a stop codon, leading to a truncated variant with increased expression yield. C) A model of the truncated variant served as template for a second round of in silico folding and design. We truncated the template further by the N terminal 14 residues, and introduced a disulfide bond between residues 1 and 43, leading to S0_1.39. See methods for full details on the design selection process.

    [0044] FIG. 10—Biophysical characterization of the S0_1 design series. Top: Circular dichroism spectra. Middle: Surface plasmon resonance measurements against D25 and 5C4. Bottom: Multi-angle light scattering coupled to size exclusion chromatography. A) S0_1.1 bound with a KD of 1.4 μM to D25 and no detectable binding to 5C4. To verify that the binding interaction was specific to the epitope we generated a knockout mutant (N30Y) and observed that the binding interaction was absent. B) S0_1.17 showed a KD of 270 nM to D25 and no binding to 5C4. C) S0_1.39 binds with a KD of 5 nM to 5 D24 and 5C4. All designs showed CD spectra typical of helical proteins and behaved as monomers is solution (Top and bottom rows).

    [0045] FIG. 11—Shape mimicry of computationally designed immunogens compared to prefusion RSVF. A) Designed immunogens (S2_1.2, S0_2.126, S4_2.45) superimposed to prefusion RSVF (PDB 4JHW), shown in surface representation (grey). (B, C) Close-up view of S0_1.39 and S4_1.5 with RSVF shown in surface representation. The design template used for the S0_1.39 design violates the shape constraints of the site 0 epitope in its native environment (preRSVF). While site 0 is freely accessible for antibody binding in preRSVF, the C-terminal helix of S0_1.39 constrains its accessibility (dark grey surface). (D) The design template used for the previously designed site II antigen respected the site II quaternary environment. (E,F) De novo templates were built in order to respect the epitope's shape constraints, and to improve epitope stabilization compared to naturally occurring design templates.

    [0046] FIG. 12—De novo computational method to assemble idealized SSEs and motif of interest.

    [0047] FIG. 13—De novo backbone assembly for site IV immunogen. The site IV epitope was stabilized with three antiparallel beta strands built de novo, and a helix packing in various orientations against this beta sheet (bb1-bb3). Each backbone was simulated in Rosetta abinitio simulations for its ability to fold into a low energy state that is close to the design model, indicating that S4_2_bb2 and bb3 have a stronger tendency to fold into the designed fold.

    [0048] FIG. 14—Biophysical characterization of de novo site IV designs. Shown are circular dichroism spectra and SPR sensorgrams against 101F for 13 designs of the S4_2 design series that were enriched for protease resistance and binding to 101F in the yeast display selection assay.

    [0049] FIG. 15—Biophysical characterization of S4_2.45 (A,C,E) and S0_2.126 (B,D,F). A,B: S4_2.45 and S0_2.126 are monomeric in solution as shown by SEC-MALS profile. C,D: Circular dichroism spectra at 25° C. E,F: 2D NMR of 15N HSQC spectra for S4_2.45 (E) and S0_2.126 (F) are well dispersed, confirming that the designs are well folded in solution.

    [0050] FIG. 16—De novo topology assembly to stabilize site 0. Three customized helical orientations were assembled (S0_2_bb1-bb3) to support site 0 epitope, and evaluated for their ability to fold into the designed topology in Rosetta abinitio simulations. S0_2_bb3 showed a funnel-shaped energy landscape, and was selected for subsequent sequence design.

    [0051] FIG. 17—(A) Binding affinity measurement for D25 and 5C4 binding of de novo site 0 scaffolds. Shown are the SPR sensorgrams of enriched designs that were successfully expressed and purified after the yeast display selection. (B) Sequence alignment of experimentally characterized sequences.

    [0052] FIG. 18—Binding affinity of designed immunogens towards panels of site-specific, human neutralizing antibodies and human sera. A) Binding affinity (KD, determined by SPR flowing Fabs as analyte) of S0_1.39 (grey) and S0_2.126 (black) towards a diverse panel of site-specific neutralizing antibodies, in comparison to prefusion RSVF (blue). Antibodies shown for site 0 are 5C4, D25 (1), ADI-14496, ADI-18916, ADI-15602, ADI-18900 and ADI-19009 (2). For site IV, the binding affinity was tested against 101F (3), ADI-15600 (2), 17E10, 6F18 and 2N6 (4), comparing S4_1.5 (grey) and S4_2.45 (black) to prefusion RSVF. The higher binding affinity of the second-generation designs (S0_2.126 and S4_2.45) compared to the first-generation and to prefusion RSVF indicates a greatly improved, near-native epitope mimicry of the respective antigenic sites in the designed immunogens. B) ELISA reactivity of designed immunogens with sera obtained from 50 healthy human adults that were seropositive for prefusion RSVF. Both S0_2.126 and S4_2.45 showed significantly increased reactivity compared to the first-generation designs, confirming an improved epitope-mimicry on the serum level (*p<0.05 and **p<0.01, Wilcoxon test).

    [0053] FIG. 19—Comparison of S0_2.126 Rosetta scores against natural proteins. Protein structures within the same size as S0_2.126 (57+/−5 residues) were downloaded from the CATH database and filtered by 70% sequence homology, yielding a representative database of natural proteins with similar size as S0_2.126 (n=1,013 structures). Proteins were then minimized and scored by Rosetta to compute their radius of gyration, intra-protein cavities (cavity) and core packing (packstat). Plotted is the distribution for these score terms in 1,013 natural proteins (blue histogram), and the same scores for S0_2.126 are shown in orange. The NMR structure of S0_2.126 is shown in (A), the computational model of S0_2.126 is shown in (B), indicating that, despite similar radius of gyration, S0_2.126 shows a substantial cavity volume as well as a very low core packing compared to natural proteins of similar size.

    [0054] FIG. 20—Electron microscopy analysis of site-specific antibodies in complex with RSVF trimer. (A) Superposed size-exclusion profiles of unliganded RSVF (black line) and RSVF in complex with 101F (green line), D25 (blue line), Mota (purple line) and all three (101F, D25, Mota—red line) Fabs. (B-F) Representative reference-free 2D class averages of the unliganded RSVF trimer (B) and RSVF in complex with 101F (C), D25 (D), Mota (E) or all three (101F, D25, Mota (F)) Fabs. Fully-saturated RSVF trimers bound by Fabs are observed, as well as sub-stoichiometric classes. (G) Left panel: referencefree 2D class average of RSVF trimer with three copies of 101F, D25 and Mota Fabs visibly bound. Right panel: predicted structure of RSVF trimer with bound 101F, D25 and Mota Fabs based on the existing structures of RSVF with individual Fabs (PDB ID 4JHW, 3QW0 and 3045). The predicted structure of RSVF in complex with 101F, D25 and Mota was used to simulate 2D class averages in Cryosparc2, and simulated 2D class average with all three types of Fabs is shown in the middle panel. Fabs are colored as follow: red—101F; blue—Mota; green—D25. Scale bar—100 Å.

    [0055] FIG. 21—Composition and EM analysis of Trivaxl RSVN nanoparticles. A) Trivax1 contains equimolar amounts of site II, 0 and IV epitope focused immunogens fused to the self-assembling RSVN nanoparticle with a ring-like structure (n 32 10-11 subunits). The site II-RSVN nanoparticle has been described previously (5). Shown are the computational models for the nanoparticles-immunogen fusion proteins. B,C) Negative stain electron microscopy for S0_1.39-RSVN and S4_1.5-RSVN nanoparticles confirms that the ring-like structure is maintained upon fusion of the designed immunogens.

    [0056] FIG. 22—EM analysis of Trivax2 ferritin nanoparticles. A,B,D,E) Negative stain electron microscopy (A,D) and 3D reconstruction (B,E) for S0_2.126 and S4_2.45 fused to ferritin nanoparticles. C) Binding affinity of S0_2.126 nanoparticle (blue) to 5C4 antibody in comparison to S0_2.126 monomer (red), showing that S0_2.126 has been successfully multimerized and antibody binding sites are accessible. F) Binding of S4_2.45 to 101F antibody when multimerized on ferritin nanoparticle (blue) compared to monomeric S4_2.45 (red), indicating that the scaffold is multimerized and the epitope is accessible for antibody binding.

    [0057] FIG. 23—Mouse immunization studies with Trivaxt A) RSVF cross-reactivity of epitope-focused immunogens formulated individually, as cocktail of two, and three (Trivax1). B) RSV neutralizing serum titer of mice immunized with designed immunogens and combinations thereof.

    [0058] FIG. 24—Confirmation of NHP neutralization titer by an independent laboratory. Sera from indicated timepoints were tested for RSV neutralization by an independent laboratory in a different RSV neutralization assay, using a Vero-118 cell line and a GFP readout. See (6) for method details.

    [0059] FIG. 25—NHP serum reactivity with designed immunogens. A) ELISA titer of NHP group 1 (immunized with Trivax1) measured at different timepoints. All animals responded to Trivax1 immunogens at day 91, with site IV immunogen reactivity lower compared to site 0 and site II reactivity. B) ELISA titer of NHP group 2 (grey, RSVF prime) and 3 (blue, RSVF prime, Trivax1 boost) (see FIG. 5 for immunization schedule). Following the priming immunization, all animals developed detectable cross-reactivity with the designed immunogens, indicating that the designed scaffolds recognized relevant antibodies primed by RSVF.

    [0060] References for legends to FIGS. 6-25 only: [0061] 1. J. S. McLellan et al., Structure of RSV fusion glycoprotein trimer bound to a prefusion specific neutralizing antibody. Science 340, 1113-1117 (2013). [0062] 2. M. S. Gilman et al., Rapid profiling of RSV antibody repertoires from the memory B cells of naturally infected adult donors. Sci Immunol 1, (2016). [0063] 3. J. S. McLellan et al., Structure of a major antigenic site on the respiratory syncytial virus fusion glycoprotein in complex with neutralizing antibody 101F. J Virol 84, 12236-12244 (2010). [0064] 4. J. J. Mousa et al., Human antibody recognition of antigenic site IV on Pneumovirus fusion proteins. PLoS Pathog 14, e1006837 (2018). [0065] 5. F. Sesterhenn et al., Boosting subdominant neutralizing antibody responses with a computationally designed epitope-focused immunogen. PLoS Biol 17, e3000164 (2019). [0066] 6. E. Olmedillas et al., Chimeric Pneumoviridae fusion proteins as immunogens to induce cross-neutralizing antibody responses. EMBO Mol Med 10, 175-187 (2018).

    DETAILED DESCRIPTION OF THE INVENTION

    De Novo Design of Immunogens with Structurally Complex Epitopes

    [0067] Designing proteins with structurally complex functional sites has remained a largely unmet challenge on the field of computational protein design. We sought to design accurate mimetics of RSV neutralization epitopes, which have been particularly well studied structurally, and evaluate their functionality in immunization studies. We chose antigenic sites 0 and IV (FIG. 1), which are both targeted by potent nAbs, and are structurally distinct from functional motifs that have previously been handled by computational protein design algorithms. The antigenic site 0 presents a structurally complex and discontinuous epitope consisting of a kinked 17-residue alpha helix and a disordered loop of 7 residues, targeted by nAbs D25 and 5C4 (12, 14), while site IV presents an irregular 6-residue bulged beta-strand and is targeted by nAb 101F (13).

    [0068] The computational design of proteins mimicking structural motifs has previously been performed by first identifying compatible protein scaffolds, either from naturally occurring structures or built de novo, which then serve as design templates to graft the motif (5, 6, 8, 15, 16). Given the structural complexity of sites 0 and IV, this approach did not yield any promising matches even with loose structural criteria (FIG. 6).

    [0069] Thus, for site IV, we noticed that a small structural domain that resembles an immunoglobulin fold containing the epitope could be excised from the preRSVF structure, hypothesizing this would be a conservative approach to maintain its native, distorted epitope structure (FIG. 7). The excised domain did not show a folding funnel in Rosetta abinitio simulations, and could not be expressed in E. coli, prompting us to perform in silico folding and design with Rosetta FunFolDes (17) to optimize the sequence for stability and epitope mimicry (FIG. 2a). The best computational designs for site IV (S4_1.1) bound with a K.sub.D>85 μM to the 101F target antibody. To improve binding affinity, we generated a deep mutational scanning library for selected positions, sorted clones with higher affinity and used next-generation sequencing to identify positions and amino acids that were enriched for high-affinity binding (FIG. 7). We tested combinations of enriched positions in recombinantly expressed proteins for antibody binding, obtaining a double mutant (S4_1.5) that bound with a K.sub.D of 35 nM to the target antibody, showed a circular dichroism (CD) spectrum corresponding to the secondary structure content designed, and that was thermostable up to 65° C. (FIG. 2b-d and FIG. 8).

    [0070] The discontinuous structure of site 0 was not amenable for a domain excision and stabilization approach. We searched for template structures that mimicked the helical segment of the epitope, and simultaneously allowed to graft the loop segment, and selected a designed helical repeat protein as design template (PDB 5cwj) (FIG. 2a and FIG. 9) (18). In order to avoid clashing with the target antibody D25, we truncated the N-terminal 29 residues of the 5cwj template, and performed in silico folding and design simulations to perform local and global changes on the scaffold to allow the presentation of the site 0 epitope (FIG. 2a). Out of 9 sequences tested, 2 were successfully expressed in E. coli and behaved as monomers in solution (FIG. 10). The best design, named S0_1.1, bound with a K.sub.D of 1.4 μM to the D25 target antibody (FIG. 10), which is four orders of magnitude lower than the target affinity (19). Following multiple rounds of directed evolution using yeast display, we found a sequence that was C-terminally truncated by 29 residues (S0_1.17), which was enriched and showed greatly increased expression yield, as well as a ˜5-fold increased affinity towards D25 (FIG. 9-10). We used the truncated structure as a new template for in silico folding and design. Ultimately, this multi-stage process yielded S0_1.39, a design truncated by another 13 residues, which bound with 5 nM to D25 (FIG. 2d). S0_1.39 also gained binding to the 5C4 antibody (FIG. 10), which was shown to engage site 0 from a different orientation, with an affinity of 5 nM, identical to that of the 5C4-preRSVF interaction (19).

    [0071] The primary goals for the designs were achieved in terms of the stabilization of irregular and complex binding motifs in a conformation relevant for antibody binding, however, the overall strategy presented important limitations with respect to its general utility. Despite the large number of structures available to serve as design templates, the number of those that are practically useful for the design of functional proteins becomes increasingly limited with the structural complexity of the motif. As described above, suboptimal design templates require extensive backbone flexibility on the design process and multiple rounds of directed evolution until a sequence with high-affinity binding is identified. Additionally, the starting topology determines the overall shape of the designed protein, which may be suboptimal for the accurate stabilization of the motif, and may oppose unwanted tertiary steric constraints that interfere with the designed function. In particular, for immunogen design it would be advantageous to preserve native-like accessibility of the epitope to maximize the induction of functional antibodies that can cross-react with the proteins presented by the pathogen. An illustrative example on how a template-based design approach can fail to fulfil these criteria is the comparison between the quaternary environment of the site 0 epitope in preRSVF and S0_1.39 showing that this topology does not mimic such environment, albeit allowing the binding of several monoclonal antibodies (FIG. 11).

    [0072] To overcome these limitations, we developed a template-free design protocol—the TopoBuilder—that generates tailor-made topologies to stabilize complex functional motifs. Within the TopoBuilder, we sample parametrically the placement of idealized secondary structure elements which are then connected by loop segments, to assemble topologies that can stabilize the desired conformation of the structural motif. These topologies are then diversified to enhance structural and sequence diversity with a folding and design stage using Rosetta FunFoldDes (see FIG. 12 and methods for full details). For this approach, we defined two new design objectives which were not met by our previous designs using available structural templates: (1) building stable topologies de novo that stabilize the epitope, while mimicking its native quaternary environment; (2) Fine-tuning the topology's secondary structure arrangement to maximize the fold stability and optimize epitope presentation for high affinity antibody binding.

    [0073] To present antigenic site IV, we designed a fold composed of a β-sheet with 4 antiparallel strands and one helix (FIG. 3a), referred to as S4_2 fold. Within the S4_2 topology, we generated three distinct structural variants (S4_2_bb1-3), by sampling parametrically three distinct helical secondary structural elements, varying orientations and lengths to maximize the packing interaction against the β-sheet. Sequences generated from 2 out of the 3 structural variants (S4_2_bb2 and S4_2_bb3) showed a strong tendency to recover the designed structures in Rosetta abinitio simulations (FIG. 3a and FIG. 13).

    [0074] We screened a defined set of computationally designed sequences using yeast display and applied two selective pressures—binding to 101F and resistance to the unspecific protease chymotrypsin, an effective method to digest partially unfolded proteins (5, 20, 21). Deep sequencing of populations sorted under different conditions revealed that S4_2_bb2-based designs were strongly enriched under stringent selection conditions for folding and 101F binding, showing that subtle topological differences in the design template can have substantial impact on function and stability. We expressed 15 S4_2_bb2 design variants and successfully purified and biochemically characterized 14. The designs showed mixed alpha/beta CD spectra and bound to 101F with affinities ranging from 1 nM to 1 μM (FIG. 14). The best variant, S4_2.45 (K.sub.D=1 nM), was well folded and thermostable according to CD and NMR with a T.sub.m of 75° C. (FIG. 3d and FIG. 20).

    [0075] Similarly, we built a minimal de novo topology to present the tertiary structure of the site 0 epitope. The choice for this topology was motivated by the fact that site 0, in its native environment preRSVF, is accessible for antibody binding from diverse angles (14), in contrast to the S0_39 natural template which topologically constrained site 0 accessibility (FIG. 11). By building a template de novo, we attempted to mimic the native quaternary constraints and improve the binding affinity to the site 0 specific monoclonal antibodies.

    [0076] We explored the topological space within the shape constraints of preRSVF and built three different helical orientations that support both epitope segments. Evaluation of the designed sequences with Rosetta abinitio showed that only sequences generated based on one of the three topologies (S0_2_bb3) presented a funnel-shaped energy landscape (FIG. 16). A set of computationally designed sequences based on S0_2_bb3 was screened in yeast under the selective pressure of two site 0-specific antibodies (D25 and 5C4) to ensure the integrity of the epitope. Deep sequencing of the double-enriched clones and subsequent sequence analysis revealed that a valine at position 28 is critical to retain a cavity formed between the two epitope segments, ensuring binding to both antibodies (FIG. 3b).

    [0077] We selected 5 sequences, differing in 3-21 positions, for further biochemical characterization (FIG. 17). The design with best solution behaviour (S0_02.126) showed a CD spectrum of a mostly helical protein, with extremely high thermostability even under reducing conditions (T.sub.m=81° C., FIG. 3d) and a well-dispersed HSQC NMR spectrum (FIG. 15). Strikingly, S0_02.126 bound with ˜50 μM affinity to D25, similar to that of the preRSVF-D25 interaction (150 μM), and with a K.sub.D=4 nM to 5C4 (FIG. 3e and FIG. 18).

    [0078] Overall, the properties of the designs generated by topological assembly with the TopoBuilder showed improved binding affinities and thermal stabilities as compared to those using available structural templates. To investigate whether this design and screening procedure yielded scaffolds that better mimicked the viral epitope presented, or rather revealed sequences with a highly optimized interface towards the antibodies used during the selection, we determined the affinity of S4_2.45 and S0_2.126 against a panel of site-specific antibodies. Compared to the first-generation designs, S4_2.45 and S0_2.126 showed large affinity improvements to diverse panels of site-specific antibodies, exhibiting a geometric mean affinity closely resembling that of the antibodies to preRSVF (FIG. 18). In the light of such results, we concluded that the topologically designed immunogens were improved mimetics of site IV and 0 as compared to template-based designs.

    De Novo Designed Topologies Adopt the Predicted Structures

    [0079] To evaluate the structural accuracy of the computational design approach, we solved the crystal structure of S4_2.45 in complex with 101F at 2.6 Å resolution. The structure closely matched our design model, with a full-atom RMSD of 1.5 Å. The epitope was mimicked with an RMSD of 0.135 ↑, and retained all essential interactions with 101F (FIG. 4a). Importantly, the structural data confirmed that we presented an irregular beta strand, a common motif found in many protein-protein interactions (22), in a fully de novo designed protein with sub-angstrom accuracy.

    [0080] Next, we solved an unbound structure of S0_2.126 by NMR, confirming the accuracy of the designed fold with a backbone RMSD between the average structure and the model of 2.8 Å (FIG. 4b). Additionally, we solved a crystal structure of S0_2.126 bound to D25 at a resolution of 3.0 ↑. The structure showed an overall RMSD of 1.5 Å to the design model, and an RMSD of 0.9 Å over the discontinuous epitope compared to prefusion RSVF (FIG. 4c-d). To the best of our knowledge, this is the first computationally de novo designed protein that presents a two-segment, structurally irregular, binding motif with atomic-level accuracy. In comparison with native proteins, S0_2.126 showed exceptionally low packing due to a large core cavity (FIG. 19), but retained a very high thermal stability. The core cavity was essential for antibody binding and highlights the potential of de novo approaches to design small proteins hosting structurally challenging motifs and preserving cavities required for function (2). Notably, due to the level of control and precision of the TopoBuilder, both designed antigens respected the shape constraints of the respective epitope in their native environment preRSVF, a structural feature that may be important for the improved elicitation of functional antibodies (FIG. 11).

    Cocktails of Designed Immunogens Elicit Neutralizing Antibodies In Vivo

    [0081] Lastly, we sought to evaluate the designed antigens for their ability to elicit antibody responses in vivo. Our rationale for combining site 0, II and IV immunogens in a cocktail formulation is that all three sites are non-overlapping, as verified by electron microscopy analysis (FIG. 20), and thus could induce a broader antibody response in vivo. To increase immunogenicity, each immunogen was multimerized on self-assembling protein nanoparticles. We chose the RSV nucleoprotein (RSVN), a self-assembling ring-like structure containing 10-11 subunits, previously been shown to be an effective carrier for the site II immunogen (23), and formulated a trivalent immunogen cocktail containing equimolar amounts of S0_1.39, S4_1.05 and S2_1.2 immunogen nanoparticles (“Trivax1”, FIG. 21). The fusion of S0_2.126 and S4_2.45 to RSVN yielded poorly soluble nanoparticles, prompting us to use ferritin particles for multimerization, with a 50% occupancy (˜12 copies), creating a second cocktail that contained S2_1.2 in RSVN and the remaining immunogens in ferritin (“Trivax2”, FIG. 22).

    [0082] In mice, Trivax1 elicited low levels of RSVF cross-reactive antibodies, and sera did not show

    [0083] RSV neutralizing activity in most animals (FIG. 23). In contrast, Trivax2 induced robust levels of RSVF cross-reactive serum levels, and the response was balanced against all three epitopes (FIG. 5a,b). Strikingly, Trivax2 immunization yielded RSV neutralizing activity above the protective threshold in 6/10 mice (FIG. 5c). Remarkably, these results show that vaccine candidates composed of de novo designed proteins mimicking viral neutralization epitopes can induce robust antibody responses in vivo, targeting multiple specificities. This is an important finding given that mice have been a traditionally difficult model to induce neutralizing antibodies with scaffold-based design approaches (11, 15).

    [0084] In parallel, we sought to test the potential of a trivalent immunogen cocktail in NHPs. The previously designed site II immunogen showed promise in NHPs, but induced neutralizing titers were low and inconsistent across animals, requiring up to five immunizations to elicit neutralizing antibodies in 2/4 animals (11). We immunized seven RSV naïve NHPs with Trivax1, as detailed in FIG. 5d. In contrast to mice, NHPs developed robust levels of RSVF cross-reactive serum titer in all animals (FIG. 5e), and antibodies induced were directed against all three epitopes (FIG. 5f). Strikingly, we found that 6/7 NHPs showed RSV neutralizing serum levels above the protective threshold after a single boosting immunization (mean IC.sub.50=312) (FIG. 5g). Neutralization titers were maximal at day 84 (median IC.sub.50=408), four-fold above the protective threshold (19), and measurements were confirmed by an independent laboratory (FIG. 24).

    [0085] While immunization studies in naïve animals are important to test the designed immunogens, an overarching challenge for vaccine development to target pathogens such as RSV, influenza, dengue and others is to focus or reshape pre-existing immunity of broad specificity on defined neutralizing epitopes that may be of higher-quality and mediate long-term protection (23). To mimic a serum response of broad specificity, we immunized 13 NHPs with prefusion RSVF. All animals developed strong preRSVF-specific titers and cross-reactivity with all the epitope-focused immunogens, indicating that epitope-specific antibodies were primed and recognized by the designed immunogens (FIG. 25). Group 2 (6 animals) subsequently served as control group to follow the dynamics of epitope-specific antibodies over time, and group 3 (7 animals) was boosted three times with Trivax1 (FIG. 5d). PreRSVF-specific antibody and neutralization titers maximized at day 28 and were maintained up to day 119 in both groups (FIG. 5h,i). Analysis of the site-specific antibody levels showed that site 0, II and IV responses were dynamic in the control group, with site II dropping from 37% to 13% and site 0 from 17% to 4% at day 28 and 91, respectively (FIG. 5j). In contrast, site IV specific responses increased from 13% to 43% over the same time span. Although Trivax1 boosting immunizations did not significantly change the magnitude of the preRSVF-specific serum response, they reshaped the serum specificities in primed animals. Site II specific titers were 6.5-fold higher (day 91) compared to the non-boosted control group (84% vs 13%, p=0.02, Mann-Whitney), and unlike the rapid drop of site 0-specific antibodies in the non-boosted group, these antibodies were maintained upon Trivax1 boosting (25% vs 4%, p=0.02, Mann-Whitney) (FIG. 5j). In contrast, site IV specific responses increased to similar levels in both groups, 43% and 40% in group 2 and 3, respectively. Strikingly, upon depletion of site 0, II and IV specific antibodies from pooled sera, we observed a 60% drop in neutralizing activity in group 3 as compared to only a 7% drop in the non-boosted control group, indicating that Trivax1 boosting reshaped a serum response of broad specificity towards a more focused response that predominantly depends on site 0, II and IV-specific antibodies for RSV neutralization (FIG. 5k).

    [0086] Altogether, we concluded that both design strategies yielded antigens for complex neutralization epitopes that induce neutralizing antibodies upon cocktail formulation, providing a strong rationale for including multiple, ideally non-overlapping epitopes in an epitope-focused vaccination strategy. While the first-generation immunogens were inferior according to biophysical parameters and failed to induce neutralization in mice, but were successful under two different immunological scenarios in NHPs, we show that a second generation with improved biophysical properties and proven accurate mimicry of the epitope can now induce neutralizing antibodies in mice. This is an important step as it now allows to optimize and test the different nanoparticles, formulations and delivery routes in a small animal model, and we foresee that these second-generation immunogens will prove superior in inducing neutralizing serum responses in NHPs.

    Discussion & Conclusions

    [0087] Here, we have showcased computational protein design strategies to design accurate mimetics of structurally complex epitopes, and validated their functionality to elicit neutralizing antibody responses in cocktail formulations both in mice and NHPs.

    [0088] We have shown that through computational design of pre-existing templates with full backbone flexibility, irregular and discontinuous epitopes were successfully stabilized in heterologous scaffolds. However, this design strategy required extensive in vitro evolution optimization and the resulting scaffolds remained suboptimal regarding their biochemical and biophysical properties. In addition, the lack of precise topological control of the designed proteins is a major limitation for the design of functional proteins that require specific topological similarity on top of the local mimicry of the transplanted site. For instance, the design template of the site 0 immunogen did not mimic the quaternary environment of the epitope of interest, which may have contributed to the low levels of functional antibodies induced in mice. To overcome these limitations, we developed the TopoBuilder, a motif-centric design approach that tailors a protein fold directly to the functional site of interest. Compared to previously employed de novo design approaches, in which a stable scaffold topology was constructed first and endowed with binding motifs in a second step (5), our method has significant advantages for structurally complex motifs. First, it allows to tailor the topology to the structural requirements of the functional motif from the beginning of the design process, rather than through the adaptation (and often destabilization) of a stable protein to accommodate the functional site. Second, the topological assembly and fine-tuning allowed to select for optimal backbone orientations and sequences that stably folded and bound with high affinity in a single screening round, without requiring further optimization through directed evolution, as often used in computational protein design efforts (5, 24, 25). Together, our approach enabled the computational design of de novo proteins presenting irregular and discontinuous structural motifs that are typically required to endow proteins with diverse biochemical functions (e.g. binding or catalysis), thus providing a new means for the de novo design of functional proteins.

    [0089] On the functional aspect of our design work, we showed in vivo that these immunogens consistently elicited neutralizing serum levels in mice and NHPs as cocktail formulations. The elicitation of focused neutralizing antibody responses by vaccination remains the central goal for vaccines against pathogens that have frustrated conventional vaccine development efforts. Using RSV as a model system, we have shown that cocktails of computationally designed antigens can robustly elicit neutralizing serum levels in naïve animals. These neutralization levels were much superior to any previous report on epitope-focused immunogens (11) and provide a strong rationale for an epitope-focused vaccination strategy involving multiple, non-overlapping epitopes. Also, their capability to dramatically reshape the nature of non-naïve repertoires in NHPs, addresses an important challenge for many next-generation vaccines to target pathogens for which efficacious vaccines are needed. An important pathogen from this category is influenza, where the challenge is to overcome established immunodominance hierarchies (26) that favour strain-specific antibody specificities, rather than cross-protecting nAbs found in the hemagglutinin stem region (27). The ability to selectively boost subdominant nAbs targeting defined, broadly protective epitopes that are surrounded by strain-specific epitopes could overcome a long-standing challenge for vaccine development, given that cross-neutralizing antibodies were shown to persist for years once elicited (28). A tantalizing future application for epitope-focused immunogens could marry this technology with engineered components of the immune system and they could be used to stimulate antibody production of adoptively transferred, engineered B-cells that express monoclonal therapeutic antibodies in vivo (29).

    [0090] Altogether, this study provides a blueprint for the design of an epitope-focused vaccination strategy against pathogens that have eluded traditional vaccine development approaches. Beyond immunogen design, the design strategy presented opens a door for the de novo design of proteins stabilizing complex binding sites, applicable to the design of novel functional proteins with defined structural properties.

    REFERENCES

    [0091] 1. N. Koga et al., Principles for designing ideal protein structures. Nature 491, 222-227 (2012). [0092] 2. E. Marcos et al., Principles for designing proteins with cavities formed by curved beta sheets. Science 355, 201-206 (2017). [0093] 3. P. S. Huang et al., De novo design of a four-fold symmetric TIM-barrel protein with atomic-level accuracy. Nat Chem Biol 12, 29-34 (2016). [0094] 4. M. Mravic et al., Packing of apolar side chains enables accurate design of highly stable membrane proteins. Science 363, 1418-1423 (2019). [0095] 5. A. Chevalier et al., Massively parallel de novo protein design for targeted therapeutics. Nature 550, 74-79 (2017). [0096] 6. E. Procko et al., A computationally designed inhibitor of an Epstein-Barr viral Bcl-2 protein induces apoptosis in infected cells. Cell 157, 1644-1656 (2014). [0097] 7. S. Berger et al., Computationally designed high specificity inhibitors delineate the roles of BCL2 family proteins in cancer. Elife 5, (2016). [0098] 8. M. L. Azoitei et al., Computation-guided backbone grafting of a discontinuous motif onto a protein scaffold. Science 334, 373-376 (2011). [0099] 9. S. Jones, J. M. Thornton, Principles of protein-protein interactions. Proc Natl Acad Sci USA 93, 13-20 (1996). [0100] 10. N. D. Rubinstein et al., Computational characterization of B-cell epitopes. Mol Immunol 45, 3477-3489 (2008). [0101] 11. B. E. Correia et al., Proof of principle for epitope-focused vaccine design. Nature 507, 201-206 (2014). [0102] 12. J. S. McLellan et al., Structure of RSV fusion glycoprotein trimer bound to a prefusion-specific neutralizing antibody. Science 340, 1113-1117 (2013). [0103] 13. J. S. McLellan et al., Structure of a major antigenic site on the respiratory syncytial virus fusion glycoprotein in complex with neutralizing antibody 101F. J Virol 84, 12236-12244 (2010). [0104] 14. D. Tian et al., Structural basis of respiratory syncytial virus subtype-dependent neutralization by an antibody targeting the fusion glycoprotein. Nat Commun 8, 1877 (2017). [0105] 15. J. S. McLellan et al., Design and characterization of epitope-scaffold immunogens that present the motavizumab epitope from respiratory syncytial virus. J Mol Biol 409, 853-866 (2011). [0106] 16. S. J. Fleishman et al., Computational design of proteins targeting the conserved stem region of influenza hemagglutinin. Science 332, 816-821 (2011). [0107] 17. J. Bonet et al., Rosetta FunFolDes—A general framework for the computational design of functional proteins. PLoS Comput Biol 14, e1006623 (2018). [0108] 18. T. J. Brunette et al., Exploring the repeat protein universe through computational protein design. Nature 528, 580-584 (2015). [0109] 19. J. S. McLellan et al., Structure-based design of a fusion glycoprotein vaccine for respiratory syncytial virus. Science 342, 592-598 (2013). [0110] 20. P. Kristensen, G. Winter, Proteolytic selection for protein folding using filamentous bacteriophages. Fold Des 3, 321-328 (1998). [0111] 21. M. D. Finucane, M. Tuna, J. H. Lees, D. N. Woolfson, Core-directed protein design. I.

    [0112] An experimental method for selecting stable proteins from combinatorial libraries. Biochemistry 38, 11604-11612 (1999). [0113] 22. A. M. Watkins, P. S. Arora, Anatomy of beta-strands at protein-protein interfaces. ACS Chem Biol 9, 1747-1754 (2014). [0114] 23. F. Sesterhenn et al., Boosting subdominant neutralizing antibody responses with a computationally designed epitope-focused immunogen. PLoS Biol 17, e3000164 (2019). [0115] 24. D. A. Silva et al., De novo design of potent and selective mimics of IL-2 and IL-15. Nature 565, 186-191 (2019). [0116] 25. E. M. Strauch et al., Computational design of trimeric influenza-neutralizing proteins targeting the hemagglutinin receptor binding site. Nat Biotechnol 35, 667-671 (2017). [0117] 26. D. Angeletti et al., Defining B cell immunodominance to viruses. Nat Immunol 18, 456-463 (2017). [0118] 27. D. Corti et al., A neutralizing antibody selected from plasma cells that binds to group 1 and group 2 influenza A hemagglutinins. Science 333, 850-856 (2011). [0119] 28. J. Lee et al., Persistent Antibody Clonotypes Dominate the Serum Response to Influenza over Multiple Years and Repeated Vaccinations. Cell Host Microbe 25, 367-376 e365 (2019). [0120] 29. H. F. Moffett et al., B cells engineered to express pathogen-specific antibodies protect against infection. Sci Immunol 4, (2019).

    METHODS

    Computational Design of Template-Based Epitope-Focused Immunogens

    Site 0

    [0121] The structural segments entailing the antigenic site 0 were extracted from the prefusion stabilized RSVF Ds-Cav1 crystal structure, bound to the antibody D25 (PDB ID: 4JHVV) (1). The epitope consists of two segments: a kinked helical segment (residues 196-212) and a 7-residue loop (residues 63-69).

    [0122] The MASTER software (2) was used to perform structural searches over the Protein Data Bank (PDB, from August 2018), containing 141,920 protein structures, to select template scaffolds with local structural similarities to the site 0 motif. A first search with a Cα RMSD threshold below 2.5 Å did not produce any usable structural matches both in terms of local mimicry as well as global topology features. A second search was performed, where extra structural elements that support the epitope in its native environment were included as part of the query motif to bias the search towards matches that favoured motif-compatible topologies rather than those with close local similarities. The extra structural elements included were the two buried helices that directly contact the site 0 in the preRSVF structure (4JHW residues 70-88 and 212-229). The search yielded initially 7,600 matches under 5 Å of backbone RMSD, which were subsequently filtered for proteins with a length between 50 and 160 residues, high secondary structure content, as well as for accessibility of the epitope for antibody binding. Remaining matches were manually inspected to select template-scaffolds suitable to present the native conformation of antigenic site 0. Subsequently, we selected a computationally designed, highly stable, helical repeat protein (3) consisting of 8 regular helices (PDB ID: SCWJ) with an RMSD of 4.4 Å to the query (2.82 A for site 0 segments only). To avoid steric clashes with the D25 antibody, we truncated the SCWJ template structure at the N-terminus by 29 residues, resulting in a structural topology composed of 7 helices.

    [0123] Using Rosetta FunFolDes (4) the truncated SCWJ topology was folded and designed to stabilize the grafted site 0 epitope recognized by D25. We generated 25,000 designs and selected the top 300 by Rosetta energy score (RE), designed backbones that presented obvious flaws, as low packing scores, distorted secondary structural elements and buried unsatisfied atoms were discarded. From the top 300 designs, 3 were retained for follow-up iterative cycles of structural relaxation and design using Rosetta FastDesign (5), generating a total of 100 designed sequences.

    [0124] The best 9 designs by Rosetta energy score were recombinantly expressed in E. coli. 2 designed sequences derived from the same backbone, were successfully expressed and purified. The best variant was named S0_1.1, and subjected to experimental optimization using yeast surface display (FIG. 9-10). In one of the libraries, we found a truncated sequence (S0_1.17) enriched for expression and binding, which served as template for a second round of computational design (FIG. 9-10). We performed 25,000 folding and design simulations using Rosetta FunFolDes (4). The best 300 decoys by total Rosetta energy score were extracted, and relaxed using the Rosetta Relax application (6). We computed the mean total RE, and selected designs that showed a lower energy score than the mean of the design population (RE=−155.2), RMSD drift of the epitope after relaxing of less than 0.7 Å, and a cavity volume <60 Å.sup.3. We selected one of the best 5 scoring decoys, truncated the N-terminal 14 residues which did not contribute to epitope stabilization, and introduced a disulfide bond between residue 1 and 43. Four sequences were experimentally tested (S0_1.37-40). The best variant according to binding, S0_1.39, bound with 5 nM affinity to antibody D25, and, importantly, also gained binding to the 5C4 antibody (K.sub.D=5 nM).

    Site IV

    [0125] When the design simulations were carried out, there was no structure available of the full RSVF protein in complex with a site IV-specific nAb, nevertheless a peptide epitope of this site recognized by the 101F nAb had been previously reported (PDB ID: 3O41) (7).

    [0126] The crystallized peptide-epitope corresponds to the residues 429-434 of the RSVF protein. Structurally the 101F-bound peptide-epitope adopts a bulged strand and several studies suggest that 101F recognition extends beyond the linear β-strand, contacting other residues located in antigenic site IV (8). Despite the apparent structural simplicity of the epitope, structural searches for designable scaffolds failed to yield promising starting templates. However, we noticed that the antigenic site IV of RSVF is self-contained within an individual domain that could potentially be excised and designed as a soluble folded protein. To maximize these contacts, we first truncated the seemingly self-contained region from RSVF pre-fusion structure (PDB ID: 4JHW, residue: 402-459) forming a β-sandwich and containing site IV. We used Rosetta FastDesign to optimize the core positions of this minimal topology, obtaining our initial design: S4_wt. However, S4_wt did not show a funnel-shaped energy landscape in Rosetta ab initio simulations, and we were unable to obtain expression in E. coli.

    [0127] In an attempt to improve the conformation and stabilization of S4_wt, we used Rosetta FunFolDes to fold and design this topology, while keeping the conformation of the site IV epitope fixed. Out of 25,000 simulations, the top 1% decoys according to RE score and overall RMSD were selected for manual inspection, and 12 designed sequences were selected for recombinant expression in E. coli.

    TopoBuilder—Motif-Centric De Novo Design

    [0128] Given the limited availability of suitable starting templates to host structurally complex motifs such as site 0 and site IV, we developed a template-free design protocol, which we named

    [0129] TopoBuilder. In contrast to adapting an existing topology to accommodate the epitope, the design goal is to build protein scaffolds around the epitope from scratch, using idealized secondary structures (beta strands and alpha helices). The length, orientation and 3D-positioning are defined by the user for each secondary structure with respect to the epitope, which is extracted from its native environment. The topologies built were designed to meet the following criteria: (1) Small, globular proteins with a high contact order between secondary structures and the epitope, to allow for stable folding and accurate stabilization of the epitope in its native conformation (2) Context mimicry, i.e. respecting shape constraints of the epitope in its native context (FIG. 12). For assembling the topology, the default distances between alpha helices was set to 11 Å and for adjacent beta-strands was 5 Å. For each discontinuous structural sketch, a connectivity between the secondary structural elements was defined and loop lengths were selected to connect the secondary structure elements with the minimal number of residues that can cover a given distance, while maintaining proper backbone geometries.

    [0130] For site 0, the short helix of S0_1.39 preceding the epitope loop segment was kept, and a third helix was placed on the backside of the epitope to: (1) provide a core to the protein and (2) allow for the proper connectivity between the secondary structures.

    [0131] A total of three different orientations (45°, 0° and −45° degrees to the plane formed by site 0) were tested for the designed supporting alpha helix (FIG. 3 and FIG. 16).

    [0132] In the case of site IV, the known binding region to 101F (residues 428F-434F) was extracted from prefusion RSVF (PDB 4JWH). Three antiparallel beta strands, pairing with the epitope, plus an alpha helix on the buried side, were assembled around the 101F epitope. Three different configurations (45°, (−45°, 0°, 10°) and −45° degrees with respect to the β-sheet) were sampled parametrically for the alpha helix (FIG. 3).

    [0133] The structural sketches were used to generate C! distance constraints to guide Rosetta FunFolDes (4) folding trajectories. Around 25,000 trajectories were generated for each sketch. The newly generated backbones were further subjected to layer-based FastDesign (5), meaning that each amino acid position was assigned a layer (combining ‘core’, ‘boundary’, ‘surface’ and ‘sheet’ or ‘helix’) on the basis of its exposure and secondary structure type, that dictated the allowed amino acid types at that position.

    [0134] After iterative cycles of sequence design, unconstraint FastRelax (9) (i.e sidechain repacking and backbone minimization) was applied over the designs to evaluate their conformational stability of the epitope region. After each relax cycle, structural changes of the epitope region were evaluated (epitope RMSD drift). Designs with epitope RMSD drifts higher than 1.2 Å were discarded. Designs were also ranked and selected according hydrophobic core packing (packstat score), with a cutoff of 0.5 for site 0 and 0.6 for the site IV design series, and a cavity volume of <50 Å.sup.3. Between 1,000 and 10,000 of the designed sequences were generated from this computational protocol. We evaluated sequence profiles for the designs, and encoded the critical positions combinatorially by assembling overlapping oligos. Upon PCR assembly, libraries were transformed in yeast and screened for antibody binding and stability as assessed by protease digestion assays (10-12).

    Mouse Immunizations

    [0135] All animal experiments were approved by the Veterinary Authority of the Canton of Vaud (Switzerland) according to Swiss regulations of animal welfare (animal protocol number 3074). Female Balb/c mice (6-week old) were purchased from Janvier labs. Immunogens were thawed on ice, mixed with equal volumes of adjuvant (2% Alhydrogel, Invivogen or Sigma Adjuvant System, Sigma) and incubated for 30 minutes. Mice were injected subcutaneously with 100 μl vaccine formulation, containing in total 10 μg of immunogen (equimolar ratios of each immunogen for Trivax immunizations). Immunizations were performed on day 0, 21 and 42. 100-200 μl blood were drawn on day 0, 14 and 35. Mice were euthanized at day 56 and blood was taken by cardiac puncture.

    NHP Immunizations

    [0136] Twenty-one african green monkeys (AGM, 3-4 years) were divided into three experimental groups with at least two animals of each sex. AGMs were pre-screened as seronegative against prefusion RSVF (preRSVF) by ELISA. Vaccines were prepared 1 hour before injection, containing 50 μg preRSVF or 300 μg Trivax1 in 0.5 ml PBS, mixed with 0.5 ml alum adjuvant (Alhydrogel, Invivogen) for each animal. AGMs were immunized intramuscularly at day 0, 28, 56, and 84. Blood was drawn at days 14, 28, 35, 56, 63, 84, 91, 105 and 119.

    RSV Neutralization Assay

    [0137] The RSV neutralization assay was performed as described previously (13). Briefly, Hep2 cells were seeded in Corning 96-well tissue culture plates (Sigma) at a density of 40,000 cells/well in 100 μl of Minimum Essential Medium (MEM, Gibco) supplemented with 10% FBS (Gibco), L-glutamine 2 mM (Gibco) and penicillin-streptomycin (Gibco), and grown overnight at 37° C. with 5% CO2. Serial dilutions of heat-inactivated sera were prepared in MEM without phenol red (M0, Life Technologies, supplemented with 2 mM L-glutamine and penicillin/streptomycin) and were incubated with 800 pfu/well (final MOI 0.01) RSV-Luc (A2 strain carrying a luciferase gene) for 1 hour at 37° C. Serum-virus mixture was added to Hep2 cell layer, and incubated for 48 hours. Cells were lysed in lysis buffer supplemented with 1 μg/ml luciferin (Sigma) and 2 mM ATP (Sigma), and luminescence signal was read on a Tecan Infinite 500 plate reader. The neutralization curve was plotted and fitted using the GraphPad variable slope fitting model, weighted by 1/Y.sup.2.

    Serum Fractionation

    [0138] Monomeric Trivax1 immunogens (S2_1, S0_1.39 and S4_1.5) were used to deplete the site 0, II and IV specific antibodies in immunized sera. HisPurTM Ni-NTA resin slurry (Thermo Scientific) was washed with PBS containing 10 mM imidazole. Approximately 1 mg of each immunogen was immobilized on Ni-NTA resin, followed by two wash steps to remove unbound scaffold. 60 μl of sera pooled from all animals within the same group were diluted to a final volume of 600 μl in wash buffer, and incubated overnight at 4° C. with 500 μl Ni-NTA resin slurry. As control, the same amount of sera was incubated with Ni-NTA resin that did not contain scaffolds. Resin was pelleted down at 13,000 rpm for 5 minutes, and the supernatant (depleted sera) was collected and then used for neutralization assays.

    Site Saturation Mutagenesis Library (SSM)

    [0139] A SSM library was assembled by overhang PCR, in which 11 selected positions surrounding the epitope in the S4_1.1 design model were allowed to mutate to all 20 amino acids, with one mutation allowed at a time. Each of the 11 libraries was assembled by primers (Table 1) containing the degenerate codon ‘NNK’ at the selected position. All 11 libraries were pooled, and transformed into EBY-100 yeast strain with a transformation efficiency of 1×10.sup.6 transformants.

    Combinatorial Library

    [0140] Combinatorial sequence libraries were constructed by assembling multiple overlapping primers (Table 2) containing degenerate codons at selected positions for combinatorial sampling of hydrophobic amino acids in the protein core. The theoretical diversity was between 1×10.sup.6 and 5×10.sup.6. Primers were mixed (10 μM each), and assembled in a PCR reaction (55° C. annealing for 30 sec, 72° C. extension time for 1 min, 25 cycles). To amplify full-length assembled products, a second PCR reaction was performed, with forward and reverse primers specific for the full-length product. The PCR product was desalted, and transformed into EBY-100 yeast strain with a transformation efficiency of at least 1×10.sup.7 transformants (14).

    Protein Expression and Purification

    Designed Scaffolds

    [0141] All genes of designed proteins were purchased as DNA fragments from Twist Bioscience, and cloned via Gibson assembly into either pET11b or pET21b bacterial expression vectors. Plasmids were transformed into E. coli BL21 (DE3) (Merck) and grown overnight in LB media. For protein expression, precultures were diluted 1:100 and grown at 37° C. until the OD.sub.600 reached 0.6, followed by the addition of 1 mM IPTG to induce expression. Cultures were harvested after 12-16 hours at 22° C. Pellets were resuspended in lysis buffer (50 mM Tris, pH 7.5, 500 mM NaCl, 5% Glycerol, 1 mg/ml lysozyme, 1 mM PMSF, 1 μg/ml DNase) and sonicated on ice for a total of 12 minutes, in intervals of 15 seconds sonication followed by 45 seconds pause. Lysates were clarified by centrifugation (20,000 rpm, 20 minutes) and purified via Ni-NTA affinity chromatography followed by size exclusion on a HiLoad 16/600 Superdex 75 column (GE Healthcare) in PBS buffer.

    Antibodies—IgG and Fab Constructs

    [0142] Plasmids encoding cDNAs for the heavy chain of IgG were purchased from Genscript and cloned into the pFUSE-CHIg-hG1 vector (Invivogen). Heavy and light chain DNA sequences of antibody fragments (Fab) were purchased from Twist Bioscience and cloned separately into the pHLsec mammalian expression vector (Addgene, #99845) via Gibson assembly. HEK293-F cells were transfected in a 1:1 ratio with heavy and light chains, and cultured in FreeStyle medium (Gibco) for 7 days. Supernatants were collected by centrifugation and purified using a 1 ml HiTrap Protein A HP column (GE Healthcare) for IgG expression and 5 ml kappa-select column (GE Healthcare) for Fab purification. Bound antibodies/Fabs were eluted with 0.1 M glycine buffer (pH 2.7), immediately neutralized by 1 M Tris ethylamine buffer (pH 9), and buffer exchanged to PBS.

    Prefusion Stabilized RSVF

    [0143] The construct encoding the thermostabilized the preRSVF protein corresponds to the sc9-10 DS-Cav1 A149C Y458C S46G E92D S215P K465Q variant (referred to as DS2) reported by Joyce and colleagues (15). The sequence was codon-optimized for mammalian cell expression and cloned into the pHCMV-1 vector flanked with two C-terminal Strep-Tag II and one 8x His tag. Expression and purification were performed as described previously (13).

    Nanoring-Based Immunogens

    [0144] The full-length N gene derived from the human RSV strain Long, ATCC VR-26 (GenBank accession number AY911262.1) was PCR amplified and cloned into pET28a+ at Ncol-Xhol sites to obtain the pET-N plasmid. Immunogens presenting sites 0, II and IV epitopes were cloned into the pET-N plasmid at Ncol site as pET-S0_1.39-N, pET-S2_1.2-N and pET-S4_1.5-N, respectively. Expression and purification of the nanoring fusion proteins was performed as described previously (13).

    Ferritin-Based Immunogens

    [0145] The gene encoding Helicobacter pylori ferritin (GenBank ID: QAB33511.1) was cloned into the pHLsec vector for mammalian expression, with an N-terminal 6x His Tag. The sequence of the designed immunogens (S0_2.126 and S4_2.45) were cloned upstream of the ferritin gene, spaced by a GGGGS linker. Ferritin particulate immunogens were produced by co-transfecting a 1:1 stochiometric ratio of “naked” ferritin and immunogen-ferritin in HEK-293F cells, as previously described for other immunogen-nanoparticle fusion constructs (16). The supernatant was collected 7-days post transfection and purified via Ni-NTA affinity chromatography and size exclusion on a Superose 6 increase 10/300 GL column (GE).

    Negative-Stain Transmission Electron Microscopy

    Sample Preparation

    [0146] RSVN and Ferritin-based nanoparticles were diluted to a concentration of 0.015 mg/ml. The samples were absorbed on carbon-coated copper grid (EMS, Hatfield, Pa., United States) for 3 mins, washed with deionized water and stained with freshly prepared 0.75% uranyl formate.

    Data Acquisition

    [0147] The samples were viewed under an F20 electron microscope (Thermo Fisher) operated at 200 kV. Digital images were collected using a direct detector camera Falcon III (Thermo Fisher) with the set-up of 4098×4098 pixels. The homogeneity and coverage of staining samples on the grid was first visualized at low magnification mode before automatic data collection. Automatic data collection was performed using EPU software (Thermo Fisher) at a nominal magnification of 50,000×, corresponding to pixel size of 2 Å, and defocus range from −1 μm to −2 μm.

    Image Processing

    [0148] CTFFIND4 program (17) was used to estimate the contrast transfer function for each collected image. Around 1000 particles were manually selected using the installed package XMIPP within SCIPION framework (18). Manually picked particles were served as input for XMIPP auto-picking utility, resulting in at least 10,000 particles. Selected particles were extracted with the box size of 100 pixels and subjected for three rounds of reference-free 2D classification without CTF correction using RELION-3.0 Beta suite (19).

    RSVF-Fabs Complex Formation and Negative Stain EM

    [0149] 20 μg of RSVF trimer was incubated overnight at 4° C. with 80 μg of Fabs (Motavizumab, D25 or 101F). For complex formation with all three monoclonal Fabs, 80 μg of each Fab was used. Complexes were purified on a Superose 6 Increase 10/300 column using an Akta Pure system (GE Healthcare) in TBS buffer. The main fraction containing the complex was directly used for negative stain EM. Purified complexes of RSVF and Fabs were deposited at approximately 0.02 mg/ml onto carbon-coated copper grids and stained with 2% uranyl formate. Images were collected with a field-emission FEI Tecnai F20 electron microscope operating at 200 kV. Images were acquired with an Orius charge-coupled device (CCD) camera (Gatan Inc.) at a calibrated magnification of ×34,483, resulting in a pixel size of 2.71 A. For the complexes of RSVF with a single Fab, approximately 2,000 particles were manually selected with Cryosparc2 (20). Two rounds of 2D classification of particle images were performed with 20 classes allowed. For the complexes of RSVF with D25, Motavizumab and 101F Fabs, approximately 330,000 particles were picked using Relion 3.0 (19) and subsequently imported to Cryosparc2 for two rounds of 2D classification with 50 classes allowed.

    Determining Binding Affinities by Surface Plasmon Resonance (SPR)

    [0150] SPR measurements were performed on a Biacore 8K (GE Healthcare) with HBS-EP+ as running buffer (10 mM HEPES pH 7.4, 150 mM NaCl, 3 mM EDTA, 0.005% v/v Surfactant

    [0151] P20, GE Healthcare). Ligands were immobilized on a CM5 chip (GE Healthcare #29104988) via amine coupling. Approximately 2000 response units (RU) of IgG were immobilized, and designed monomeric proteins were injected as analyte in two-fold serial dilutions. The flow rate was 30 μl/min for a contact time of 120 seconds followed by 400 seconds dissociation time. After each injection, surface was regenerated using 3 M magnesium chloride (101F as immobilized ligand) or 0.1 M Glycine at pH 4.0 (Motavizumab and D25 IgG as an immobilized ligand). Data were fitted using 1:1 Langmuir binding model within the Biacore 8K analysis software (GE Healthcare #29310604).

    Dissection of Serum Antibody Specificities by SPR

    [0152] To quantify the epitope-specific antibody responses in bulk serum from immunized animals, we performed an SPR competition assay with the monoclonal antibodies (D25, Motavizumab and 101F) as described previously (13). Briefly, approximately 400 RU of prefusion RSVF were immobilized on a CM5 chip via amine coupling, and serum diluted 1:10 in running buffer was injected to measure the total response ((RU.sub.non-blocked surface). After chip regeneration using 50 mM NaOH, the site 0/II/IV epitopes were blocked by injecting saturating amounts of either D25, Motavizumab, or 101F IgG, and serum was injected again to quantify residual response (RU.sub.blocked surface). The delta serum response (ΔSR) was calculated as follows:


    ΔSR=RU.sub.(non-)blocked surface−RU.sub.Baseline

    [0153] Percent blocking was calculated for each site as:

    [00001] % blocking = ( 1 - ( Δ SR blocked surface Δ SR non - blocked surface ) ) * 100

    SEC-MALS

    [0154] Size exclusion chromatography with an online multi-angle light scattering (MALS) device (miniDAWN TREOS, Wyatt) was used to determine the oligomeric state and molecular weight for the protein in solution. Purified proteins were concentrated to 1 mg/ml in PBS (pH 7.4), and 100 μl of sample was injected into a Superdex 75 300/10 GL column (GE Healthcare) with a flow rate of 0.5 ml/min, and UV280 and light scattering signals were recorded. Molecular weight was determined using the ASTRA software (version 6.1, Wyatt).

    Circular Dichroism

    [0155] Far-UV circular dichroism spectra were measured using a Jasco-815 spectrometer in a 1 mm path-length cuvette. The protein samples were prepared in 10 mM sodium phosphate buffer at a protein concentration of 30 μM. Wavelengths between 190 nm and 250 nm were recorded with a scanning speed of 20 nm min.sup.−1 and a response time of 0.125 sec. All spectra were averaged 2 times and corrected for buffer absorption. Temperature ramping melts were performed from 25 to 90° C. with an increment of 2° C./min in presence or absence of 2.5 mM TCEP reducing agent. Thermal denaturation curves were plotted by the change of ellipticity at the global curve minimum to calculate the melting temperature (T.sub.m).

    Yeast Surface Display

    [0156] Libraries of linear DNA fragments encoding variants of the designed proteins were transformed together with linearized pCTcon2 vector (Addgene #41843) based on the protocol previously described by Chao and colleagues (14). Transformation procedures generally yielded ˜10.sup.7 transformants. The transformed cells were passaged twice in SDCAA medium before induction. To induce cell surface expression, cells were centrifuged at 7,000 r.p.m. for 1 min, washed with induction media (SGCAA) and resuspended in 100 ml SGCAA with a cell density of 1×10.sup.7 cells/ml SGCAA. Cells were grown overnight at 30° C. in SGCAA medium. Induced cells were washed in cold wash buffer (PBS+0.05% BSA) and labelled with various concentration of target IgG or Fab (101F, D25, and 5C4) at 4° C. After one hour of incubation, cells were washed twice with wash buffer and then incubated with FITC-conjugated anti-cMyc antibody and PE-conjugated anti-human Fc (BioLegend, #342303) or PE-conjugated anti-Fab (Thermo Scientific, #MA1-10377) for an additional 30 min. Cells were washed and sorted using a SONY SH800 flow cytometer in ‘ultra-purity’ mode. The sorted cells were recovered in SDCAA medium, and grown for 1-2 days at 30° C. In order to select stably folded proteins, we washed the induced cells with TBS buffer (20 mM Tris, 100 mM NaCl, pH 8.0) three times and resuspended in 0.5 ml of TBS buffer containing 1 μM of chymotrypsin. After incubating five-minutes at 30° C., the reaction was quenched by adding 1 ml of wash buffer, followed by five wash steps. Cells were then labelled with primary and secondary antibodies as described above.

    ELISA

    [0157] 96-well plates (Nunc MediSorp platesf Thermo Scientific) were coated overnight at 4° C. with 50 ng/well of purified antigen (recombinant RSVF or designed immunogen) in coating buffer (100 mM sodium bicarbonate, pH 9) in 100 μl total volume. Following overnight incubation, wells were blocked with blocking buffer (PBS +0.05% Tween 20 (PBST) containing 5% skim milk (Sigma)) for 2 hours at room temperature. Plates were washed five times with PBST. 3-fold serial dilutions were prepared and added to the plates in duplicates, and incubated at room temperature for 1 hour. After washing, anti-mouse (abcam, #99617) or anti-monkey (abcam, #112767) HRP-conjugated secondary antibody were diluted 1:1,500 or 1:10,000, respectively, in blocking buffer and incubated for 1 hour. An additional five wash steps were performed before adding 100 μl/well Pierce TMB substrate (Thermo Scientific). The reaction was terminated by adding an equal volume of 2 M sulfuric acid. The absorbance at 450 nm was measured on a Tecan Safire 2 plate reader, and the antigen specific titers were determined as the reciprocal of the serum dilution yielding a signal two-fold above the background.

    NMR

    [0158] Protein samples for NMR were prepared in 10 mM sodium phosphate buffer, 50 mM sodium chloride at pH 7.4 with the protein concentration of 500 μM. All NMR experiments were carried out in a 18.8T (800 MHz proton Larmor frequency) Bruker spectrometer equipped with a CPTC 1H,.sup.13C,.sup.15N 5 mm cryoprobe and an Avance III console. Experiments for backbone resonance assignment consisted in standard triple resonance spectra HNCA, HN(CO)CA, HNCO, HN(CO)CA, CBCA(CO)NH and HNCACB acquired on a 0.5 mM sample doubly labelled with .sup.13C and .sup.15N (21). Sidechain assignments were obtained from HCCH-TOCSY experiments acquired on the same sample plus HNHA, NOESY-.sup.15N-HSQC and TOCSY-.sup.15N-HSQC acquired on a .sup.15N-labeled sample. The NOESY-.sup.15N-HSQC was used together with a 2D NOESY collected on an unlabelled sample for structure calculations.

    [0159] Spectra for backbone assignments were acquired with 40 increments in the .sup.15N dimension and 128 increments in the .sup.13C dimension, and processed with 128 and 256 points by using linear prediction. HCCH-TOCSY were recorded with 64-128 increments in the .sup.13C dimensions and processed with twice the number of points. .sup.15N-resolved NOESY and TOCSY spectra were acquired with 64 increments in .sup.15N dimension and 128 in the indirect .sup.1H dimension, and processed with twice the number of points. .sup.1H-.sup.1H 2D-NOESY and 2D TOCSY spectra were acquired with 256 increments in the indirect dimension, processed with 512 points. Mixing times for NOESY spectra were 100 ms and TOCSY spin locks were 60 ms. Heteronuclear .sup.1H-.sup.15N NOE was measured with 128 .sup.15N increments processed with 256 points, using 64 scans and a saturation time of 6 seconds. All samples were prepared in 20 mM phosphate buffer pH 7, with 10% .sup.2H.sub.2O and 0.2% sodium azide to prevent sample degradation.

    [0160] All spectra were acquired and processed with Bruker's TopSpin 3.0 (acquisition with standard pulse programs) and analyzed manually with the program CARA (http://cara.nmr.ch/doku.php/home) to obtain backbone and sidechain resonance assignments. Peak picking and assignment of NOESY spectra (a .sup.15N-resolved NOESY and a 2D NOESY) were performed automatically with the program UNIO-ATNOS/CANDID (22, 23) coupled to Cyana 2.1 (24), using standard settings in both programs. The run was complemented with dihedral angles derived from chemical shifts with Talos-n (25).

    X-Ray Crystallization and Structural Determination

    Co-Crystallization of Complex D25 Fab with S0 2.126

    [0161] After overnight incubation at 4° C., the S0_2.126/D25 Fab complex was purified by size exclusion chromatography using a Superdex200 26 600 (GE Healthcare) equilibrated in 10 mM Tris pH 8, 100 mM NaCl and subsequently concentrated to ˜10 mg/ml (Amicon Ultra-15, MWCO 3,000). Crystals were grown at 291K using the sitting-drop vapor-diffusion method in drops containing 1 μl purified protein mixed with 1 μl reservoir solution containing 10% PEG 8000, 100 mM HEPES pH 7.5, and 200 mM calcium acetate.

    [0162] For cryo protection, crystals were briefly swished through mother liquor containing 20% ethylene glycol.

    Data Collection and Structural Determination of the S0 2.126/D25 Fab Complex

    [0163] Diffraction data was recorded at ESRF beamline ID30B. Data integration was performed by XDS (26) and a high-resolution cut at I/σ=1 was applied. The dataset contained a strong off-origin peak in the Patterson function (88% height rel. to origin) corresponding to a pseudo translational symmetry of 1/2, 0, 1/2. The structure was determined by the molecular replacement method using PHASER (27) using the D25 structure (1) (PDB ID 4JHVV) as a search model. Manual model building was performed using Coot (28), and automated refinement in Phenix (29). After several rounds of automated refinement and manual building, paired refinement (30) determined the resolution cut-off for final refinement.

    Co-Crystallization of Complex 101F Fab with S4 2.45

    [0164] The complex of S4_2.45 with the F101 Fab was prepared by mixing two proteins in 2:1 molar ratio for 1 hour at 4° C., followed by size exclusion chromatography using a Superdex-75 column. Complexes of S4_2.45 with the 101F Fab were verified by SDS-PAGE. Complexes were subsequently concentrated to 6-8 mg/ml. Crystals were grown using hanging drops vapor-diffusion method at 20° C. The S4_2.45/101F protein complex was mixed with equal volume of a well solution containing 0.2 M Magnesium acetate, 0.1 M Sodium cacodylate pH 6.5, 20%(w/v) PEG 8000. Native crystals were transferred to a cryoprotectant solution of 0.2 M Magnesium acetate, 0.1 M Sodium cacodylate pH 6.5, 20% (w/v) PEG 8000 and 15% glycerol, followed by flash-cooling in liquid nitrogen.

    Data Collection and Structural Determination of the S4 2.45/101F Fab Complex

    [0165] Diffraction data were collected at SSRL facility, BL9-2 beamline at the SLAC National Accelerator Laboratory. The crystals belonged to space group P3221. The diffraction data were initially processed to 2.6 Å with X-ray Detector Software (XDS) (Table 9). Molecular replacement searches were conducted with the program PHENIX PHASER using 101F Fab model (PDB ID: 3041) and S4_2.45/101F Fab computational model generated from superimposing epitope region of S4_2.45 with the peptide-bound structure (PDB ID: 3041), and yielded clear molecular replacement solutions. Initial refinement provided a Rfree of 42.43% and Rwork of 32.25% and a complex structure was refined using Phenix Refine, followed by manual rebuilding with the program COOT. The final refinement statistics, native data and phasing statistics are summarized in Table 9.

    Next-Generation Sequencing of Design Pools

    [0166] After sorting, yeast cells were grown overnight, pelleted and plasmid DNA was extracted using Zymoprep Yeast Plasmid Miniprep II (Zymo Research) following the manufacturer's instructions. The coding sequence of the designed variants was amplified using vector-specific primer pairs, Illumina sequencing adapters were attached using overhang PCR, and PCR products were desalted (Qiaquick PCR purification kit, Qiagen). Next generation sequencing was performed using an Illumina MiSeq 2×150 bp paired end sequencing (300 cycles), yielding between 0.45-0.58 million reads/sample.

    [0167] For bioinformatic analysis, sequences were translated in the correct reading frame, and enrichment values were computed for each sequence. We defined the enrichment value E as follows:

    [00002] E Seq = count Seq ( high selective pressure ) count Seq ( low selective pressure )

    [0168] The high selective pressure corresponds to low labelling concentration of the respective target antibodies (100 μM D25, 10 nM 5C4 or 20 μM 101F, as shown in FIG. 3), or a higher concentration of chymotrypsin protease (0.5 μM). The low selective pressure corresponds to a high labelling concentration with antibodies (10 nM D25, 1 μM 5C4 or 2 nM 101F), or no protease digestion, as indicated in FIG. 3. Only sequences that had at least one count in both sorting conditions were included in the analysis.

    TABLES

    [0169]

    TABLE-US-00001 TABLE 1 Primers used for constructing single > site saturation mutagenesis library for S4_1 design. S4_1_SSM_fw CAGGCTAGTGGTGGAGGAGGCTCTGGTGGAGGCGGTAGCGGAGGC (SEQ ID NO: GGAGGGTCGGCTAGC 2) S4_1_SSM_rw CTGTTGTTATCAGATCTCGAGCTATTACAAGTCCTCTTCAGAAATA (SEQ ID NO: AGCTTTTGTTCGGATCC 3) S4_1_#18_rw TTTCGGGCATTTGACTTTGATACCATTGCTGT (SEQ ID NO: 4) S4_1_#18_fw CAATGGTATCAAAGTCAAATGCCCGAAANNKGGTGAATGTACGAT (SEQ ID NO: TAAAGACAGTCAACG 5) S4_1_#20_rw CTTTCGGGCATTTGACTTTGATACCATTGCTGT (SEQ ID NO: 6) S4_1_#20_fw GCAATGGTATCAAAGTCAAATGCCCGAAAGGCGGTNNKTGTACGA (SEQ ID NO: TTAAAGACAGTCAACGTGG 7) S4_1_#22_rw CCTTTCGGGCATTTGACTTTGATACCATTGCTGT (SEQ ID NO: 8) S4_1_#22_fw GCAATGGTATCAAAGTCAAATGCCCGAAAGGCGGTGAATGTNNKA (SEQ ID NO: TTAAAGACAGTCAACGTGGCATTATC 9) S4_1_#25_rw TTTAATCGTACATTCACCGCCTTTCG (SEQ ID NO: 10) S4_1_#25_fw CGAAAGGCGGTGAATGTACGATTAAANNKAGTCAACGTGGCATTA (SEQ ID NO: TCAAAACC 11) S4_1_#36_rw GCTAAAGGTTTTGATAATGCCACGTTGAC (SEQ ID NO: 12) S4_1_#36_fw CAACGTGGCATTATCAAAACCTTTAGCNNKGGTACGGAAGAAGTT (SEQ ID NO: CGCAGTC 13) S4 1 #39 rw CGTACCAGAGCTAAAGGTTTTGATAATGCCA (SEQ ID NO: 14) S4_1_#39_fw GCATTATCAAAACCTTTAGCTCTGGTACGNNKGAAGTTCGCAGTCC (SEQ ID NO: GTCCCTG 15) S4 1 #43 rw GCGAACTTCTTCCGTACCAGAGCTAAAG (SEQ ID NO: 16) S4_1_#43_fw GCTCTGGTACGGAAGAAGTTCGCNNKCCGTCCCTGGGCAAAGTGA (SEQ ID NO: CCGT 17) S4_1_#45_fw GCTCTGGTACGGAAGAAGTTCGCAGTCCGNNKCTGGGCAAAGTGA (SEQ ID NO: CCGTTGGTGATAAC 18) S4_1_#48 rw GCCCAGGGACGGACTGCGAACTTC (SEQ ID NO: 19) S4_1_#48 fw GTTCGCAGTCCGTCCCTGGGCNNKGTGACCGTTGGTGATAACACGT (SEQ ID NO: TC 20) S4_1_#50 fw GTTCGCAGTCCGTCCCTGGGCAAAGTGNNKGTTGGTGATAACACGT (SEQ ID NO: TCGAAGCG 21)

    TABLE-US-00002 TABLE 2 Primers used for encoding computationally designed sequences of S4_2 design series. S4_2_uni_O1 GACAATAGCTCGACGATTGAAGGTAGATACCCATACGACGTTCCA (SEQ ID NO: GACTACGCTCTGCAGGCTAGTGGTGGAGGAGG 22) S4_2_uni_O2 CCCTCCGCCTCCGCTACCGCCTCCACCAGAGCCTCCTCCACCACTA (SEQ ID NO: GCCTG 23) S4_2_bb1_O3.1 GTAGCGGAGGCGGAGGGTCGGCTAGCCATATGCCGTCCATCYACT (SEQ ID NO: CAKWCGTTSYTGGTGGGAACATCAAGGTGAAGTGC 24) S4_2_bb1_O3.2 GTAGCGGAGGCGGAGGGTCGGCTAGCCATATGCCGTCCATCYACT (SEQ ID NO: CAKWCGTTSYTGGGAACATCAAGGTGAAGTGC 25) S4_2_bb1_O3.3 GTAGCGGAGGCGGAGGGTCGGCTAGCCATATGCCGTCCATCYACT (SEQ ID NO: CAKWCGTTSYTAACGGGAACATCAAGGTGAAGTGC 26) S4_2_bb1_O4.1 GGTCTTGATGATGCCACGCTGGCTATCCTCGATGGTACATTTGTCA (SEQ ID NO: CCAGTGCACTTCACCTTGATGTTCCC 27) S4_2_bb1_O4.2 GGTCTTGATGATGCCACGATTCTTGTTCTCGATGGTACATTTGTCA (SEQ ID NO: C CAGTGCACTTCACCTTGATGTTCCC 28) S4_2_bb1_O4.3 GGTCTTGATGATGCCACGCTGGCTATCCTCGATGGTACACTTGCCC (SEQ ID NO: TCGTGGCACTTCACCTTGATGTTCCC 29) S4_2_bb1_O5.1 GCGTGGCATCATCAAGACCACGAATGTTGATATTGCTGAGGAGRY (SEQ ID NO: GYRGAAGCAGSYTCAAGAGBYTBWGGAAGMGAAACGTAAGGGCT 30) CGTGGGGCTCG S4_2_bb1_O5.2 GCGTGGCATCATCAAGACCTTCACGGGGTTCGAGCCCGAGGAGRY (SEQ ID NO: GYRGAAGCAGSYTCAAGAGBYTBWGGAAGMGAAACGTAAGGGCT 31) CGTGGGGCTCG S4_2_bb1_O5.3 GCGTGGCATCATCAAGACCGTCCCGATGATCGAGACAGGGGAGGA (SEQ ID NO: GRYGYRGAAGCAGSYTCAAGAGBYTBWGGAAGMGAAACGTGGCT 32) CGTGGGGCTCG S4_2_uni_O6 CAGAAATAAGCTTTTGTTCGGATCCGGGCTCAGCCTATTAGTGGTG (SEQ ID NO: GTGGTGGTGGTGCGAGCCCCACGAGCC 33) S4_2_uni_O7 GGATCCGAACAAAAGCTTATTTCTGAAGAGGACTTGTAATAGCTCG (SEQ ID NO: AGATCTGATAAC 34) S4_2_uni_O8 GTACGAGCTAAAAGTACAGTGGGAACAAAGTCGATTTTGTTACAT (SEQ ID NO: CTACACTGTTGTTATCAGATCTCGAGCTATTACAAGTCC 35) S4_2_bb2_O3.1 TAGCGGAGGCGGAGGGTCGGCTAGCCATATGCCAAAWACCHACGT (SEQ ID NO: AWTTGAAGCAGGCDTCAGCTTCACCTGCTTAGGTGAGAAGTGCAC 36) CATCGAGGAC S4_2_bb2_O3.2 TAGCGGAGGCGGAGGGTCGGCTAGCCATATGCCAAAWACCHACGT (SEQ ID NO: AWTTCCCTCGDTCAGCTTCACCTGCTTAGGTGAGAAGTGCACCATC 37) GAGGAC S4_2_bb2_O3.3 TAGCGGAGGCGGAGGGTCGGCTAGCCATATGCCAAAWACCHACGT (SEQ ID NO: AWTTCCCTCGDTCAGCTTCACCTGCCCTAAGGGGGGGAAGTGCAC 38) CATCGAGGAC S4_2_bb2_O4.1 CGGTCTTGATGATCCCACGTTGTGAGTCCTCGATGGTGCACTTC (SEQ ID NO: 39) S4_2_bb2_O4.2 CGGTCTTGATGATCCCACGATCGTCCTCGATGGTGCACTTC (SEQ ID NO: 40) S4_2_bb2_O4.3 CGGTCTTGATGATCCCACGCGAGCGGTCCTCGATGGTGCACTTC (SEQ ID NO: 41) S4_2_bb2_O5.1 CGTGGGATCATCAAGACCGGCAAAAATGCCGAGGAGKYCDKGGA (SEQ ID NO: AGATBTCGAGAAGVRGGHGCGTGCCCAGGGCTCGTGGGGCTCGCA 42) C S4_2_bb2_O5.2 CGTGGGATCATCAAGACCGGCACACATCCAGAGGAGKYCDKGGAA (SEQ ID NO: GATBTCGAGAAGVRGGHGCGTGCCCAGGGCTCGTGGGGCTCGCAC 43) S4_2_bb2_O5.3 CGTGGGATCATCAAGACCGGCAAAAATAAGGAGGAGKYCDKGGA (SEQ ID NO: AGATBTCGAGAAGVRGGHGCGTGCCCAGGGCTCGTGGGGCTCGCA 44) C S4_2_bb3_O3.1 TAGCGGAGGCGGAGGGTCGGCTAGCCATATGGTCTKSAGTKKTGT (SEQ ID NO: AGYTGGGGAGAACTATTCARYTAAGTGTACTGGCGACAAGTGCAC 45) CATCGAGGAC S4_2_bb3_O3.2 TAGCGGAGGCGGAGGGTCGGCTAGCCATATGGTCTKSAGTKKTGT (SEQ ID NO: AGYTACCCCGACATTTTCARYTAAGTGTACTGGCGACAAGTGCACC 46) ATCGAGGAC S4_2_bb3_O3.3 TAGCGGAGGCGGAGGGTCGGCTAGCCATATGTKSAGTKKTGTAGY (SEQ ID NO: TGGGGAGAACTATTCARYTAAGTGTCCTAAGGGGGGCAAGTGCAC 47) CATCGAGGAC S4 2 bb3 O4.1 GGTCTTGATGATCCCGCGCTGTGAGTCCTCGATGGTGCACTTG (SEQ ID NO: 48) S4 2 bb3 O4.2 GGTCTTGATGATCCCGCGATTCTTGTCCTCGATGGTGCACTTG (SEQ ID NO: 49) S4 2 bb3 O4.3 GGTCTTGATGATCCCGCGCCCGCCATAGTCCTCGATGGTGCACTTG (SEQ ID NO: 50) S4_2_bb3_O5.1 CGCGGGATCATCAAGACCACGATTGGAGATACATGTGAGSHGKYG (SEQ ID NO: KMTAAGGCGGYTCAAAAGGCTSVGAAAGGCTCGTGGGGCTCG 51) S4_2_bb3_O5.2 CGCGGGATCATCAAGACCGTTACTGGCAGTCGCTGTGAGSHGKYG (SEQ ID NO: KMTAAGGCGGYTCAAAAGGCTSVGAAAGGCTCGTGGGGCTCG 52)

    TABLE-US-00003 TABLE 3 Computationally designed protein sequences for S4_1 design series. Design Expression name Sequence vector S4_1.1 MDGTLQINSNGIKVKCPKGGECTIKDSQRGIIKTFSSGTEEV pET21b (SEQ ID RSPS LGKVTVGDNTFEASNGSWLEHHHHHH NO: 53) S4_1.2 MHHHHHHWGSPGTVTLNSNGLTVTGNDNYNLTVTGNDRGIIK pET11b (SEQ ID T FSPSTETTNDDGMSTITVGNLTVTLGN NO: 54) S4_1.3 MHHHHHHWGSQSTVNVQDKNIRIEVDDKNSVQVNGSNRGIIK pET11b (SEQ ID TF SPGTVQISSKNGDTVTVGNVRVNMGG NO: 55) S4_1.4 MHHHHHHWGSQSTVNVQDKNIRIECDDNCGVQVNGSNRGIIK pET11b (SEQ ID T FSPGTVQISSKNGDTVTVGNVRVNMGG NO: 56) S4_1.5 MHHHHHHWGSDGTLQINSHGVKVKAPPGSGATVKDSQRGIIK pET11b (SEQ ID TF SSGYEEVRSPSLGKVTVGDNTFEVSN NO: 57) S4_1.6 MHHHHHHWGSDGTLQINSHGVKVKCPKGSECTVKDSQRGIIK pET11b (SEQ ID TF SSGYEEVRSPSLGKVTVGDNTFEVSN NO: 58) S4_1.7 MHHHHHHGSKVTFRQDKNGIKIRVNGNKGLVIRTNDRGIIKT pET11b (SEQ ID FS NGTYDIPNSGYNRFTVGGTQFDWNE NO: 59) S4_1.8 MHHHHHHGSKVTFRQDKNGIKFRVNGNKGAVIRTNDRGIIKT pET11b (SEQ ID FS NGTYDIPNSGYNRFTVGGNTFDWNE NO: 60) S4_1.9 MDGTLQINSNGVKVKCPKGVECTVKDSQRGIIKTFSSGTEEV pET21b (SEQ ID RSP SLGKVTVGDNTFEVSNGSWLEHHHHHH NO: 61) S4_1.10 MDGTLQINSNGVKVKCPKGAECTVKVSQRGIIKTFSSGTEEV pET21b (SEQ ID RSP SLGKVTVGDNTTEVSNGSWLEHHHHHH NO: 62) S4_1.11 MHHHHHHWGSPGTVKLNSNGLTVRGNDSYGLTVRGNDRGIIK pET11b (SEQ ID T FSPSTEVVQSKGMSTITVGNLDVRLGE NO: 63)

    TABLE-US-00004 TABLE 4 Computationally designed protein sequences for S0_1 design series. Design Expression name Sequence vector S0_1.1 PEDAQKEASKGSEVRELKNIIDKQLLPIVNKTSCSGAEQAA pET21 (SEQ ID EAL NO: 64) REALEGAGSCDAVEQLLGNIKEIKCGTDAGRALIRILAEVA REI GCPRAIDQVAEWVRRIAKAVGGEEAKKQVKEVEKEIRREKG S0_1.17 PEDAQKEASKGSEVRELKNIIDKQLLPILNKASCSGAEQLL pET21 (SEQ ID EAL NO: 65) REALEGAGSCDAVEQLLGNIKEIKCGTDAGRALKRILEEVQ REI GCGSW S0_1.37 CDQLKNYIDKQLLPIVNKQSCANGEEALKDIEKALRGAGSK pET21 (SEQ ID DC WKELLSNIKEIKCGKEFAEKLKKEWERIKKEAGD NO: 66) S0_1.38 CDQIKNYIDKQLLPIVNKAGCGSAEEALKDIEKALRLAGSK pET21 (SEQ ID DCL KEIFSNIKEIKCGKEFAEKLKKEWERIKKEAGD NO: 67) S0_1.39 CDQIKNYIDKQLLPIVNKAGCGSAEEVLKDIEKALRNAGSK pET21 (SEQ ID DCL KEIFSGIKEIKCGKEQAEKLKKEWERIKKEAGDG NO: 68) S0_1.40 ADQIKNYIDKQLLPIVNKAGCGSAEEVLKDIEKALRNAGSK pET21 (SEQ ID DA LKEIFSGIKEIKCGKEQAEKLKKEWERIKKEAGDG NO: 69)

    TABLE-US-00005 TABLE 5 Protein sequences for S4_2 design series. Successful Design name Sequence expression S4_2.07 MCSVVVGENYSIKCNPDGKCTIEDKNRGIIKTV yes (SEQ ID NO: TGSRCELLYKAVQ KAQKGSWGSHHHHHH 70) S4_2.19 MPNTNVFPSFSFTCLPDGKCIIEDSQRGIIKTG yes (SEQ ID NO: KNKEEFMEDFEKQV RAQGSWGSHHHHHH 71) S4_2.20 MPSIYSDVPGGNIKVKCHEGKCTIEDSQRGIIK yes (SEQ ID NO: TVPMIETGEEMWK 72) QVQEVLEEKRGSWGSHHHHHH S4_2.21 MPKTNVIPSFSFTCLGEKCTIEDSQRGIIKTGK yes (SEQ ID NO: NKEEVLEDFEKEER AQGSWSHHHHHH 73) S4_2.22 MPSIYSDVPGNIKVKCHEGKCTIEDSQRGIIKT yes (SEQ ID NO: VPMIETGEEMWKQ 74) PQELLEEKRGSWGSHHHHHH S4_2.35 MPNTNVFPSFSFTCLPDGKCIIEDSQRGIIKTG yes (SEQ ID NO: KNKEEFMEDFEKKV RAQGSWGSHHHHHH 75) S4_2.45 MVCSVVVGENYSIKCDATKCTIEDKNRGIIKTV yes (SEQ ID NO: TGSRCEELAKAV QKAQKGSWGSHHHHHH 76) S4_2.60 MPSIYSDVPGGNVKVKCHEGKCTIEDSQRGIIK yes (SEQ ID NO: TVPMIETGEEMWK 77) QVQEVVEEKRGSWGSHHHHHH S4_2.68 MPSIHSVVVGGNIKVKCHEGKCTIEDSQRGIIK yes (SEQ ID NO: TVPMIETGEEMQK 78) QVQEFLEAKRGSWGSHHHHHH S4_2.73 MVCSVVVGENYSIKCDATKCTIEDSQRGIIKTG yes (SEQ ID NO: THPEEFLEDLEKK ARAQGSWGSHHHHHH 79) S4_2.74 MVFSCVVGENYSIKCDATKCTIEDSQRGIIKTG yes (SEQ ID NO: THPEEFLEDLEKK ARAQGSWGSHHHHHH 80) S4_2.84 MPSIHSVVPGGNIKVKCHEGKCTIEDSQRGIIK yes (SEQ ID NO: TVPMIETGEEMWK 81) QPQELLEEKRGSWGSHHHHHH S4_2.85 MPNTNVFPSFSFTCLPDGKCIISDSQRGIIKTG yes (SEQ ID NO: KNKEEFMEDFEKQV RAQGSWGSHHHHHH 82) S4_2.94 HMPSIHSVVAGGNIKVKCHEGKCTIEDSQRGII yes (SEQ ID NO: KTFTGFEPEEVWK 83) QAQEFLEEKRGSWGSHHHHH

    TABLE-US-00006 TABLE 6 Protein sequences for S0_2 design series. Successful Design name Sequence expression S0_2.37 MSCDQIKNYIDKQLLPIVNKAGCSRPEELEERI no (SEQ ID NO: RRALKKFGDT 84) DCLKDILLGIKEWKCGGSLEHHHHHH S0_2.79 MPCDKQKNYIDKQLLPIVNKAGCSRPEEVEEMV yes (SEQ ID NO: RRALKKLGE 85) TPCLEDILRGIKEIKCGGSLEHHHHHH S0_2.10 MPCDDAKNYIDKQLLPIVNKAGCSRPEEVERAV yes (SEQ ID NO: RKMLKKMG 86) NTDCLEDILRGIKEIKCGGSLEHHHHHH S0_2.102 MSCDQIKNYIDKQLLPIVNKAGCGSAKEVQKDI no (SEQ ID NO: EKALRNAGV 87) KDCLEDILRGIKEWKCGGSLEHHHHHH S0_2.31 MSCDESKNYIDKQLLPIVNKAGCDRPEDVERWI no (SEQ ID NO: RKALKKMG 88) DTSCFDEILKGLKEIKCGGSLEHHHHHH S0_2.197 MSCDQIKNYIDKQLLPIVNKAGCSRPEEVEERI no (SEQ ID NO: RRALKKMGDT 89) SCFDEIMKGLKEIKCGGSLEHHHHHH S0_2.57516 MSCDQIKNYIDKQLLPIVNKAGCNRPEEFEEWI no (SEQ ID NO: KRALKKLGDT 90) SCLEDILRGIKEIKCGGSLEHHHHHH S0_2.57575 MSCDQIKNYIDKQLLPIVNKAGCSRPEEVEEMV no (SEQ ID NO: RRALKKLGE 91) TPCLEDILRGIKEWKCGGSLEHHHHHH S0_2.57588 MSCDQIKNYIDKQLLPIVNKAGCSRPEEVERAV no (SEQ ID NO: RKMLKKMG 92) NTDCLEDILRGIKEIKCGGSLEHHHHHH S0_2.57855 MSCDQIKNYIDKQLLPIVNKAGCGSAKEVQKDI no (SEQ ID NO: EKALRNAGV 93) KDCLKEIFSGIKEIKCGGSLEHHHHHH S0_2.57910 MSCDQIKNYIDKQLLPIVNKAGCGSAKEVQKDI no (SEQ ID NO: EKALRNAGV 94) KDCLEDILRGIKEIKCGGSLEHHHHHH S0_2.57911 MSCEEAKNYIDKQLLPIVNKAGCGSAEEVQKDI no (SEQ ID NO: EKALRNAGV 95) KDCLEDILRGIKEWKCGGSLEHHHHHH S0_2.57 MPCDDAKNYIDKQLLPIVNKAGCSRPEEVEERI yes (SEQ ID NO: RRALKKMGD 96) TSCFDEIMKGLKEIKCGGSLEHHHHHH S0_2.58980 MSCEEAKNYIDKQLLPIVNKAGCSRPEELEEMI no (SEQ ID NO: RRALKKMGD 97) TSCFDEIMKGLKEIKCGGSLEHHHHHH S0_2.611 MPCDKQKNYIDKQLLPIVNKAGCGSAKEVQKDI yes (SEQ ID NO: EKALRNAG 98) VKDCLEDILRGIKEWKCGGSLEHHHHHH S0_2.126 MPCDKQKNYIDKQLLPIVNKAGCSRPEEVEERI yes (SEQ ID NO: RRALKKMGD 99) TSCFDEILKGLKEIKCGGSLEHHHHHH

    TABLE-US-00007 TABLE 7 Refinement statistics of the S0_2.126 NMR structure. NMR restraints Total NOEs from Unio (a) 306 Intraresidual 124 Interresidual 182 Sequential (i − j = 1) 112 Medium-range (1 < i − j < 5) 47 Long-range (i − j ≥ 5) 23 Dihedral Angles from Talos-n (b) 88 Φ 43 Ψ 45 Structural statistics Violations (c) Distance restraints (Å) 0.0254 ± 0.009 Dihedral angle constraints (°)  6.8 ± 0.12 Ramachandran plot (all residues/ ordered residues)(d) Most favored (%) 84.7/95.8 Additionally allowed (%) 14.3/4.5  Generously allowed (%) 0.98/0.1  Disallowed (%) 0/0 Average pairwise RMSD (Å) (e) Heavy 3.3/1.8 Backbone 2.8/1.2 Structure Quality Factors (raw score/z-text missing or illegible when filed Procheck G-factor (phi/psi) 0.15/0.9  Procheck G-factor (all) −0.48/−2.84 (a) From UNIO-ATNOS/CANDID's last cycle (cycle 7) (b) Obtained from chemical shifts with Talos-N server (c) From Cyana in Unio's last cycle (d)All residues from Cyana un Unio's last cycle; ordered residues (5-22, 26-57) from the Protein Structure Validation Suite at http://psvs-1_5-dev.nesg.org/results/testbc/OUTPUT.html (e) From the Protein Structure Validation Suite text missing or illegible when filed indicates data missing or illegible when filed

    TABLE-US-00008 TABLE 8 X-ray data collection and refinement statistics of S0_2.126 crystal structure. D25 S0_2.126 Wavelength 0.9763 Resolution range 49.09-3.0 (3.107-text missing or illegible when filed Space group P 21 21 21 Unit cell 126.3 127.0 156.1 90 90 90 Total reflections 700184 (72248) Unique reflections 50740 (5000) Multiplicity 13.8 (14.4) Completeness (%) 98.76 (99.22) Mean I/sigma(I) 12.63 (2.00) Wilson B-factor 74.78 R-merge 0.1622 (1.484) R-meas 0.1684 (1.538) R-pim 0.04506 (0.4019) CC1/2 0.999 (0.893) CC* 1 (0.971) Reflections used in text missing or illegible when filed 50284 (4971) Reflections used for R-free 2519 (249) R-work 0.2699 (0.3677) R-free 0.2936 (0.3972) CC(work) 0.949 (0.817) CC(free) 0.958 (0.793) Number of non-hydrogen text missing or illegible when filed 14453 macromolecules 14452 Protein residues 1921 RMS(bonds) 0.004 RMS(angles) 1.02 Ramachandran favored (%) 94.45 Ramachandran allowed (%) 5.07 Ramachandran outliers (%) 0.48 Rotamer outliers (%) 0.00 Clashscore 7.35 Average B-factor 97.74 macromolecules 97.74 solvent 59.33 Number of TLS groups 12 text missing or illegible when filed indicates data missing or illegible when filed

    TABLE-US-00009 TABLE 9 X-ray data collection and refinement statistics of S4_2.45 crystal structure. 101F S4_2.45 Wavelength 0.98 Resolution range 38.49-2.6 (2.693-text missing or illegible when filed Space group P 32 2 1 Unit cell 148.224 148.224 45.046 Total reflections 113069 (7302) Unique reflections 17464 (1567) Multiplicity 6.5 (4.7) Completeness (%) 98.57 (89.58) Mean I/sigma(I) 17.03 (1.66) Wilson B-factor 56.09 R-merge 0.06712 (0.8361) R-meas 0.07282 (0.9424) R-pim 0.02776 (0.4231) CC1/2 0.999 (0.635) CC* 1 (0.881) Reflections used in text missing or illegible when filed 17455 (1565) Reflections used for R-free 1748 (166) R-work 0.2298 (0.3682) R-free 0.2736 (0.3503) CC(work) 0.462 (0.203) CC(free) 0.353 (0.190) Number of non-hydrogen text missing or illegible when filed 3794 macromolecules 3686 solvent 108 Protein residues 485 RMS(bonds) 0.010 RMS(angles) 1.46 Ramachandran favored (%) 93.53 Ramachandran allowed (%) 5.64 Ramachandran outliers (%) 0.84 Rotamer outliers (%) 0.96 Clashscore 2.19 Average B-factor 38.90 macromolecules 38.37 solvent 56.78 Number of TLS groups 3 text missing or illegible when filed indicates data missing or illegible when filed

    REFERENCES FOR METHODS SECTION

    [0170] 1. J. S. McLellan et al., Structure of RSV fusion glycoprotein trimer bound to a prefusion-specific neutralizing antibody. Science 340, 1113-1117 (2013). [0171] 2. J. Zhou, G. Grigoryan, Rapid search for tertiary fragments reveals protein sequence-structure relationships. Protein Sci 24, 508-524 (2015). [0172] 3. T. J. Brunette et al., Exploring the repeat protein universe through computational protein design. Nature 528, 580-584 (2015). [0173] 4. J. Bonet et al., Rosetta FunFolDes—A general framework for the computational design of functional proteins. PLoS Comput Biol 14, e1006623 (2018). [0174] 5. X. Hu, H. Wang, H. Ke, B. Kuhlman, High-resolution design of a protein loop. Proc Natl Acad Sci USA 104, 17668-17673 (2007). [0175] 6. P. Conway, M. D. Tyka, F. DiMaio, D. E. Konerding, D. Baker, Relaxation of backbone bond geometry improves protein energy landscape modeling. Protein Sci 23, 47-55 (2014). [0176] 7. J. S. McLellan et al., Structure of a major antigenic site on the respiratory syncytial virus fusion glycoprotein in complex with neutralizing antibody 101F. J Virol 84, 12236-12244 (2010). [0177] 8. V. Mas et al., Engineering, Structure and Immunogenicity of the Human Metapneumovirus F Protein in the Postfusion Conformation. PLoS Pathog 12, e1005859 (2016). [0178] 9. M. D. Tyka et al., Alternate states of proteins revealed by detailed energy landscape mapping. J Mol Biol 405, 607-618 (2011). [0179] 10. M. D. Finucane, M. Tuna, J. H. Lees, D. N. Woolfson, Core-directed protein design. I. An experimental method for selecting stable proteins from combinatorial libraries. Biochemistry 38, 11604-11612 (1999). [0180] 11. P. Kristensen, G. Winter, Proteolytic selection for protein folding using filamentous bacteriophages. Fold Des 3, 321-328 (1998). [0181] 12. A. Chevalier et al., Massively parallel de novo protein design for targeted therapeutics. Nature 550, 74-79 (2017). [0182] 13. F. Sesterhenn et al., Boosting subdominant neutralizing antibody responses with a computationally designed epitope-focused immunogen. PLoS Biol 17, e3000164 (2019). [0183] 14. G. Chao et al., Isolating and engineering human antibodies using yeast surface display. Nat Protoc 1, 755-768 (2006). [0184] 15. M. G. Joyce et al., Iterative structure-based improvement of a fusion-glycoprotein vaccine against RSV. Nat Struct Mol Biol 23, 811-820 (2016). [0185] 16. B. Briney et al., Tailored Immunogens Direct Affinity Maturation toward HIV Neutralizing Antibodies. Cell 166, 1459-1470 e1411 (2016). [0186] 17. A. Rohou, N. Grigorieff, CTFFIND4: Fast and accurate defocus estimation from electron micrographs. J Struct Biol 192, 216-221 (2015). [0187] 18. J. M. de la Rosa-Trevin et al., Scipion: A software framework toward integration, reproducibility and validation in 3D electron microscopy. J Struct Biol 195, 93-99 (2016). [0188] 19. S. H. Scheres, RELION: implementation of a Bayesian approach to cryo-EM structure determination. J Struct Biol 180, 519-530 (2012). [0189] 20. A. Punjani, J. L. Rubinstein, D. J. Fleet, M. A. Brubaker, cryoSPARC: algorithms for rapid unsupervised cryo-EM structure determination. Nat Methods 14, 290-296 (2017). [0190] 21. M. Sattler, J. Schleucher, C. Griesinger, Heteronuclear multidimensional NMR experiments for the structure determination of proteins in solution employing pulsed field gradients. Frog Nucl Mag Res Sp 34, 93-158 (1999). [0191] 22. T. Herrmann, P. Guntert, K. Wuthrich, Protein NMR structure determination with automated NOE-identification in the NOESY spectra using the new software ATNOS. Journal of Biomolecular Nmr 24, 171-189 (2002). [0192] 23. T. Herrmann, P. Guntert, K. Wuthrich, Protein NMR structure determination with automated NOE assignment using the new software CANDID and the torsion angle dynamics algorithm DYANA. Journal of Molecular Biology 319, 209-227 (2002). [0193] 24. D. Gottstein, D. K. Kirchner, P. Guntert, Simultaneous single-structure and bundle representation of protein NMR structures in torsion angle space. J Biomol NMR 52, 351-364 (2012). [0194] 25. Y. Shen, A. Bax, Protein backbone and sidechain torsion angles predicted from NMR chemical shifts using artificial neural networks. Journal of Biomolecular Nmr 56, 227¬241 (2013). [0195] 26. W. Kabsch, Xds. Acta Crystallogr D 66, 125-132 (2010). [0196] 27. A. J. Mccoy et al., Phaser crystallographic software. J Appl Crystallogr 40, 658-674 (2007). [0197] 28. P. Emsley, B. Lohkamp, W. G. Scott, K. Cowtan, Features and development of Coot. Acta Crystallogr D 66, 486-501 (2010). [0198] 29. P. D. Adams et al., PHENIX: a comprehensive Python-based system for macromolecular structure solution. Acta Crystallogr D 66, 213-221 (2010). [0199] 30. P. A. Karplus, K. Diederichs, Linking crystallographic model and data quality. Science 336, 1030-1033 (2012).