PEPTIDE EXHIBITING EXCELLENT ADHESION TO RESINS AND BIOCOMPATIBLE FUNCTIONAL MATERIAL USING SAME
20220211899 · 2022-07-07
Inventors
- Tomio Iwasaki (Tokyo, JP)
- Masashi Maruyama (Tokyo, JP)
- Takeshi SERIZAWA (Tokyo, JP)
- Toshiki SAWADA (Tokyo, JP)
Cpc classification
A61L29/041
HUMAN NECESSITIES
A61L2300/25
HUMAN NECESSITIES
A61L31/048
HUMAN NECESSITIES
A61L27/16
HUMAN NECESSITIES
A61L29/041
HUMAN NECESSITIES
A61L31/048
HUMAN NECESSITIES
A61L29/16
HUMAN NECESSITIES
A61L31/16
HUMAN NECESSITIES
C08L33/12
CHEMISTRY; METALLURGY
A61L15/24
HUMAN NECESSITIES
A61L27/16
HUMAN NECESSITIES
A61L29/14
HUMAN NECESSITIES
C07K17/00
CHEMISTRY; METALLURGY
A61L15/24
HUMAN NECESSITIES
A61L31/14
HUMAN NECESSITIES
C08L27/18
CHEMISTRY; METALLURGY
A61L27/54
HUMAN NECESSITIES
C08L33/12
CHEMISTRY; METALLURGY
C08L27/18
CHEMISTRY; METALLURGY
A61L15/42
HUMAN NECESSITIES
International classification
A61L15/24
HUMAN NECESSITIES
A61L27/16
HUMAN NECESSITIES
A61L27/54
HUMAN NECESSITIES
A61L29/16
HUMAN NECESSITIES
A61L31/16
HUMAN NECESSITIES
C07K17/00
CHEMISTRY; METALLURGY
Abstract
The present invention provides a biocompatible material improved in biocompatibility owing to adsorption of a peptide that has high adhesion with a resin and hardly separates from a surface of the resin, and a functional material including the biocompatible material. The biocompatible material includes a resin and a peptide adsorbed on the resin. The resin has methoxycarbonyl groups and methyl groups, and tryptophan or arginine accounts for 70% or more of amino acid residues in the peptide. As an alternative, the resin is a fluorinated resin, and 2,3,4,5,6-pentafluoro-phenylalanine, 3-(trifluoromethyl)alanine, serine, threonine, histidine, aspartic acid, glutamic acid, phenylalanine, or aspartic acid accounts for 40% or more of the amino acid residues in the peptide. The functional material includes the biocompatible material, and a functional substance. The functional substance is held on a surface of the biocompatible material or is released from the surface of the biocompatible material.
Claims
1. A biocompatible material comprising: a resin; and a peptide adsorbed on the resin, wherein the resin has methoxycarbonyl groups and methyl groups, and tryptophan or arginine accounts for 70% or more of amino acid residues in the peptide.
2. The biocompatible material according to claim 1, wherein proline or glutamic acid accounts for 10% or more of the amino acid residues in the peptide.
3. The biocompatible material according to claim 1, wherein the peptide contains a tryptophan residue as a 2n-th (where n represents a natural number, and the same will apply hereinafter) amino acid residue, an arginine residue as a (2n+2)th amino acid residue, and a tryptophan residue as a (2n+4)th amino acid residue, all, as counted from an N-terminus.
4. The biocompatible material according to claim 3, wherein the peptide contains an arginine residue as a (2m−1)th (where m represents a natural number, and the same will apply hereinafter) amino acid residue, a tryptophan residue as a (2m+1)th amino acid residue, and a proline residue as a (2m+3)th amino acid residue, all, as counted from the N-terminus, an arginine residue as a (2m−1)th amino acid residue, a tryptophan residue as a (2m+1)th amino acid residue, and an arginine residue as a (2m+3)th amino acid residue, all, as counted from the N-terminus, a tryptophan residue as a (2m−1)th amino acid residue, a tryptophan residue as a (2m+1)th amino acid residue, and a proline residue as a (2m+3)th amino acid residue, all, as counted from the N-terminus, or a glutamic acid residue as a (2m−1)th amino acid residue, a tryptophan residue as a (2m+1)th amino acid residue, and a proline residue as a (2m+3)th amino acid residue, all, as counted from the N-terminus.
5. The biocompatible material according to claim 1, wherein the peptide is a peptide including an amino acid sequence with one or two amino acid residues added to, inserted into, substituted for, or deleted from an amino acid sequence represented by any one of the following SEQ ID NOs. (1-1) to (1-5): TABLE-US-00007 RWWRPWW . . . (1-1) RWWRRWW . . . (1-2) WWWRPWW . . . (1-3) EWWRPWR . . . (1-4) RWWRPWR . . . (1-5)
6. The biocompatible material according to claim 1, wherein the resin is poly(methyl methacrylate) resin.
7. The biocompatible material according to claim 1, wherein the resin is isotactic poly(methyl methacrylate) resin.
8. A biocompatible material comprising: a resin; and a peptide adsorbed on the resin, wherein the resin is a fluorinated resin, and 2,3,4,5,6-pentafluorophenylalanine, 3-(trifluoromethyl)alanine, serine, threonine, histidine, aspartic acid, glutamic acid, phenylalanine, or asparagine accounts for 40% or more of amino acid residues in the peptide.
9. The biocompatible material according to claim 8, wherein the peptide is a peptide including an amino acid sequence represented by any one of the following SEQ ID NOs. (A-1) to (A-21) where Z denotes a 2,3,4,5,6-pentafluorophenylalanine residue, and X denotes a 3-(trifluoromethyl)alanine residue, or a peptide including an amino acid sequence with one or two amino acid residues added to, inserted into, substituted for, or deleted from an amino acid sequence represented by any one of the following SEQ ID NOs. (A-1) to (A-21): TABLE-US-00008 ZZXXZ . . . (A-1) ZXXZZ . . . (A-2) XXZZX . . . (A-3) XZZXX . . . (A-4) STSTS . . . (A-5) TSTST . . . (A-6) SSSSS . . . (A-7) TTTTT . . . (A-8) HHHHH . . . (A-9) DSDSD . . . (A-10) SDSDS . . . (A-11) DHDHD . . . (A-12) HDHDH . . . (A-13) DEDED . . . (A-14) EDEDE . . . (A-15) FFHHF . . . (A-16) FHHFF . . . (A-17) HHFFH . . . (A-18) HFFHH . . . (A-19) NENEN . . . (A-20) ENENE . . . (A-21)
10. The biocompatible material according to claim 8, wherein the peptide is a peptide including an amino acid sequence represented by any one of the following SEQ ID NOs. (3-1) to (3-5), or a peptide including an amino acid sequence having an identity of 80% or greater to any one of the following SEQ ID NOs. (3-1) to (3-5): TABLE-US-00009 VHFPTKISEGDM . . . (3-1) SPHLHTSSPWER . . . (3-2) FIESKTPVDPDG . . . (3-3) EALTVNIKREME . . . (3-4) SMIVEPRMLSTH . . . (3-5)
11. The biocompatible material according to claim 8, wherein the resin is polytetrafluoroethylene.
12. The biocompatible material according to claim 1, wherein the resin is a composite with a fibrous material or a filler material.
13. The biocompatible material according to claim 1, wherein the resin is laminated on an adherend different from the resin.
14. The biocompatible material according to claim 1, wherein the resin constitutes a housing for a device including a system component or an electronic component.
15. A functional material comprising: the biocompatible material according to claim 1; and a functional substance that functions in a living body or on a surface of the living body, wherein the functional substance is held on a surface of the biocompatible material, or is released from the surface of the biocompatible material.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
MODES FOR CARRYING OUT THE INVENTION
[0040] With reference to the figures, a description will hereinafter be made regarding peptides according to an embodiment of the present invention, biocompatible materials using the same, and functional materials using the same. In the individual figures to be referred to hereinafter, common elements are identified by the same reference signs, and their repeated descriptions are omitted.
<Biocompatible Materials>
[0041]
As illustrated in
[0042] The biocompatible material 10 has a structure that the adsorptive peptide 2, a substance similar to biological substances, is adsorbed on the resin 1, and therefore is useful as a material that shows good biocompatibility compared with a case in which the resin 1 alone is used as a material. Throughout this specification, the term “biocompatibility” means a property of a material, by virtue of which it can coexist with a living body while fulfilling its inherent function without giving adverse effect or strong irritation to the living body over a long term.
[0043] The biocompatible material 10 can be used as a material for an optional article having a possibility of contact with a living body. Articles formed with the biocompatible material 10 are not particularly limited in kind, use, function, and so on insofar as they can be brought into contact with living bodies. The biocompatible material 10 is suitably used in a living body, for example, the human body, on a surface, for example, a skin of a living body, and for a use where the biocompatible material 10 comes into contact with another tissue or organ.
[0044] Specific examples of the articles formed with the biocompatible material 10 include artificial organs, artificial tissues, implantable therapeutic devices, epidermally fixed therapeutic devices, diagnostic devices, therapeutic appliances, surgical appliances, surgical materials, osteosynthesis materials, dental materials, filler materials, osteotomy appliances, orthodontic appliances, other prosthetic devices, contact lenses, eye glasses, clothing, footwear, wound dressings such as adhesive bandages and gauze, bandages, plasters, poultices, and so on.
[0045] The resin 1 that constitutes the biocompatible material 10 may be in any form such as a molded body or a non-molded solid body. The resin 1 can be formed in, but is not particularly limited to, an appropriate shape according to the kind, use, function, and the like of each article to be formed with the biocompatible material 10. The resin 1 may constitute the entire portion or only a portion of the article. As the resin 1, a resin having methoxycarbonyl groups and methyl groups or a fluorinated resin is used as will be described subsequently herein.
[0046] The adsorptive peptide 2, which constitutes the biocompatible material 10, is adsorbed to the resin 1 via non-covalent bonding, intermolecular forces such as van der Waals forces, hydrogen bonds, or dipole interactions, and is held on a surface of the resin 1. The adsorptive peptide 2 may be adsorbed on the entire area or a part of the surface of the resin 1. Used as the adsorptive peptide 2 is, as will be described subsequently herein, a peptide that has a predetermined amino acid sequence and shows specific affinity with the particular resin 1.
<Separation Energy>
[0047] The affinity (binding force) between a resin and an adsorptive peptide can be evaluated by the value of separation energy. Separation energy is defined as a difference in energy between a state in which the resin and the adsorptive peptide are adsorbed each other, and a state in which the resin and the adsorptive peptide are dissociated from each other.
[0048] An adsorption reaction (association reaction and dissociation reaction), in which a composite AB is formed through interaction between a resin A and a peptide B, can be expressed by the following reaction formula (1). In the reaction formula (1):
where k.sub.1 represents an association rate constant [M.sup.−1.Math.s.sup.−1], and k.sub.−1 represents a dissociation rate constant [s.sup.−1].
[0049] Assuming that the resin A and the peptide B follows a first order reaction, the rate equation of the adsorption reaction of the formation of the composite AB is expressed by the following equation (2):
where [A] represents the concentration of the resin A, [B] represents the concentration of the peptide B, and [AB] represents the concentration of the composite AB, at a given time t.
[0050] Calculating with the left side of the equation (2) set at 0, the equilibrium constant Ka of the reaction formula (1) satisfies the following equation (3):
[0051] The standard Gibbs energy ΔG [J/mol] in the adsorption reaction of the formation of the composite AB is expressed by the following equation (4):
[Math. 3]
ΔG=−RT ln(Ka) (4)
where R represents the gas constant R[J.Math.K.sup.−1.Math.mol.sup.−1], and T represents the absolute temperature [K].
[0052] The separation energy is equivalent to the standard Gibbs energy ΔG in the adsorption reaction of the formation of the composite AB, and therefore can be determined from the equations (3) and (4), using the association rate constant k.sub.1 and the dissociation rate constant k.sub.−1. Assuming the resin to be a ligand and a solution of the adsorptive peptide to be an analyte solution, the association rate constant k.sub.1 and the dissociation rate constant k.sub.−1 can be measured by a surface plasmon resonance method.
<PMMA-Adsorbed Peptides>
[0053] First, a description will be made regarding an example of adsorbed peptides, specifically a PMMA-adsorbed peptide that shows high affinity with a resin having methoxycarbonyl groups and methyl groups such as poly(methyl methacrylate) resin (PMMA).
[0054] The PMMA-adsorbed peptide is formed of an amino acid sequence containing one or more amino acid residues out of tryptophan (Trp: W), arginine (Arg: R), proline (Pro: P), and glutamic acid (Glu: E).
[0055] Table 1 shows the separation energies, association rate constants, and dissociation rate constants in the adsorption reactions between peptides and isotactic poly(methyl methacrylate) resin (it-PMMA), and the contents of tryptophan (W) and arginine (R) and the contents of proline (P) and glutamic acid (E) in amino acid sequences.
TABLE-US-00001 TABLE 1 Peptide - it-PMMA Separation energy Contents SIM Association of amino calculated Measured rate Amino acid acids value value constant Dissociation rate sequence W, R (P , E) [kJ/mol] [kJ/mol] [M.sup.−1 .Math. s.sup.−1] constant [10.sup.−3 .Math. s.sup.−1] 1-1 RWWRPWW 6/7 41.1 Unmeasurable 1.5 × 10.sup.2 0 (not Present (1/7) dissociated) Invention 1-2 RWWRRWW 7/7 38.1 Unmeasurable 1.6 × 10.sup.2 0 (not (0/7) dissociated) 1-3 WWWRPWW 6/7 37.2 — — — (1/7) 1-4 EWWRPWR 5/7 36.3 Unmeasurable 0.95 × 10.sup.2 0 (not (2/7) dissociated) 1-5 RWWRPWR 6/7 35.9 Unmeasurable 1.7 × 10.sup.2 0 (not (1/7) dissociated) 1-6 ELWRPTR 3/7 32.3 31.2 31 0.11 Non-Patent (2/7) Document 1 1-7 EAWRPTR 3/7 31.8 30.9 30 0.12 (2/7) 1-8 ELWRATR 3/7 23.7 22.6 3.4 0.38 (1/7) 1-9 QLQKYPS 0/7 26.5 25.0 13 0.58 (1/7) 1-10 ELWRPAR 3/7 28.7 27.8 17 0.24 (2/7) 1-11 ELWR 2/4 19.1 18.4 2.5 3.00 (1/4) 1-12 ARPHLSF 1/7 28.5 27.6 13 0.20 (1/7) 1-13 SSPWMRE 2/7 28.3 27.5 15 0.24 (2/7) 1-14 GIRHTNR 2/7 27.9 26.5 20 0.48 (0/7) 1-15 ALWRPTR 3/7 30.7 29.3 31 0.11 (1/7) 1-16 ELARPTR 2/7 32.1 31.0 29 0.11 (2/7) 1-17 ELWAPTR 2/7 31.2 29.7 23 0.15 (2/7) 1-18 ELWRPTA 2/7 30.2 28.7 13 0.13 (2/7) 1-19 RPTR 2/4 28.1 26.7 7.4 0.16 (1/4)
[0056] SEQ ID NOs. 1-1 to 1-5 are PMMA-adsorbed peptides according to the present invention, which have improved affinity with it-PMMA owing to molecular designing. SEQ ID NOs. 1-6 to 1-19 are the peptides described in Non-Patent Document 1 and having high affinity with it-PMMA.
[0057] In Table 1, there are shown, as separation energy, calculated values by a molecular dynamic simulation (SIM calculated values), and measured values calculated based on a measurement experiment. The measured values have been calculated from the equations (3) and (4), using the association rate constant k.sub.1 and the dissociation rate constant k.sub.−1 measured by the surface plasmon resonance method.
[0058] No measured values are available for SEQ ID NOs. 1-1 to 1-5, because the peptides have high affinity and no dissociation takes place. Measured values for SEQ ID NOs. 1-6 to 1-19 are calculated from the association rate constant k.sub.1 and the dissociation rate constant k.sub.−1 published in Non-Patent Document 1. The gas constant R is 8.314 [m.sup.2.Math.Kg.Math.s.sup.−2.Math.K.sup.−1.Math.mol.sup.−1], and the absolute temperature T is 300 [K].
[0059] Using the reactive molecular dynamics calculation program “ReaxFF” as in Non-Patent Document (Akbar Bagri et al., Nature Chemistry, 2010, 2, p. 581 to 587), the molecular dynamics simulation was conducted by simulating behaviors of atoms and molecules in water. ReaxFF is a program that uses both a relation between bond distance and bond order and a relations between bond order and bond energy in a calculation, and is characterized in that it provides a reactive force field for describing bond breaking and formation in a hydrocarbon-oxygen system. In ReaxFF, non-bonded interactions are analyzed by conducting a calculation with the connectivity varied between all atom pairs.
[0060] The measurement experiment by the surface plasmon resonance method was conducted using an intermolecular interaction analysis system “Biacore X” (manufactured by GE Healthcare) as in Non-Patent Document (Morio Arai, “Analysis of Biomolecular Interactions by Biosensor (BIACORE™) Using Surface Plasmon Resonance,” The Japanese Journal of Thrombosis and Hemostasis, The Japanese Society on Thrombosis and Hemostasis, Oct. 1, 1997, 8(5), p. 397 to 405).
[0061] Employed as it-PMMA was a resin having a number average molecular weight Mn of 32900, a weight average molecular weight Mw/number average molecular weight Mn ratio of 1.3, and a triad ratio mm:mr:rr of 97:3:0. it-PMMA was coated with a thickness of approximately 10 nm on a slide glass on which gold of a sensor chip was bonded, and the sensor chip coated with it-PMMA was installed in an analyzer.
[0062] As peptides, used were those which had the amino acid sequences shown in Table 1, had a free N-terminus, and were amidated at a C-terminus. Each peptide was purified by high-performance chromatography, and was then dissolved in 10 mM HEPES buffer (pH 7.4) with 150 mM of NaCl dissolved therein, so that an analyte solution was prepared.
[0063] In the measurement experiment by the surface plasmon resonance method, each analyte solution with the corresponding peptide dissolved therein was first allowed to flow at a temperature of 25° C. and a flow rate of 20 μm/min for two minutes over a surface of it-PMMA, thereby inducing an association reaction. Subsequently, the buffer without containing the peptide was allowed to flow for two minutes under similar conditions, thereby inducing a dissociation reaction.
[0064] Sensorgrams, which had been measured at a plurality of concentrations different from one another, were then subjected to simultaneous global fitting, using analysis software “BIAevaluation ver. 4.1” (created by GE Healthcare), whereby the association rate constant k.sub.1 and the dissociation rate constant k.sub.−1 were determined from a linear relation between resonance units RU and time-dependent variations d (RU)/dt in resonance units, the linear relation corresponding to the equation (2).
[0065] As shown in Table 1, the association rate constants of SEQ ID NOs. 1-1 to 1-5 generally had large values compared with that of SEQ ID NO. 1-6 the separation energy of which was the largest in Non-Patent Document 1. On the other hand, the dissociation rate constants of SEQ ID NOs. 1-1 to 1-5 did not reach any finite value greater than 0 because the peptides had high affinity with it-PMMA and their dissociation was not observed.
[0066] From results of the molecular dynamics simulation and the measurement experiment, it is envisaged that SEQ ID NOs. 1-1 to 1-5 are prone to associate with it-PMMA but are hard to dissociate from it-PMMA. The measured values of the separation energy of SEQ ID NOs. 1-1 to 1-5 are evidently greater compared with that of SEQ ID NO. 1-6, thereby enabling to confirm the high degrees of their affinity with it-PMMA.
[0067]
[0068] In
[0069] As illustrated in
[0070] Compared with SEQ ID NO. 1-6 the separation energy of which was the largest in Non-Patent Document 1, SEQ ID NOs. 1-1 to 1-5 are significantly improved in the calculated value of separation energy. SEQ ID NOs. 1-1 to 1-5 is therefore considered to be peptides that are high in affinity with it-PMMA and are excellent in adhesion with it-PMMA.
[0071] Next, measurement results of interactions between it-PMMA and a PMMA-adsorbed peptide by the surface plasmon resonance method will be described.
[0072]
As illustrated in
[0073]
[0074] As illustrated in each of
[0075] Next, results of atomic arrangements of it-PMMA and PMMA-adsorbed peptides as calculated by molecular dynamics simulations will be described.
[0076]
[0077] In each of
[0078] On the image of each of
[0079] As illustrated in each of
[0080] On the other hand, the backbone of the PMMA-adsorbed peptide is oriented substantially parallel to the molecular chains of it-PMMA, and forms a zigzag structure in a β-strand-like shape. The oxygen atoms (largest spheres) of the carbonyl groups existing in the backbone of the PMMA-adsorbed peptide are each located on a side of a proximal end of the facing methoxycarbonyl group (in a neighborhood of a facing ester group) in it-PMMA.
[0081] Further, the side chains of the amino acid residues located at odd-numbered positions as counted from the N-terminus toward the C-terminus, among the amino acid residues constituting the PMMA-adsorbed peptide, are located in the CH.sub.3OCO region, and are close to methoxycarbonyl groups of another it-PMMA adjacent it-PMMA that is closest to the backbone of the PMMA-adsorbed peptide.
[0082] On the other hand, the side chains of the amino acid residues located at even-numbered positions as counted from the N-terminus toward the C-terminus, among the amino acid residues constituting the PMMA-adsorbed peptide, are located in the CH.sub.3 region, and are close to the backbone and methyl groups of the it-PMMA located adjacent and on an opposite side of it-PMMA that is closest to the backbone of the PMMA-adsorbed peptide.
[0083] According to the simulation results illustrated in each of
[0084] Especially according to the simulation results illustrated in
[0085] Based on the results of Table 1 and
[0086] Therefore, the PMMA-adsorbed peptide preferably contains one or more amino acid residues among tryptophan (W), arginine (R), proline (P), and glutamic acid (E), with the content of tryptophan or arginine being high.
[0087] The PMMA-adsorbed peptide may also be formed using only W, R, P, and E, or may also be formed using other amino acid residues. The amino acid residues that constitute the PMMA-adsorbed peptide are each of the L-type, preferably.
[0088] The PMMA-adsorbed peptide has separation energy of preferably 35.0 kJ/mol or higher, more preferably 36.0 kJ/mol or higher, still more preferably 37.0 kJ/mol or higher, even more preferably 38.0 kJ/mol or higher.
[0089] The PMMA-adsorbed peptide has a length of preferably 5 or more amino acid residues, more preferably 6 or more amino acid residues. On the other hand, 100 or fewer amino acid residues are preferred, 20 or fewer amino acid residues are more preferred, 15 or fewer amino acid residues are still more preferred, and 10 or fewer amino acid resides are even more preferred. The longer the PMMA-adsorbed peptide, the higher affinity can be obtained with the resin. On the other hand, the shorter the PMMA-adsorbed peptide, the harder intramolecular or intermolecular aggregations take place, the easier the alterations such as chemical modifications and clustering. Particularly preferably, the PMMA-adsorbed peptide has a length of 7 amino acid residues.
[0090] In the PMMA-adsorbed peptide, it is preferred that tryptophan or arginine accounts for 70% or more of the amino acid residues. The content of each of tryptophane and arginine in the total length of the amino acid sequence is more preferably 75% or higher, still more preferably 80% or higher, even more preferably 85% or higher, yet more preferably 90% or higher. On the other hand, the content of tryptophane or arginine may be set at 100%, lower than 95%, or lower than 90%.
[0091] Tryptophane and arginine have relatively long side chains, and can form relatively strong interactions with methoxycarbonyl groups and methyl groups of the resin. Further, the side chain of tryptophan is relatively rigid, and tends to stabilize the structure of the backbone and the orientation of the side chains of the PMMA-adsorbed peptide. On the other hands, arginine has longer side chains than tryptophan, and therefore can form interactions different from those formed by tryptophan. If the content of tryptophan or arginine is increased, a PMMA-adsorbed peptide that shows high affinity with a resin having methoxycarbonyl groups and methyl groups is obtained.
[0092] In the PMMA-adsorbed peptide, it is preferred that proline or glutamic acid preferably accounts for 10% or more of the amino acid residues. The content of proline or glutamic acid in the total length of the amino acid sequence may be set at 15% or higher, or 20% or higher. Further, the content of proline or glutamic acid may be set at lower than 25%, lower than 20%, or lower than 15%.
[0093] Proline has a ring structure, so that the bond angle and dihedral angle of a peptide bond are restricted or fixed. Proline therefore exhibits an action to stabilize the structure of the backbone. On the other hand, glutamic acid has a relatively long side chain, and contains a polar group in the side chain. If proline or glutamic acid is interposed, the zigzag structure in a β-strand-like shape becomes resistant to disruption, and the structure of the backbone and the orientation of side chains may be stabilized.
[0094] Among the amino acid residues constituting the PMMA-adsorbed peptide, the amino acid residues located at the odd-numbered positions as counted from the N-terminus toward the C-terminus in the PMMA-adsorbed peptide and the amino acid residues located at the even-numbered positions, both, as counted from the N-terminus toward the C-terminus in the PMMA-adsorbed peptide preferably do not have a sequence containing two or more consecutive amino acid residues of the same type.
[0095] In the case of a sequence containing two or more consecutive amino acid residues of the same type, for example, like Trp-Xaa-Trp-Xaa-Trp (Xaa is an optional amino acid residue), odd-numbered side chains themselves and even-numbered side chains themselves interfere, so that the structure of the backbone is disrupted, or aggregations occur through intramolecular interactions. If formed in a sequence containing no consecutive amino acid residues of the same type, on the other hand, the structure of the backbone and the orientation of side chains in the PMMA-adsorbed peptide tend to be stabilized.
[0096] In the PMMA-adsorbed peptide, the even-numbered amino acid residues as counted from the N-terminus toward the C-terminus of the PMMA-adsorbed peptide may preferably have a sequence with Trp, Arg, and Trp in this order (Trp-Xaa-Arg-Xaa-Trp) or a sequence with Arg, Trp, and Arg in this order (Arg-Xaa-Trp-Xaa-Arg) (where the third amino acid residue is the last even-numbered amino acid residue located on the side of the C-terminus, or the next even-numbered amino acid residue is an intermediate amino acid residue that is an amino acid residue of a different type).
[0097] With such a sequence, amino acid residues of the same type do not follow continuously, the structure of the backbone and the orientation of the side chains of the PMMA-adsorbed peptide are stabilized, and interactions tend to occur between the side chains of the amino acid residues and the methyl groups of the resin. Such a sequence therefore tends to provide high affinity with the resin.
[0098] It is particularly preferred for the PMMA-adsorbed peptide that the 2n-th amino acid residue, the (2n+2)th amino acid residue, and the (2n+4)th amino acid residue, all, as counted from the N-terminus are tryptophan (W), arginine (R), and tryptophan (W), respectively (where n represents a natural number, and the (2n+4)th amino acid residue is the last even-numbered amino acid residue located on the side of the C-terminus or the next (2n+6)th amino acid residue is an intermediate amino acid residue that is an amino acid residue other than arginine).
[0099] In general, the even-numbered amino acid residues of the PMMA-adsorbed peptide come close to methyl groups of it-PMMA, thereby stabilizing the PMMA-adsorbed peptide. However, the side chain of arginine is long compared with a methyl group, so that the side chains of even-numbered arginine residues are prone to bending and tend to hardly orient toward adjacent molecular chains of the resin. If the even-numbered amino acid residues have a sequence of Arg, Trp, and Arg in this order, the side chains of arginine may interfere with one another across the adjacent even-numbered amino acid residue, so that the structure of the backbone of the PMMA-adsorbed peptide tends to be disrupted. If the even-numbered amino acid residues have a sequence of Trp, Arg, and Trp in this order, on the other hand, the structure of the backbone and the orientation of the side chains of the PMMA-adsorbed peptide can be stabilized while increasing the affinity with the resin.
[0100] It is preferred for the PMMA-adsorbed peptide that the (2m−1)th amino acid residue, the (2m+1)th amino acid residue, and the (2m+3)th amino acid residue, all, as counted from the N-terminus are arginine (R), tryptophan (W), and proline (P), respectively, the (2m−1)th amino acid residue, the (2m+1)th amino acid residue, and the (2m+3)th amino acid residue, all, as counted from the N-terminus are arginine (R), tryptophan (W), and arginine (R), respectively, the (2m−1)th amino acid residue, the (2m+1)th amino acid residue, and the (2m+3)th amino acid residue, all, as counted from the N-terminus are tryptophan (W), tryptophan (W), and proline (P), respectively, or the (2m−1)th amino acid residue, the (2m+1)th amino acid residue, and the (2m+3)th amino acid residue, all, as counted from the N-terminus are glutamic acid (E), tryptophan (W), and proline (P), respectively (where m represents a natural number).
[0101] In general, the odd-numbered amino acid residues of the PMMA-adsorbed peptide come close to methoxycarbonyl groups of it-PMMA, thereby stabilizing the PMMA-adsorbed peptide. However, a methoxycarbonyl group is long compared with a methyl group. Even if the odd-numbered amino acid residues have a sequence of Arg, Trp, and Arg in this order, side chains of the arginine residues rarely interfere with each other across the adjacent odd-numbered amino acid residue, so that the structure of the backbone of the PMMA-adsorbed peptide tends to be hardly disrupted. If the odd-numbered amino acid residues have the sequence of Arg, Trp, and Arg in this order, the side chains of arginine, which are longer than those of tryptophan, form intermolecular interactions, so that the affinity with the resin can be increased.
[0102] It is more preferred for the PMMA-adsorbed peptide that, when the (2m+3)th amino acid residue as counted from the N-terminus is proline (P), the (2m+5)th amino acid residue is tryptophan (W) or arginine (R).
[0103] If the (2m+5)th amino acid residue is Trp or Arg when the (2m+3)th amino acid residue is Pro, the zigzag structure of the backbone of the PMMA-adsorbed peptide is stabilized by the molecular structure of Pro, thereby tending to have the side chain of (2m+5)th Trp or Arg oriented toward the side of the methoxycarbonyl group of the adjacent molecular chain. The affinity with the resin may hence be increased if the (2m+5)th amino acid residue is Trp or Arg.
[0104] The PMMA-adsorbed peptide may have such a predetermined even-numbered amino acid sequence (W.R.W, R. W. R) or such a predetermined odd-numbered amino acid sequence (R.W.P, R.W.R, W.W.P, E.W.P) on a side closest to the N-terminus among all the amino acid residues, or at an intermediate position among all the amide acid residues. In other words, as the above-described numbers of the amino acid residues, n=1 and m=1 may be acceptable, or n>1 and m>1 may be acceptable. However, the PMMA-adsorbed peptide is preferably as short as 10 or fewer amino acid residues. In this case, the PMMA-adsorbed peptide may preferably have such a predetermined amino acid sequence on the side closest to the N-terminus among all the amino acid residues (amino acid residues of n=1 or m=1).
[0105] The PMMA-adsorbed peptide may also have one or a plurality of such predetermined even-numbered amino acid sequences (W.R.W, R.W.R) or such predetermined odd-numbered amino acid sequences (R.W.P, R.W.R, W.W.P, E.W.P) in the total length. However, the PMMA-adsorbed peptide is preferably as short as 10 or fewer amino acid residues. In this case, the PMMA-adsorbed peptide may preferably have a single unit of such a predetermined amino acid sequence in the total length.
[0106] The PMMA-adsorbed peptide may also have such a predetermined even-numbered amino acid sequences (W.R.W, R.W.R) and such a predetermined odd-numbered amino acid sequence (R.W.P, R.W.R, W.W.P, E.W.P) at positions consecutive to each other or at positions non-consecutive to each other. In other words, as the numbers of the above-described amino acid residues, n=m may be acceptable, or n≠m may be acceptable. However, the PMMA-adsorbed peptide is preferably as short as 10 or fewer amino acid residues. In this case, the PMMA-adsorbed peptide may preferably have such predetermined amino acid sequences at positions consecutive to each other (amino acid residues of n=m).
[0107] The PMMA-adsorbed peptide is preferably a peptide containing an amino acid sequence represented by any one of the following SEQ ID NOs. (1-1) to (1-5) with one or two amino acid residues added thereto, inserted thereinto, substituted therefor, or deleted therefrom, more preferably a peptide containing an amino acid sequence represented by any one of the following SEQ ID NOs. (1-1) to (1-5), particularly preferably an amino acid sequence represented by any one of the following SEQ ID NOs. (1-1) to (1-5). [0108] RWWRPWW . . . (1-1) [0109] RWWRRWW . . . (1-2) [0110] WWWRPWW . . . (1-3) [0111] EWWRPWR . . . (1-4) [0112] RWWRPWR . . . (1-5)
[0113] The PMMA-adsorbed peptide may also have an amino acid sequence having a specific function, in addition to the amino acid sequence represented by any one of SEQ ID NOs. 1-1 to 1-5. The PMMA-adsorbed peptide may have such an amino acid sequence on a side closest to the N-terminus among all the amino acid residues, or may have it at an intermediate position among all the amino acid sequences.
[0114] The PMMA-adsorbed peptide may also have one or a plurality of amino acid sequences of SEQ ID NOs. 1-1 to 1-5 in the total length. The PMMA-adsorbed peptide may have a single kind or plural types of these amino acid sequences.
[0115] The N-terminus and C-terminus of the PMMA-adsorbed peptide may be chemically modified, or may be in an optional ionization state. For example, the N-terminus may be any one of —NH.sub.2, —NH.sub.3.sup.+, —CH.sub.3CO, 9-fluorenylmethyloxycarbonyl (Fmoc) group, tert-butoxycarbonyl (Boc) group, or the like. The C-terminus may be any one of —COOH, —COO.sup.−, —CONH.sub.2.sup.−, —CONH.sub.3.sup.+, or the like.
[0116] If the PMMA-adsorbed peptide is a peptide containing an amino acid sequence represented by any one of SEQ ID NOs. 1-1 to 1-5 or an amino acid sequence similar to the above-mentioned amino acid sequence, the separation energy relative to a resin having methoxycarbonyl groups and methyl groups has a higher theoretical value, so that high affinity is obtained with the resin. Accordingly, the peptide adsorbed on the resin hardly undergoes separation, thereby enabling to obtain a biocompatible material the biocompatibility of which lasts over a longer term.
[0117] The PMMA-adsorbed peptide can be synthesized using a variety of synthesis methods including, for example, chemical synthesis methods such as liquid-phase synthesis methods and solid-phase synthesis methods, genetic engineering synthesis methods, and the like. Usable as liquid-phase synthesis methods are, for example, the synthesis method using a soluble anchor, which is described in Non-Patent Document (Keisuke Aihara et al., Organic Letters, 2015, 17(3), p. 696 to 699), and the stepwise method, the fragment condensation method, and the like, which are described in Non-Patent Document (Noboru Yanaihara, and two others, “Chemical Syntheses of Peptides and Their Applications,” Journal of Synthetic Organic Chemistry, The Society of Synthetic Organic Chemistry, Japan, Nov. 1, 1998, 46(11), p. 1073 to 1084). On the other hand, usable as the solid-phase synthesis methods are, for example, the various types of synthesis methods described in the above-described Non-Patent Document (Journal of Synthetic Organic Chemistry), and various types of synthesis methods described in Non-Patent Document (Kiyoshi Nokihara, “New Technology for Peptide Syntheses,” KOBUNSHI (in Japanese), The Society of Polymer Science, Japan, Sep. 1, 1994, 43(9), p. 611 to 615).
<Resin Having Methoxycarbonyl Groups and Methyl Groups>
[0118] As the resin on which the PMMA-adsorbed peptide is to be adsorbed (the resin 1 that constitutes the biocompatible material 10), any optional resin can be used insofar as it is a resin having methoxycarbonyl groups and methyl groups.
[0119] The resin on which the PMMA-adsorbed peptide is to be adsorbed may be a polymer of a monomer having a methoxycarbonyl group and a methyl group, a copolymer of a monomer having a methoxycarbonyl group and a monomer having a methyl group, or a copolymer of a monomer having a methoxycarbonyl group and a methyl group and another monomer. The copolymer may be any one of a block copolymer, a random copolymer, and a graft copolymer.
[0120] As the resin on which the PMMA-adsorbed peptide is to be adsorbed, poly(methyl methacrylate) resin (PMMA) is preferred, with isotactic poly(methyl methacrylate) resin (it-PMMA) being particularly preferred. If the resin is PMMA, the monomer has a methoxycarbonyl group and a methyl group, so that high affinity is available. If the resin is it-PMMA, on the other hand, methoxycarbonyl groups and methyl groups are arranged in a stereoregular and uniform conformation, so that higher affinity is available. Further, it-PMMA also facilitates processing of the biocompatible material as it has a lower glass transition temperature compared with atactic poly(methyl-methacrylate) resin (at-PMMA) or syndiotactic poly(methyl-methacrylate) resin(st-PMMA).
[0121] Isotactic poly(methyl methacrylate) resin (it-PMMA) has an isotactic triad fraction (mm) of 50% or higher, preferably 70% or higher, more preferably 90% or higher, still more preferably 95% or higher. it-PMMA may also contain a monomer other than methyl methacrylate.
[0122] Poly(methyl methacrylate) resin (PMMA) can be synthesized using, for example, the synthesis method described in Non-Patent Document 1. it-PMMA is obtained if methyl methacrylate is subjected to anionic polymerization in a non-polar solvent using as an initiator a Grignard reagent having a bulky substituent group such as a tert-butyl group. As the non-polar solvent, diethyl ether, dichloromethane, toluene, or the like can be used, for example.
<PTFE-Adsorbed Peptide>
[0123] As an example of the adsorptive peptide, a description will next be made regarding a PTFE-adsorbed peptide that shows high affinity with polytetrafluoroethylene resin (PTFE) or the like.
[0124] The PTFE-adsorbed peptide is formed of an amino acid sequence containing one or more types of amino acid residues among 2,3,4,5,6-pentafluorophenylalanine (Phe(5F): represented by Z), 3-(trifluoromethyl)alanine (2-amino-4,4,4-trufluorobutyric acid) (Abu(3F): represented by X), serine (Ser: S), threonine (Thr: T), histidine (His: H), aspartic acid (Asp: D), glutamic acid (Glu: E), phenylalanine (Phe: F), asparagine (Asn: N), and proline (Pro: P).
[0125] Table 2 shows separation energies of adsorption reactions between peptides and polytetrafluoroethylene resin (PTFE), and the contents of 2,3,4,5,6-pentafluorophenyl-alanine (Z), 3-(trifluoromethyl)alanine (X), serine (S), threonine (T), histidine (H), aspartic acid (D), glutamic acid (E), phenylalanine (F), and asparagine (N) in their amino acid sequences.
TABLE-US-00002 TABLE 2 Peptide - PTFE Content of amino Separation acid residues energy Amino acid Z, X, S, T, H, D, SIM calculated sequence E, F, N value [kJ/mol] 2-1 ZZXXZZXXZZXX 12/12 65.2 2-2 ZXXZZXXZZXXZ 12/12 65.1 2-3 STSTSPSTSTST 11/12 40.4 2-4 TSTSTPTSTSTS 11/12 40.3 2-5 SSSSSPSSSSSS 11/12 40.3 2-6 TTTTTPTTTTTT 11/12 40.2 2-7 STSTSTSTSTST 12/12 39.1 2-8 TSTSTSTSTSTS 12/12 39.0 2-9 SSSSSSSSSSSS 12/12 39.0 2-10 TTTTTTTTTTTT 12/12 38.9 2-11 HHHHHHHHHHHH 12/12 38.9 2-12 HHHHHPHHHHHH 11/12 38.7 2-13 DSDSDPDSDSDS 11/12 38.5 2-14 DSDSDSDSDSDS 12/12 37.3 2-15 DHDHDHDHDHDH 12/12 37.1 2-16 DHDHDPDHDHDH 11/12 36.9 2-17 DEDEDPDEDEDE 11/12 36.2 2-18 DEDEDEDEDEDE 12/12 35.6 2-19 FHHFFHHFFHHF 12/12 34.6 2-20 FFHHFFHHFFHH 12/12 34.4 2-21 NENENPNENENE 11/12 34.2 2-22 NENENENENENE 12/12 34.0 3-1 VHFPTKISEGDM 6/12 28.8 3-2 TFTLNSVHRSVH 8/12 27.8 3-3 SPHLHTSSPWER 7/12 27.4 3-4 FIESKTPVDPDG 6/12 27.1 3-5 GSESRTLFHPEG 7/12 27.0 3-6 EALTVNIKREME 5/12 26.9 3-7 SMIVEPRMLSTH 5/12 25.9 4-1 SAAASAAASAAS 4/12 19.4 4-2 HAAAHAAAHAAH 4/12 19.2 4-3 YYYYYYYYYYYY 0/12 18.9 4-4 AAAAAAAAAAAA 0/12 18.3
[0126] In Table 2, SEQ ID NOs. 2-1 to 2-22 are PTFE-adsorbed peptides according to the present invention, which have improved affinity with PTFE owing to molecular designing. SEQ ID NOs. 3-1 to 3-7 are PTFE-adsorbed peptides according to the present invention, which have been acquired through random screening based on their affinity with PTFE. SEQ ID NOs. 4-1 to 4-4 are 12-mer peptides prepared as comparison.
[0127] In Table 2, as separation energy, calculated values (SIM calculated values) by molecular dynamics simulations are shown. Using the reactive molecular dynamics calculation program “ReaxFF” as for the PMMA-adsorbed peptides, the molecular dynamics simulations have been each conducted by simulating behaviors of atoms and molecules in water.
[0128] As shown in Table 2, the contents of one or more of the nine types of amino acids in SEQ ID NOs. 2-1 to 2-22 and SEQ ID NOs. 3-1 to 3-7 are 40% or higher, thereby indicating high separation energy. Comparing SEQ ID NOs. 3-1 to 3-7 in which the contents of one or more of the nine types of amino acids are 40% or higher and 70% or lower with SEQ ID NOs. 2-1 to 2-22 in which the content of one or more of the nine types of amino acids is 90% or higher, the latter indicate higher separation energy. In SEQ ID NOs. 4-1 to 4-4, on the other hand, the contents of one or more of the nine types of amino acids are lower than 40%, thereby indicating low separation energy.
[0129] From the results of the molecular dynamics simulations, it is envisaged that a PTFE-adsorbed peptide, which contains one or more of the nine types of amino acids at a high content or higher contents and has an appropriate recurring structure, shows high affinity with PTFE.
[0130] Next, calculation results of atomic arrangements of PTFE and PTFE-adsorbed peptides by molecular dynamics simulations will be described.
[0131]
[0132] In each of
[0133] On the image of each of
[0134] As illustrated in each of
[0135] Further, the side chains of the amino acid residues located at odd-numbered positions as counted from the N-terminus toward the C-terminus, among the amino acid residues constituting the PTFE-adsorbed peptide, are close to another molecular chain of the PTFE, the another molecular chain being adjacent the PTFE that is closest to the backbone of the PTFE-adsorbed peptide.
[0136] On the other hand, the side chains of the amino acid residues located at even-numbered positions as counted from the N-terminus toward the C-terminus, among the amino acid residues constituting the PTFE-adsorbed peptide, are close to a further molecular chain of the PTFE, the further molecular chain being adjacent and on an opposite side of the PTFE that is closest to the backbone of the PTFE-adsorbed peptide.
[0137] According to the simulation results illustrated in each of
[0138] Especially according to the simulation results illustrated in
[0139] According to the simulation results illustrated in
[0140] According to the simulation results illustrated in
[0141] Based on the results of Table 2 and
[0142] Next, a description will be made regarding results of an adsorption experiment in which interactions between PTFE and PTFE-adsorbed peptides were measured.
[0143]
[0144] In the PTFE-adsorbed peptides of SEQ ID NOs. 3-1 to 3-7, the contents of S, T, H, D, E, F, and N are 40% or higher. In the wild-type peptide, on the other hand, the content of S, T, H, D, E, F, and N is 30%. The amino acid sequence of the wild-type structure protein is
TABLE-US-00003 AEGDDPAKAAFNSLQATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS.
[0145] As illustrated in
[0146] As illustrated in
[0147] The PTFE-adsorbed peptide therefore preferably has an amino acid sequence, which contains at least one type of amino acid residue or residues among 2,3,4,5,6-pentafluorophenylalanine (Z), 3-(trifluoromethyl)alanine (X), serine (S), threonine (T), histidine (H), aspartic acid (D), glutamic acid (E), phenylalanine (F), or asparagine (N), and has a recurring structure.
[0148] The PTFE-adsorbed peptide may be formed using only Z, X, S, T, H, D, E, F, and N, or may be formed using one or more types of other amino acid residues. The amino acid residues that constitute the PTFE-adsorbed peptide are each of the L-type.
[0149] The PTFE-adsorbed peptide has separation energy of preferably 25.0 kJ/mol or higher, more preferably 30.0 kJ/mol or higher, still more preferably 34.0 kJ/mol or higher, even more preferably 35.0 kJ/mol or higher, yet more preferably 38.0 kJ/mol or higher, yet still more preferably 40.0 kJ/mol or higher, yet even more preferably 60.0 kJ/mol or higher.
[0150] The PTFE-adsorbed peptide has a length of preferably 5 or more amino acid residues, more preferably 8 or more amino acid residues, still more preferably 10 or more amino acid residues. On the other hand, 100 or fewer amino acid residues are preferred, 20 or fewer amino acid residues are more preferred, and 15 or fewer amino acid residues are still more preferred. The longer the PTFE-adsorbed peptide, the higher affinity can be obtained with the resin. On the other hand, the shorter the PTFE-adsorbed peptide, the harder intramolecular or intermolecular aggregations take place, the easier the alterations such as chemical modifications and clustering. Particularly preferably, the PTFE-adsorbed peptide has a length of 12 amino acid residues.
[0151] In the PTFE-adsorbed peptide, 2,3,4,5,6-pentafluoro-phenylalanine (Z), 3-(trifluoromethyl)alanine (X), serine (S), threonine (T), histidine (H), aspartic acid (D), glutamic acid (E), phenylalanine (F), or asparagine (N) account preferably for 40% or more of the amino acid residues. The content of Z, X, S, T, H, D, E, F, and N in the total length of the amino acid sequence is more preferably 50% or higher, still more preferably 60% or higher, even more preferably 70% or higher, yet more preferably 80% or higher, yet still more preferably 90% or higher. On the other hand, the content of Z, X, S, T, H, D, E, F, and N may be set at 100%, lower than 90%, or lower than 80%.
[0152] The PTFE-adsorbed peptide preferably has a recurring structure containing Z, X, S, T, H, D, E, F, or N, more preferably has a recurring structure containing Z, X, S, T, H, D, or E, still more preferably has a recurring structure containing Z, X, S, or T, particularly preferably has a recurring structure containing Z or X.
[0153] Z, X, S, T, H, D, E, and N can form relatively strong interactions with the resin as their side chains have a polarity. With an amino acid sequence containing Z, X, S, T, H, D, E, or N, a PTFE-adsorbed peptide that shows high affinity with PTFE can be obtained accordingly. With an amino acid sequence containing F, on the other hand, a PTFE-adsorbed peptide, in which the structure of the backbone and the orientation of the side chains are stable, may be obtained.
[0154] In the PTFE-adsorbed peptide, proline preferably accounts for 5% or more of the amino acid residues. The content of proline in the total length of the amino acid sequence may be set at 10% or higher, or 15% or higher. On the other hand, the content of proline may be set at lower than 20%, lower than 15%, or lower than 10%.
[0155] Proline has a ring structure so that the bond angle or dihedral angle of its peptide bond is restricted or fixed. Proline residues therefore exhibits an action to stabilize the structure of the backbone, and an action to bend the backbone. Interposition of proline may therefore provide a PTFE-adsorbed peptide with the structure of the backbone and the orientation of side chains being stabilized, or a PTFE-adsorbed peptide that forms interactions with plural respective molecular chains of PTFE.
[0156] The PTFE-adsorbed peptide is preferably a peptide containing an amino acid sequence represented by any one of the following SEQ ID NOs. (A-1) to (A-21) with one or two amino acid residues added thereto, inserted thereinto, substituted therefor, or deleted therefrom, more preferably a peptide containing an amino acid sequence represented by any one of the following SEQ ID NOs. (A-1) to (A-21), still more preferably a peptide containing two or more amino acid sequences represented by any one of the following SEQ ID NOs. (A-1) to (A-21) as recurring structure:
TABLE-US-00004 ZZXXZ . . . (A-1) ZXXZZ . . . (A-2) XXZZX . . . (A-3) XZZXX . . . (A-4) STSTS . . . (A-5) TSTST . . . (A-6) SSSSS . . . (A-7) TTTTT . . . (A-8) HHHHH . . . (A-9) DSDSD . . . (A-10) SDSDS . . . (A-11) DHDHD . . . (A-12) HDHDH . . . (A-13) DEDED . . . (A-14) EDEDE . . . (A-15) FFHHF . . . (A-16) FHHFF . . . (A-17) HHFFH . . . (A-18) HFFHH . . . (A-19) NENEN . . . (A-20) ENENE . . . (A-21)
[0157] where Z denotes a 2,3,4,5,6-pentafluorophenylalanine residue, and X represents a 3-(trifluoromethyl)alanine residue.
[0158] The PTFE-adsorbed peptide is more preferably a peptide containing an amino acid sequence represented by any one of the following SEQ ID NOs. (2-1) to (2-22) with one or two amino acid residues added thereto, inserted thereinto, substituted therefor, or deleted therefrom, still more preferably a peptide containing an amino acid sequence represented by any one of SEQ ID NOs. (2-1) to (2-22), particularly preferably an amino acid sequence represented by any one of SEQ ID NOs. (2-1) to (2-22):
TABLE-US-00005 ZZXXZZXXZZXX . . . (2-1) ZXXZZXXZZXXZ . . . (2-2) STSTSPSTSTST . . . (2-3) TSTSTPTSTSTS . . . (2-4) SSSSSPSSSSSS . . . (2-5) TTTTTPTTTTTT . . . (2-6) STSTSTSTSTST . . . (2-7) TSTSTSTSTSTS . . . (2-8) SSSSSSSSSSSS . . . (2-9) TTTTTTTTTTTT . . . (2-10) HHHHHHHHHHHH . . . (2-11) HHHHHPHHHHHH . . . (2-12) DSDSDPDSDSDS . . . (2-13) DSDSDSDSDSDS . . . (2-14) DHDHDHDHDHDH . . . (2-15) DHDHDPDHDHDH . . . (2-16) DEDEDPDEDEDE . . . (2-17) DEDEDEDEDEDE . . . (2-18) FHHFFHHFFHHF . . . (2-19) FFHHFFHHFFHH . . . (2-20) NENENPNENENE . . . (2-21) NENENENENENE . . . (2-22)
[0159] The PTFE-adsorbed peptide may also be a peptide containing an amino acid sequence that has an identity of 80% or greater with the amino acid sequence represented by any one of the following SEQ ID NOs. (3-1) to (3-7). The identity of the amino acid sequence is preferably 85% or greater, more preferably 90% or greater, still more preferably 95% or greater, particularly preferably 100%.
TABLE-US-00006 VHFPTKISEGDM . . . (3-1) TFTLNSVHRSVH . . . (3-2) SPHLHTSSPWER . . . (3-3) FIESKTPVDPDG . . . (3-4) GSESRTLFHPEG . . . (3-5) EALTVNIKREME . . . (3-6) SMIVEPRMLSTH . . . (3-7)
[0160] The PTFE-adsorbed peptide may also have one or more types of amino acid sequences having specific functions in addition to the amino acid sequence of any one of SEQ ID NOs. A-1 to A-21, SEQ ID NOs. 2-1 to 2-22, and SEQ ID NOs. 3-1 to 3-7. The PTFE-adsorbed peptide may have such an amino acid sequence on a side closest to the N-terminus among all the amino acid residues, or may have it at an intermediate position among all the amino acid sequences.
[0161] The PTFE-adsorbed peptide may also have one or a plurality of the amino acid sequences of SEQ ID NOs. A-1 to A-21, SEQ ID NOs. 2-1 to 2-22, and SEQ ID NOs. 3-1 to 3-7 in the total length. The PTFE-adsorbed peptide may have a single kind or plural types of these amino acid sequences.
[0162] The N-terminus and C-terminus of the PTFE-adsorbed peptide may be chemically modified, or may be in an optional ionization state. For example, the N-terminus may be any one of —NH.sub.2, —NH.sub.3.sup.+, —CH.sub.3CO, 9-fluorenylmethyloxycarbonyl (Fmoc) group, tert-butoxycarbonyl (Boc) group, or the like. The C-terminus may be any one of —COOH, —COO.sup.−, —COO.sup.−, —CONH.sub.2, —CONH.sub.3.sup.−, or the like.
[0163] If the PTFE-adsorbed peptide is a peptide containing an amino acid sequence of any one of SEQ ID NOs. A-1 to A-21, SEQ ID NOs. 2-1 to 2-22, and SEQ ID NOs. 3-1 to 3-7 or an amino acid sequence similar to the above-mentioned amino acid sequence, the separation energy with a fluorinated resin has a higher theoretical value, so that high affinity is obtained to the fluorinated resin. Accordingly, the peptide adsorbed on the fluorinated resin hardly undergoes separation, thereby enabling to obtain a biocompatible material the biocompatibility of which lasts over a longer term.
[0164] Similar to the PMMA-adsorbed peptide, the PTFE-adsorbed peptide can be synthesized using a variety of synthesis methods including, for example, chemical synthesis methods such as liquid-phase synthesis methods and solid-phase synthesis methods, genetic engineering synthesis methods, and the like.
<Fluorinated Resin>
[0165] As the resin on which the PTFE-adsorbed peptide is to be adsorbed (the resin 1 that constitutes the biocompatible material 10), any optional resin can be used insofar as it is a fluorinated resin having fluorinated olefin units.
[0166] The resin on which the PTFE-adsorbed peptide is to be adsorbed may be a polymer of a fluorinated monomer, or a copolymer of a fluorinated monomer and another monomer. The copolymer may be any one of a block copolymer, a random copolymer, or a graft copolymer.
[0167] As the resin on which the PTFE-adsorbed peptide is to be adsorbed, polytetrafluoroethylene (PTFE) is particularly preferred. If the resin on which the PTFE-adsorbed peptide is to be adsorbed is PTFE, fluorine atoms as substituents are arranged in a stereoregular and uniform conformation, so that high affinity is available.
[0168] The fluorinated resin can be synthesized using a general synthesis method. If a fluorinated olefin such as tetrafluoroethylene is subjected to a radical polymerization, for example, a fluorinated resin is obtained in a powder form or the like. When melted, a fluorinated resin has high viscosity and low fluidity. When a fluorinated resin in a powder form or the like is allowed to cool after melting, however, a molded body, a non-molded solid body, or the like of the fluorinated resin is obtained. As a radical polymerization method, any one of emulsion polymerization, suspension polymerization, bulk polymerization, solution polymerization, or the like can also be used.
<Production Method of Biocompatible Material>
[0169] The biocompatible material 10 according to this embodiment can be produced, for example, by a method that brings a liquid in which the adsorptive peptide 2 is dispersed into contact with the resin 1 as a main part of the material. Usable as the liquid is a buffer with a variety of additives such as a pH regulator, a buffer agent, a salt, a reducing agent, and an organic solvent added therein, water, or the like.
[0170] As a method for bringing the liquid into contact with the resin 1, a variety of methods can be used including, for example, a method that coats the resin 1 with the liquid, a method that sprays the liquid onto the resin 1, a method that immerses the resin 1 in the liquid, and the like. When the liquid is caused to flow over the resin 1 for bringing the former into contact with the latter, control of the flow rate of the liquid at 20 μL/min or lower provides a higher adsorption efficiency for the adsorptive peptide 2.
<Combination of Biocompatible Material into Composite>
[0171] The biocompatible material 10 according to this embodiment can also be used in a form in which the resin 1 as a main part of the material is combined with a fibrous material or a filler material into a composite, a form in which the resin 1 is laminated on a surface of an adherend different from the resin 1, or a form in which the resin 1 constitutes a housing for a device.
[0172]
As illustrated in
[0173] In the biocompatible material 10A, the fibrous material 4 is embedded in a matrix of the resin 1. The fibrous material 4 may be dispersed in a form of short whiskers or the like in the matrix, or may be formed into a knitted, woven, or braided fabric, or the like and may then be embedded in the matrix. The fibrous material 4 can be combined into a composite by dispersing or otherwise incorporating it in the resin 1, for example, before polymerizing the resin 1 or before subjecting a preform of the powdery resin 1 to melt forming.
[0174] As the fibrous material 4, organic fibers, inorganic fibers, and metal fibers may each be used. Examples of the organic fibers include polyamide fibers, polyester fibers, aramid fibers, cellulose fibers, fluorinated resin fibers, and the like. Examples of the inorganic fibers include carbon fibers, silicon carbide fibers, glass fibers, boron fibers, alumina fibers, zirconia fibers, mullite fibers, rock wool, and the like. As the fibrous material 4, a single kind of such a fibrous material or a plurality of kinds of such fibrous materials may be used. Preferred as the fibrous material 4 to be combined with the fluorinated resin into a composite are inorganic fibers and/or metal fibers having a higher melting point than the fluorinated resin.
[0175]
As illustrated in
[0176] In the biocompatible material 10B, the filler material 5 is embedded in a matrix of the resin 1. The filler material 5 may be in any shape such as a granular (spherical) shape, a flaky shape, or plate shape. Further, the filler material 5 may be in a solid form, or in a hollow form. The filler material 5 can be combined into a composite by dispersing it in the resin 1, for example, before polymerizing the resin 1 or before subjecting a preform of the powdery resin 1 to melt forming.
[0177] As the filler material 5, any one of an organic material, an inorganic material, or a metal material may be used. Examples of the organic material include polyamides, polyesters, aramids, fluorinated resins, and the like. Examples of the inorganic material include graphite, carbon black, silicon carbide, glass, silica, alumina, zirconia, mullite, mica, talc, kaolin, calcium carbonate, magnesium carbonate, aluminum hydroxide, titanium oxide, iron oxide, ferrite, and the like. As the filler material 5, a single kind of such a filler material or a plurality of kinds of such filler materials may be used. Preferred as the filler material 5 to be combined with the fluorinated resin into a composite is an inorganic material and/or a metal material having a higher melting point than the fluorinated resin.
[0178] With the biocompatible material 10A illustrated in
[0179]
As illustrated in
[0180] The composite material 100 can be used as a material for optional articles which have a possibility of contact with a living body. The articles formed with the composite material 100 are not particularly limited in kind, use, function, and so on insofar as they can be brought into contact with living bodies. Similar to the above-described biocompatible material 10 itself, the composite material 100 can form the articles exemplified as specific examples.
[0181] In the composite material 100, the adsorptive peptide 2 is adsorbed on a front side of the biocompatible material 10, and the adherend 20 is joined to a back side of the biocompatible material 10 where the adsorptive peptide 2 is not adsorbed. The joining of the biocompatible material 10 and the adherend 20 can be conducted by an appropriate method, such as a method that polymerizes the resin 1 on a surface of the adherend 20, compression bonding, welding, or adhesion, according to the kind of the adherend 20.
[0182] The adherend 20 is a material different from the resin 1, and constitutes the main part of the composite material 100. The adherend 20 can be formed into an appropriate shape according to the kind, use, function and the like of the article to be formed with the composite material 100, and is not particularly limited in shape. The adherend 20 may be covered with resin 1 in the shape of a film or sheet to constitute the composite material 100, or may be bonded with the resin 1 formed in a similar shape as the adherend 20 to constitute the composite material 100. The adherend 20 and the resin 1 may constitute the entire area or only a part of the article.
[0183] As the adherend 20, any of organic materials such as natural polymers, synthetic polymers, and foamed resins, inorganic materials such as alumina, zirconia, and glass, and metal materials such as stainless steel, aluminum alloys, copper alloys, cobalt alloys, and titanium alloys may be used. The adherend 20 may have biocompatibility by itself, or may have no biocompatibility by itself. If the adherend 20 itself has biocompatibility, the adherend 20 may be covered at a part or the entire area of its surface with the biocompatible material 10.
[0184] With the biocompatible material 10 illustrated in
[0185]
[0186] As illustrated in
[0187] The implantable device 200 is implanted in a living body, and operates for a variety of purposes. No particular limitation is imposed on the kind, use, function, and the like of the implantable device 200. As a specific example of the implantable device 200, there may be given such an artificial heart described in Non-Patent Document (Tomoko Sugiyama et al., “Evaluation of Biocompatibility of Long-term Implantable Device Material in Subcutaneous Implantation Experiment,” JINKO ZOKI (in Japanese), Japan Society for Artificial Organs, April 15th, 1998, 28(2), p. 509 to 513). In addition, artificial pancreases, artificial organs such as pacemakers, artificial joints, artificial tissues such as artificial muscles, electronic devices such as IC (integrated circuit) tags and IC chips, and the like are exemplified.
[0188] In the implantable device 200, the adsorptive peptide 2 is adsorbed on a surface of the resin 1 that constitutes the housing, and the device 30 is accommodated on back sides of the resin 1 where the adsorptive peptide 2 is not adsorbed. The device 30 can be joined to the resin 1 by an appropriate method such as compression bonding, welding, adhesion, or mechanical joining that uses fasteners or the like, or can be covered with the resin 1 without joining it to the resin 1.
[0189] The device 30 is formed of at least one of various system components, electronic components, and the like, each of which uses an artificial material or the like such that the device 30 operates for a variety of purposes such as a treatment, a replacement for a biofunction, an aid to a biofunction, recording of information, and calculation of information. The device 30 can be formed into an appropriate shape according to the kind, use, function, and the like of the implantable device 200, and no particular limitation is imposed on its shape. The device 30 may be covered at a part or the entire area of its surface with the biocompatible material 10. Further, the device 30 may autonomously operate in the body, or may operate with equipment outside the body connected thereto via a tubing, a control line, or the like.
[0190] With the biocompatible material 10 illustrated in
<Functional Material>
[0191] Through combinations with various functional substances into composites, the biocompatible material 10 according to this embodiment can also be formed into functional materials that fulfil particular functions by themselves.
[0192]
[0193] As illustrated in
As the functional substance 6, a variety of substances that fulfil specific functions through biological effects, chemical effects, or the like in living bodies or on the surfaces of living bodies can be used. The functional substance 6 may be adsorbed on the resin 1, or may be adsorbed on the adsorptive peptide 2 adsorbed on the resin 1. The adsorptive peptide 2 can have a function to have the functional substance 6 which is to adsorb to a front side of the functional material 300, adhered or bonded, in addition to the function to improve the biocompatibility of the functional material 300 on the front side thereof.
[0194] As the functional substance 6, a variety of substances such as physiologically active substances and antibacterial substances can be used, for example. During use of the functional material 300, the functional substance 6 may function while being held on the surface of the biocompatible material 10, or may function while being released from the surface of the biocompatible material 10. The functional substance 6 may be adsorbed by physical adsorption, or may be adsorbed by chemical adsorption.
[0195] Specific examples of physiological substances include inflammation suppressing proteins such as interleukin-10, and angiogenesis promoting proteins such as interleukin-8. Further, other interleukins, interferons, cytokines such as chemokines, hormones, and the like are also exemplified. In addition, antibiotics, anticoagulants, antihistamines, nutrients such as vitamins, sedatives, analgesics, anti-inflammatories, steroids, insulin, and the like are also exemplified.
[0196] Specific examples of antibacterial substances include metal particles of silver, copper, zinc, titanium, zirconium, cobalt, nickel, and the like, inorganic compounds of these metals, metal supports with these metals carried on a support such as zeolite, and the like.
[0197] As illustrated in
[0198] As illustrated in
[0199] According to the functional materials 300A and 300B as described above, good biocompatibility is obtained from the adsorptive peptide 2 adsorbed on the surface of the resin 1. Especially if the functional substance 6 is released from the front side of the biocompatible material 10, the surface of the resin 1 is hardly exposed, thereby enabling to suppress adverse effect and irritation to a living body by the resin 1.
[0200] As illustrated in
[0201] According to the functional material 300C as described above, good biocompatibility is obtained from the adsorptive peptide 2 exposed to the surface, irrespective of properties of the functional substance 6. Especially if the functional substance 6 is released from the front side of the biocompatible material 10, the surface of the resin 1 is not exposed, thereby enabling to prevent adverse effect and irritation to a living body by the resin 1.
[0202] The present invention has been described above. However, the present invention should not be limited to the above-described embodiment and modifications, and a variety of modifications is feasible within a range not departing from the spirit of the present invention. For example, the present invention is not necessarily limited to that including all the elements included in the above-described embodiment and modifications. One or some of the elements of any one of the embodiment and modifications can be replaced by other element or elements, one or some of the elements of any one of the embodiment and modifications can be added to other configuration or configurations, or one or some of the elements of any one of the embodiment and modifications can be omitted.
[0203] For example, the above-described fibrous material 4 or filler material 5 can be combined into a composite with the biocompatible material 10 which covers the adherend 20, or the biocompatible material 10 which constitutes the housing for the device 30. Further, the above-described adherend 20 can also be arranged so as to come into contact with the surface of the biocompatible material 10, the surface being on the side where the adsorptive peptide 2 is adsorbed. Furthermore, the above-described housing for the device 30 can also be formed with the biocompatible material 10 laminated on the adherend 20 such as titanium.
[0204] The above-described functional material 300 is not particularly limited in the state of adsorption, the shape, the structure, or the like insofar as it includes the resin 1, the adsorptive peptide 2 adsorbed on the resin 1, and the functional substance 6. The functional substance 6 itself may have an amino acid sequence that adsorbs to the resin 1, may be adsorbed on the adsorptive peptide 2, or may be bound to the adsorptive peptide 2 via covalent bonds or the like.
REFERENCE SIGNS LIST
[0205] 1: Resin [0206] 2: Adsorptive peptide [0207] 4: Fibrous material [0208] 5: Filler material [0209] 6: Functional substance [0210] 10: Biocompatible material [0211] 20: Adherend [0212] 30: Device [0213] 100: Composite material [0214] 200: Implantable device [0215] 300: Functional material