FUSIONS OF MUTANT INTERLEUKIN-2 POLYPEPTIDES WITH ANTIGEN BINDING MOLECULES FOR MODULATING IMMUNE CELL FUNCTION
20220251202 · 2022-08-11
Inventors
Cpc classification
C07K2319/75
CHEMISTRY; METALLURGY
C07K2317/51
CHEMISTRY; METALLURGY
C07K2319/30
CHEMISTRY; METALLURGY
A61K47/68
HUMAN NECESSITIES
A61K2039/507
HUMAN NECESSITIES
C07K2317/73
CHEMISTRY; METALLURGY
A61K47/6849
HUMAN NECESSITIES
C07K2319/74
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
A61K47/6813
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
Abstract
Provided herein are fusion proteins that bind human CD8α, human CD8β, or human PD1 and comprise a mutant IL-2 polypeptide, as well as polynucleotides, host cells, compositions, and methods of use thereof.
Claims
1. A fusion protein comprising two moieties, wherein: i) The first moiety comprises an antibody heavy chain VH—CH1-hinge-CH2-CH3 monomer wherein VH is a variable heavy chain and CH2-CH3 is a Fc domain, an antibody light chain VL-CL wherein VL is a variable light chain and CL is a constant light chain, and a mutant IL-2 polypeptide, wherein the N-terminus of the mutant IL-2 polypeptide is fused to the C-terminus of the Fc domain via a linker; ii) The second moiety comprises an antibody heavy chain VH—CH1-hinge-CH2-CH3 monomer and an antibody light chain VL-CL; and wherein, both the first and second moiety bind to an epitope on one antigen selected from the following group: human CD8α, human CD8β, and human PD1.
2. A fusion protein comprising two moieties, wherein: i) The first moiety is a polypeptide comprising an antibody hinge-CH2-CH3 monomer wherein CH2-CH3 is a Fc domain, and a mutant IL-2 polypeptide, wherein the N-terminus of the mutant IL-2 polypeptide is fused to the C-terminus end of the Fc domain via a linker; ii) The second moiety is a polypeptide comprising an antibody heavy chain VH—CH1-hinge-CH2-CH3 monomer and an antibody light chain VL-CL; and wherein the second moiety binds to an epitope on one antigen selected from the following group: human CD8α, human CD8β, and human PD1.
3. A fusion protein comprising two moieties, wherein: i) The first moiety is a polypeptide comprising an antibody hinge-CH2-CH3 monomer wherein CH2-CH3 is a Fc domain, and a mutant IL-2 polypeptide, wherein the C-terminus of the mutant IL-2 polypeptide is fused to the N-terminus end of the Fc domain via a linker; ii) The second moiety is a polypeptide comprising an antibody heavy chain VH—CH1-hinge-CH2-CH3 monomer and an antibody light chain VL-CL; and wherein the second moiety binds to an epitope on one antigen selected from the following group: human CD8α, human CD8β, and human PD1.
4. A fusion protein comprising two moieties, wherein: i) The first moiety comprises an antigen-binding domain that binds to human CD8α or human CD8β; ii) The second moiety comprises a mutant IL-2 polypeptide; and wherein the second moiety is linked to the first moiety via a linker.
5. The fusion protein of claim 4 wherein said first moiety comprises (a) an antibody or antigen-binding fragment thereof comprising one or two heavy chain polypeptides and one or two light chain polypeptides; (b) a single chain antibody or single chain variable fragment (scFv); or (c) a VHH antibody.
6. The fusion protein of any one of claims 1 to 5 wherein the fusion protein activates CD8+ T cells with 10-fold or greater potency, as compared to activation of NK cells.
7. The fusion protein of claim 6 wherein the fusion protein activates CD8+ T cells with 50-fold or greater potency, as compared to activation of NK cells.
8. The fusion protein of any one of claims 1-7 wherein said mutant IL-2 polypeptide exhibits reduced binding affinity by 50% or more to IL-2Rα polypeptide having an amino acid sequence of SEQ ID NO:2, compared to the binding affinity of the wild-type IL-2 polypeptide with an amino acid sequence of SEQ ID NO:1.
9. The fusion protein of claim 8 wherein said mutant IL-2 polypeptide exhibits reduced binding affinity by 50% or more to IL-2Rβ polypeptide having an amino acid sequence of SEQ ID NO:3, compared to the binding affinity of the wild-type IL-2 polypeptide with an amino acid sequence of SEQ ID NO:1.
10. The fusion protein of claim 8 or claim 9 wherein said mutant IL-2 polypeptide exhibits reduced binding affinity by 50% or more to IL-2Rγ polypeptide having an amino acid sequence of SEQ ID NO:4, compared to the binding affinity of the wild-type IL-2 polypeptide with an amino acid sequence of SEQ ID NO:1.
11. The fusion protein of any one of claims 1-10 wherein said mutant IL-2 polypeptide comprises the sequence of SEQ ID NO:1 with one or more or two or more amino acid substitutions relative to SEQ ID NO:1, and wherein the one or more or two or more substitution(s) comprise substitution(s) at positions of SEQ ID NO:1 selected from the group consisting of: Q11, H16, L18, L19, D20, Q22, R38, F42, K43, Y45, E62, P65, E68, V69, L72, D84, S87, N88, V91, 192, T123, Q126, S127, I129, and S130.
12. The fusion protein of claim 11, wherein the one or more or two or more substitution(s) comprise an F42A or F42K amino acid substitution relative to SEQ ID NO:1.
13. The fusion protein of claim 11 or claim 12, wherein the one or more or two or more substitution(s) further comprise an R38A, R38D, R38E, E62Q, E68A, E68Q, E68K, or E68R amino acid substitution relative to SEQ ID NO:1.
14. The fusion protein of any one of claims 11-13, wherein the one or more or two or more substitution(s) further comprise an H16E, H16D, D20N, M23A, M23R, M23K, S87K, S87A, D84L, D84N, D84V, D84H, D84Y, D84R, D84K, N88A, N88S, N88T, N88R, N88I, V91A, V91T, V91E, I92A, E95S, E95A, E95R, T123A, T123E, T123K, T123Q, Q126A, Q126S, Q126T, Q126E, S127A, S127E, S127K, or S127Q amino acid substitution relative to SEQ ID NO:1.
15. The fusion protein of any one of claims 11-14 wherein the one or more or two or more substitution(s) further comprise the amino acid mutation C125A compared to SEQ ID NO:1.
16. The fusion protein of any one of claims 1-10 wherein said mutant IL-2 polypeptide comprises an amino acid sequence selected from the group consisting of SEQ ID Nos:18-88.
17. The fusion protein of any one of claims 1-10 wherein said mutant IL-2 polypeptide comprises the amino acid sequence of SEQ ID NO:1 with one of the following sets of amino acid substitutions (relative to the sequence of SEQ ID NO:1): R38E and F42A; R38D and F42A; F42A and E62Q; R38A and F42K; R38E, F42A, and N88S; R38E, F42A, and N88A; R38E, F42A, and V91E; R38E, F42A, and D84H; H16D, R38E and F42A; H16E, R38E and F42A; R38E, F42A and Q126S; R38D, F42A and N88S; R38D, F42A and N88A; R38D, F42A and V91E; R38D, F42A, and D84H; H16D, R38D and F42A; H16E, R38D and F42A; R38D, F42A and Q126S; R38A, F42K, and N88S; R38A, F42K, and N88A; R38A, F42K, and V91E; R38A, F42K, and D84H; H16D, R38A, and F42K; H16E, R38A, and F42K; R38A, F42K, and Q126S; F42A, E62Q, and N88S; F42A, E62Q, and N88A; F42A, E62Q, and V91E; F42A, E62Q, and D84H; H16D, F42A, and E62Q; H16E, F42A, and E62Q; F42A, E62Q, and Q126S; R38E, F42A, and C125A; R38D, F42A, and C125A; F42A, E62Q, and C125A; R38A, F42K, and C125A; R38E, F42A, N88S, and C125A; R38E, F42A, N88A, and C125A; R38E, F42A, V91E, and C125A; R38E, F42A, D84H, and C125A; H16D, R38E, F42A, and C125A; H16E, R38E, F42A, and C125A; R38E, F42A, C125A and Q126S; R38D, F42A, N88S, and C125A; R38D, F42A, N88A, and C125A; R38D, F42A, V91E, and C125A; R38D, F42A, D84H, and C125A; H16D, R38D, F42A, and C125A; H16E, R38D, F42A, and C125A; R38D, F42A, C125A, and Q126S; R38A, F42K, N88S, and C125A; R38A, F42K, N88A, and C125A; R38A, F42K, V91E, and C125A; R38A, F42K, D84H, and C125A; H16D, R38A, F42K, and C125A; H16E, R38A, F42K, and C125A; R38A, F42K, C125A and Q126S; F42A, E62Q, N88S, and C125A; F42A, E62Q, N88A, and C125A; F42A, E62Q, V91E, and C125A; F42A, E62Q, and D84H, and C125A; H16D, F42A, and E62Q, and C125A; H16E, F42A, E62Q, and C125A; F42A, E62Q, C125A and Q126S; F42A, N88S, and C125A; F42A, N88A, and C125A; F42A, V91E, and C125A; F42A, D84H, and C125A; H16D, F42A, and C125A; H16E, F42A, and C125A; and F42A, C125A and Q126S.
18. The fusion protein of any one of claims 1-17 wherein the fusion protein binds human CD8, and wherein the binding of the fusion protein to CD8 does not block the interaction of CD8 with MEC class I.
19. The fusion protein of any one of claims 1-18 wherein said first and second Fc domains comprise the following Fc mutations according to EU numbering: L234A, L235A, G237A, and K322A.
20. The fusion protein of any one of claims 1-19 wherein: (a) said first Fc domain comprises the following amino acid substitutions: Y349C and T366W, and wherein said second Fc domain comprises the following amino acid substitutions: S354C, T366S, L368A and Y407V, according to EU numbering; or (b) said second Fc domain comprises the following amino acid substitutions: Y349C and T366W, and wherein said first Fc domain comprises the following amino acid substitutions: S354C, T366S, L368A and Y407V, according to EU numbering.
21. The fusion protein of any one of claims 1-20, wherein the fusion protein has one or more of the following properties: (a) wherein the fusion protein binds human CD8, and wherein the binding of the fusion protein to CD8 does not block the interaction of CD8 with MEC class I; and (b) activates CD8+ T cells with 10-fold or greater potency, as compared to activation of NK cells.
22. The fusion protein of any one of claims 6, 7, and 21, wherein potency of activation of CD8+ T cells and NK cells is measured by EC50 of cell activation, as assessed by cell proliferation.
23. One or more isolated polynucleotides encoding the mutant IL-2 polypeptides or fusion protein of any one of claims 1-22.
24. One or more vectors, particularly expression vectors, comprising the polynucleotides of claim claim 23.
25. A host cell comprising the polynucleotides of claim 23.
26. A pharmaceutical composition comprising the fusion protein according to any one of claims 1-22 and a pharmaceutically acceptable carrier.
27. The fusion protein of any one of claims 1-22 or composition of claim 26 for use as a medicament.
28. A method of treating cancer or chronic infection comprising administering an effective amount of the fusion protein according to any one of claims 1-22 or the composition of claim 26 to a patient.
29. A method of treating cancer comprising administering an effective amount of the fusion protein according to any one of claims 1-22 or the composition of claim 26 to a patient in combination with a T cell therapy, cancer vaccine, chemotherapeutic agent, or immune checkpoint inhibitor (ICI).
30. The method of claim 29, wherein the ICI is an inhibitor of PD-1, PD-L1, or CTLA-4.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
DETAILED DESCRIPTION
Definitions
[0052] “Immune cells” as used here are cells of the immune system that react to organisms or other entities that are deemed foreign to the immune system of the host. They protect the host against foreign pathogens, organisms and diseases. Immune cells, also called leukocytes, are involved in both innate and adaptive and immune responses to fight pathogens. Innate immune responses occur immediately upon exposure to pathogens without additional priming or learning processes. Adaptive immune processes require initial priming, and subsequently create memory, which in turn leads to enhanced responsiveness during subsequent encounters with the same pathogen Innate immune cells include, but are not limited to monocytes, macrophages, dendritic cells, innate lymphoid cells (ILCs) including natural killer (NK) cells, neutrophils, megakaryocytes, eosinophils and basophils. Adaptive immune cells include B and T lymphocytes/cells. T cells subsets include, but are not limited to, alpha beta CD4+ T (naïve CD4+, memory CD4+, effector memory CD4+, effector CD4+, regulatory CD4+), and alpha beta CD8+ T (naïve CD8+, memory CD8+, effector memory CD8+, effector CD8+). B cell subsets include, but is not limited to, naïve B, memory B, and plasma cells. NK T cells and T gamma delta (Tγδ) cells exhibit properties of both innate and adaptive lymphocytes.
[0053] “T cells” or “T lymphocytes” are immune cells that play a key role in the orchestration of immune responses in health and disease. Two major T cell subsets exist that have unique functions and properties: T cells that express the CD8 antigen (CD8.sup.+ T cells) are cytotoxic or killer T cells that can lyse target cells using the cytotoxic proteins such as granzymes and perforin; and T cells that express the CD4 antigen (CD4.sup.+ T cells) are helper T cells that are capable of regulating the function of many other immune cell types including that of CD8.sup.+ T cells, B cells, macrophages etc. Furthermore, CD4.sup.+ T cells are further subdivided into several subsets such as: T regulatory (Treg) cells that are capable of suppressing the immune response, and T helper 1 (Th1), T helper 2 (Th2), and T helper 17 (Th17) cells that regulate different types of immune responses by secreting immunomodulatory proteins such as cytokines. T cells recognize their targets via alpha beta T cell receptors that bind to unique antigen-specific motifs and this recognition mechanism is generally required in order to trigger their cytotoxic and cytokine-secreting functions. “Innate lymphocytes” can also exhibit properties of CD8.sup.+ and CD4.sup.+ T cells, such as the cytotoxic activity or the secretion of Th1, Th2, and Th17 cytokines. Some of these innate lymphocyte subsets include NK cells and ILC1, ILC2, and ILC3 cells; and innate-like T cells such as Tγδ cells; and NK T cells. Typically, these cells can rapidly respond to inflammatory stimuli from infected or injured tissues, such as immunomodulatory cytokines, but unlike alpha beta T cells, they can respond without the need to recognize antigen-specific patterns.
[0054] “Cytokine” is a form of immunomodulatory polypeptide that mediates cross-talk between initiating/primary cells and target/effector cells. It can function as a soluble form or cell-surface associated to bind the “cytokine receptor” on target immune cells to activate signaling. “Cytokine receptor” as used here is the polypeptide on the cell surface that activates intracellular signaling upon binding the cytokine on the extracellular cell surface. Cytokines includes, but are not limited to, chemokines, interferons, interleukins, lymphokines, and tumor necrosis factors. Cytokines are produced by a wide range of cells, including immune cells, endothelial cells, fibroblasts, and stromal cells. A given cytokine may be produced by more than one cell type. Cytokine are pleiotropic; since the receptors are expressed on multiple immune cell subsets, one cytokine can activate the signaling pathway in multiple cells. However, depending on the cell type, the signaling events for a cytokine can result in different downstream cellular events such as activation, proliferation, survival, apoptosis, effector function and secretion of other immunomodulatory proteins.
[0055] “Amino acid” as used here refers to naturally occurring carboxy α-amino acids comprising alanine (three letter code: ala, one letter code: A), arginine (arg, R), asparagine (asn, N), aspartic acid (asp, D), cysteine (cys, C), glutamine (gln, Q), glutamic acid (glu, E), glycine (gly, G), histidine (his, H), isoleucine (ile, I), leucine (leu, L), lysine (lys, K), methionine (met, M), phenylalanine (phe, F), proline (pro, P), serine (ser, S), threonine (thr, T), tryptophan (trp, W), tyrosine (tyr, Y), and valine (val, V).
[0056] “Polypeptide” or “protein” as used here refers to a molecule where monomers (amino acids) are linearly linked to one another by peptide bonds (also known as amide bonds). The term “polypeptide” refers to any chain of two or more amino acids and does not refer to a specific length of the product. Thus, peptides, dipeptides, tripeptides, oligopeptides, “protein”, “amino acid chain”, or any other term used to refer to a chain of two or more amino acids, are included within the definition of “polypeptide”, and the term “polypeptide” may be used instead of, or interchangeably with any of these terms. The term “polypeptide” is also intended to refer to the products of A polypeptide may be derived from a natural biological source or produced by recombinant technology but is not necessarily translated from a designated nucleic acid sequence. It may be generated in any manner, including by chemical synthesis. Polypeptides normally have a defined three-dimensional structure, but they do not necessarily have such structure. A polypeptide of the present disclosure may be of a size of about 3 or more, 5 or more, 10 or more, 20 or more, 25 or more, 50 or more, 75 or more, 100 or more, 200 or more, 500 or more, 1,000 or more, or 2,000 or more amino acids. Polypeptides with a defined three-dimensional structure are referred to as folded, and polypeptides which do not possess a defined three-dimensional structure, but rather can adopt many different conformations and are referred to as unfolded. Polypeptides may further form multimers such as dimers, trimers and higher oligomers, i.e. consisting of more than one polypeptide molecule. Polypeptide molecules forming such dimers, trimers etc. may be identical or non-identical. The corresponding higher order structures of such multimers are, consequently, termed homo- or heterodimers, homo- or heterotrimers etc. The terms “polypeptide” and “protein” also refer to modified polypeptides/proteins wherein the post-expression modification is affected including without limitation glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, or modification by non-naturally occurring amino acids.
[0057] “Residue” as used herein is meant a position in a protein and its associated amino acid identity. For example, Leu 234 (also referred to as Leu234 or L234) is a residue at position 234 in the human antibody IgG1.
[0058] “wild-type” herein means an amino acid sequence or a nucleotide sequence that is found in nature, including allelic variations. A wild-type protein has an amino acid sequence or a nucleotide sequence that has not been intentionally modified.
[0059] “Substitution” or “mutation” refers to a change to the polypeptide backbone wherein an amino acid occurring naturally in the wild-type sequence of a polypeptide is substituted to another amino acid not naturally occurring at the same position in the said polypeptide. Preferably, a mutation or mutations are introduced to modify polypeptide's affinity to its receptor thereby altering its activity such that it becomes different from the affinity and activity of the wild-type cognate polypeptide. Mutations can also improve polypeptide's biophysical properties. Amino acid mutations can be generated using genetic or chemical methods well known in the art. Genetic methods may include site-directed mutagenesis, PCR, gene synthesis and the like. It is contemplated that methods of altering the side chain group of an amino acid by methods other than genetic engineering, such as chemical modification, may also be useful.
[0060] “Interleukin-2” or “IL-2” as used here refers to any native human IL-2, unless otherwise indicated. “IL-2” encompasses unprocessed IL-2 as well as “mature IL-2” which is a form of IL-2 that results from processing in the cell. The sequence of “mature IL-2” is depicted in
[0061] “Affinity” or “binding affinity” refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g. an antibody) and its binding partner (e.g. an antigen). Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity which reflects a 1:1 interaction between members of a binding pair (e.g. antibody and antigen). The affinity can generally be represented by the dissociation constant (K.sub.D), which is the ratio of dissociation and association rate constants (koff and kon, respectively). Thus, equivalent affinities may comprise different rate constants, as long as the ratio of the rate constants remains the same. Affinity can be measured by common methods known in the art, such as enzyme-linked immunosorbent assay (ELISA), surface plasmon resonance (SPR) technologies (e.g. BIAcore), BioLayer Interferometry (BLI) technologies (e.g. Octet) and other traditional binding assays (Heeley, Endocr Res 28, 217-229 (2002).
[0062] “Binding” or “Specific binding” as used here, refers the ability of a polypeptide or an antigen binding molecule to selectively interact with the receptor for the polypeptide or target antigen, respectively, and this specific interaction can be distinguished from non-targeted or undesired or non-specific interactions. Examples of specific binding include but are not limited to IL-2 cytokine binding to its specific receptors (e.g. IL-2Rα, IL-2Rβ and IL-2Rγ) and an antigen binding molecule binding to a specific antigen (e.g. CD8 or PD-1).
[0063] “Mutant IL-2 polypeptide” refers to IL-2 polypeptide that has reduced affinity to its receptor wherein such decreased affinity will result in reduced biological activity of the mutant. Reduction in affinity and thereby activity can be obtained by introducing a small number of amino acid mutations or substitutions. The mutant IL-2 polypeptides can also have other modifications to the peptide backbone, including but not limited to amino acid deletion, permutation, cyclization, disulfide bonds, or the post-translational modifications (e.g. glycosylation or altered carbohydrate) of a polypeptide, chemical or enzymatic modifications to the polypeptide (e.g. attaching PEG to the polypeptide backbone), addition of peptide tags or labels, or fusion to proteins or protein domains to generate a final construct with desired characteristics, such as reduced affinity to IL-2Rγγ. Desired activity may also include improved biophysical properties compared to the wild-type IL-2 polypeptide. Multiple modifications may be combined to achieve desired activity modification, such as reduction in affinity or improved biophysical properties. As a non-limiting example, amino acid sequences for consensus N-link glycosylation may be incorporated into the polypeptide to allow for glycosylation. Another non-limiting example is that a lysine may be incorporated onto the polypeptide to enable pegylation. Preferably, a mutation or mutations are introduced to the polypeptide to modify its activity.
[0064] “Targeting moiety” and “antigen binding molecule” as used here refers in its broadest sense to a molecule that specifically binds an antigenic determinant. A targeting moiety or antigen binding molecule may be a protein, carbohydrate, lipid, or other chemical compound. It includes, but is not limited to, antibody, antibody fragments (Chames et al, 2009; Chan & Carter, 2010; Leavy, 2010; Holliger & Hudson, 2005), scaffold antigen binding proteins (Gebauer and Skerra, 2009; Stumpp et al, 2008), single domain antibodies (sdAb), minibodies (Tramontano et al, 1994), the variable domain of heavy chain antibodies (nanobody, VHH), the variable domain of the new antigen receptors (VNAR), carbohydrate binding domains (CBD) (Blake et al, 2006), collagen binding domain (Knight et al, 2000), lectin binding proteins (Tetranectin), collagen binding proteins, adnectin/fibronectin (Lipo{hacek over (v)}sek, 2011), a serum transferrin (trans-body), Evibody, Protein A-derived molecule, such as Z-domain of Protein A (Affibody) (Nygren et al, 2008), an A-domain (Avimer/Maxibody), alphabodies (WO2010066740), Avimer/Maxibody, designed ankyrin-repeat domains (DARPins) (Stumpp et al, 2008), anticalins (Skerra et al, 2008), a human gamma-crystallin or ubiquitin (Affilin molecules), a kunitz type domain of human protease inhibitors, knottins (Kolmar et al, 2008), linear or constrained peptide with or without fusion to extend half-life e.g. (Fc fusion—Peptibody) (Rentero Rebollo & Heinis, 2013; EP 1144454 B2; Shimamoto et al, 2012; U.S. Pat. No. 7,205,275 B2), constrained bicyclic peptides (US 2018/0200378 A1), aptamer, engineered CH2 domains (nanoantibodies; Dimitrov, 2009)) and engineered CH3 domain “Fcab” domains (Wozniak-Knopp et al, 2010).
[0065] The term “antibody” and “immunoglobulin” are used interchangeably and herein are used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies (e.g., full length or intact monoclonal antibodies), polyclonal antibodies, multispecific antibodies (e.g. bispecific antibodies), antibody fragments and single domain antibody (as described in greater detail herein), so long as they exhibit the desired antigen binding activity.
[0066] Antibodies (immunoglobulins) refers to a protein having a structure substantially similar to a native antibody structure. “Native antibodies” refer to naturally occurring immunoglobulin molecules with varying structures. For example, native immunoglobulins of the IgG class are heterotetrameric glycoproteins of about 150,000 daltons, composed of two light chains and two heavy chains that are disulfide-bonded. From N- to C-terminus, each heavy chain has a variable region (VH), also called a variable heavy domain or a heavy chain variable domain, followed by three constant domains (CH1, CH2, and CH3), also called a heavy chain constant region. Similarly, from N- to C-terminus, each light chain has a variable region (VL), also called a variable light domain or a light chain variable domain, followed by a constant light (CL) domain, also called a light chain constant region. The subunit structures and three-dimensional configurations of the different classes of immunoglobulins are well known and described generally, for example, in Abbas et al., 2000, Cellular and Mol, and Kindt et al., Kuby Immunology, 6th ed., W.H. Freeman and Co., page 91 (2007). Antibodies (immunoglobulins) are assigned to different classes, depending on the amino acid sequences of the heavy chain constant domains. There are five major classes of antibodies: α (IgA), δ (IgD), ϵ (IgE), γ (IgG), or μ (IgM), some of which may be further divided into subtypes, e.g. γ1 (IgG1), γ2 (IgG2), γ3 (IgG3), γ4 (IgG4), α1 (IgA1) and α2 (IgA2). The light chain of an immunoglobulin may be assigned to one of two types, called kappa (κ) and lambda (λ), based on the amino acid sequence of its constant domain. An immunoglobulin essentially consists of two Fab molecules and an Fc domain, linked via the immunoglobulin hinge region.
[0067] “Fc” or “Fc region” or “Fc domain” as used herein refers to the C-terminal region of an antibody heavy chain that contains at least a portion of the constant region. The term includes native sequence Fc regions and variant Fc regions. An Fc can refer to the last two constant region immunoglobulin domains (e.g., CH2 and CH3) of IgA, IgD, and IgG, the last three constant region immunoglobulin domains of IgE and IgM, and optionally, all or a portion of the flexible hinge N-terminal to these domains. For IgA and IgM, Fc may include the J chain. An IgG Fc region comprises an IgG CH2 and an IgG CH3 domain and in some cases, inclusive of the hinge. Unless otherwise specified herein, numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991. The “hinge” region usually extends from amino acid residue at about position 216 to amino acid residue at about position 230. The hinge region herein may be a native hinge domain or variant hinge domain. The “CH2 domain” of a human IgG Fc region usually extends from an amino acid residue at about position 231 to an amino acid residue at about position 340. The CH2 domain herein may be a native sequence CH2 domain or variant CH2 domain. The “CH3 domain” comprises the stretch of residues C-terminal to a CH2 domain in an Fc region, from an amino acid residue at about position 341 to an amino acid residue at about position 447 of an IgG. The CH3 region herein may be a native sequence CH3 domain or a variant CH3 domain (e.g. a CH3 domain with an introduced “protuberance” (“knob”) in one chain thereof and a corresponding introduced “cavity” (“hole”) in the other chain thereof; see U.S. Pat. No. 5,821,333, expressly incorporated herein by reference). Thus, the definition of “Fc domain” includes both amino acids 231-447 (CH2-CH3) or 216-447 (hinge-CH2-CH3), or fragments thereof. An “Fc fragment” in this context may contain fewer amino acids from either or both of the N- and C-termini but still retains the ability to form a dimer with another Fc domain or Fc fragment as can be detected using standard methods, generally based on size (e.g. non-denaturing chromatography, size exclusion chromatography, etc.). Human IgG Fc domains are of particular use in the present disclosure, and can be the Fc domain from human IgG1, IgG2 or IgG4.
[0068] A “variant Fc domain” or “Fc variant” or “variant Fc” contains amino acid modifications (e.g. substitution, addition, and deletion) as compared to a parental Fc domain. The term also includes naturally occurring allelic variants of the Fc region of an immunoglobulin. In general, variant Fc domains have at least about 80, 85, 90, 95, 97, 98 or 99 percent identity to the corresponding parental human IgG Fc domain (using the identity algorithms discussed below, with one embodiment utilizing the BLAST algorithm as is known in the art, using default parameters). Alternatively, the variant Fc domains can have from 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 amino acid modifications as compared to the parental Fc domain. For example, one or more amino acids can be deleted from the N-terminus or C-terminus of the Fc region of an immunoglobulin without substantial loss of biological function. Additionally, as discussed herein, the variant Fc domains herein still retain the ability to form a dimer with another Fc domain as measured using known techniques as described herein, such as non-denaturing gel electrophoresis.
[0069] “Fc gamma receptor”, “FcγR” or “Fc gamma R” as used herein is meant any member of the family of proteins that bind the IgG antibody Fc region and is encoded by an FcγR gene. In humans this family includes but is not limited to FcγRI (CD64), including isoforms FcγRIa, FcγRIb, and FcγRIc; FcγRII (CD32), including isoforms FcγRIIa (including allotypes H131 and R131), FcγRIIb (including FcγRIIb-1 and FcγRIIb-2), and FcγRIIc; and FcγRIII (CD16), including isoforms FcγRIIIa (including allotypes V158 and F158) and FcγRIIIb (including allotypes FcγRIIb-NA1 and FcγRIIb-NA2) (Jefferis et al., 2002, Immunol Lett 82:57-65, entirely incorporated by reference), as well as any undiscovered human FcγRs or FcγR isoforms or allotypes. An FcγR may be from any organism, including but not limited to humans, mice, rats, rabbits, and monkeys. Mouse FcγRs include but are not limited to FcγRI (CD64), FcγRII (CD32), FcγRIII (CD16), and FcγRIII-2 (CD16-2), as well as any undiscovered mouse FcγRs or FcγR isoforms or allotypes.
[0070] By “effector function” as used herein is meant a biochemical event that results from the interaction of an antibody Fc region with an Fc receptor or ligand, which vary with the antibody isotype. Effector functions include but are not limited to antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cell-mediated phagocytosis (ADCP), complement-dependent cytotoxicity (CDC), cytokine secretion, immune complex-mediated antigen uptake by antigen presenting cells, down regulation of cell surface receptors (e.g. B cell receptor), and B cell activation. “Antibody-dependent cell-mediated cytotoxicity” or “ADCC” refer to a cell-mediated reaction in which nonspecific cytotoxic cells that express FcRs (such as Natural Killer (NK) cells, neutrophils, and macrophages) recognize bound antibody on a target cell and subsequently cause lysis of the target cell. ADCC is correlated with binding to FcγRIIIa; increased binding to FcγRIIIa leads to an increase in ADCC activity. To assess ADCC activity of a molecule of interest, an in vitro ADCC assay such as that described in U.S. Pat. No. 5,500,362 or 5,821,337 may be performed. “ADCP” or antibody dependent cell-mediated phagocytosis as used herein is meant the cell-mediated reaction wherein nonspecific cytotoxic cells that express FcγRs recognize bound antibody on a target cell and subsequently cause phagocytosis of the target cell.
[0071] “Fc null” and “Fc null variant” are used interchangeably and used herein to describe a modified Fc which have reduced or abolished effector functions. Such Fc null or Fc null variant have reduced or abolished to FcγRs and/or complement receptors. Preferably, such Fc null or Fc null variant has abolished effector functions. Exemplary methods for the modification include but not limited to chemical alteration, amino acid residue substitution, insertion and deletions. Exemplary amino acid positions on Fc molecules where one or more modifications were introduced to decrease effector function of the resulting variant (numbering based on the EU numbering scheme) at position i) IgG1: C220, C226, C229, E233, L234, L235, G237, P238, S239 D265, 5267, N297, L328, P331, K322, A327 and P329, ii) IgG2: V234, G237, D265, H268, N297, V309, A330, A331, K322 and iii) IgG4: L235, G237, D265 and E318. Exemplary Fc molecules having decreased effector function include those having one or more of the following substitutions: i) IgG1: N297A, N297Q, D265A/N297A, D265A/N297Q, C220S/C226S/C229S/P238S, S267E/L328F, C226S/C229S/E233P/L234V/L235A, L234F/L235E/P331S, L234A/L235A, L234A/L235A/G237A, L234A/L235A/G237A/K322A, L234A/L235A/G237A/A330S/A331S, L234A/L235A/P329G,E233P/L234V/L235A/G236del/S239K, E233P/L234V/L235A/G236del/S267K, E233P/L234V/L235A/G236del/S239K/A327G, E233P/L234V/L235A/G236del/S267K/A327G and E233P/L234V/L235A/G236del, L234A/L235A/G237deleted; ii) IgG2: A330S/A331S, V234A/G237A, V234A/G237A/D265A, D265A/A330S/A331S, V234A/G237A/D265A/A330S/A331S, and H268Q/V309L/A330S/A331S; iii) IgG4: L235A/G237A/E318A, D265A, L235A/G237A/D265A and L235A/G237A/D265A/E318A.
[0072] “Epitope” as used herein refers to a determinant capable of specific binding to the variable region of an antibody molecule known as a paratope. Epitopes are groupings of molecules such as amino acids or sugar side chains and usually have specific structural characteristics, as well as specific charge characteristics. A single antigen may have more than one epitope. The epitope may comprise amino acid residues directly involved in the binding and other amino acid residues, which are not directly involved in the binding, such as amino acid residues which are effectively blocked by the antigen binding peptide (in other words, the amino acid residue is within the footprint of the antigen binding peptide). Epitopes may be either conformational or linear. An epitope typically includes at least 3, and more usually, at least 5 or 8-10 amino acids. Antibodies that recognize the same epitope can be verified in a simple immunoassay showing the ability of one antibody to block the binding of another antibody to a target antigen, for example “binning”.
[0073] “Linker” as used herein refers to a molecule that connect two polypeptide chains. Linker can be a polypeptide linker or a synthetic chemical linker (for example, see disclosed in Protein Engineering, 9(3), 299-305, 1996). The length and sequence of the polypeptide linkers is not particularly limited and can be selected according to the purpose by those skilled in the art. Polypeptide linker comprises one or more amino acids. Preferably, polypeptide linker is a peptide with a length of at least 5 amino acids, preferably with a length of 5 to 100, more preferably of 10 to 50 amino acids. In one embodiment, said peptide linker is G, S, GS, SG, SGG, GGS, and GSG (with G=glycine and S=serine). In another embodiment, said peptide linker is (GGGS)xGn (SEQ ID NO:5) or (GGGGS)xGn (SEQ ID NO:6) or (GGGGGS)xGn (SEQ ID NO:7) with x=1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 and n=0, 1, 2 or 3. Preferably, the said linker is (GGGGS)xGn with x=2, 3, or 4 and n=0 (SEQ ID NO:8); more preferably the said linker is (GGGGS)xGn with x=3 and n=0 (SEQ ID NO:9). Synthetic chemical linkers include crosslinking agents that are routinely used to crosslink peptides, for example, N-hydroxy succinimide (NHS), disuccinimidyl suberate (DSS), bis(succinimidyl) suberate (BS3), dithiobis(succinimidyl propionate) (DSP), dithiobis(succinimidyl propionate) (DTSSP), ethylene glycol bis(succinimidyl succinate) (EGS), ethylene glycol bis(sulfosuccinimidyl succinate) (sulfo-EGS), disuccinimidyl tartrate (DST), disulfosuccinimidyl tartrate (sulfo-DST), bis[2-(succinimidoxycarbonyloxy)ethyl]sulfone (BSOCOES), and bis[2-(succinimidoxycarbonyloxy)ethyl]sulfone (sulfo-BSOCOES).
[0074] The term “polynucleotide” refers to an isolated nucleic acid molecule or construct, e.g. messenger RNA (mRNA), virally-derived RNA, or plasmid DNA (pDNA) encoding the polypeptides of the present disclosure. A polynucleotide may comprise a conventional phosphodiester bond or a non-conventional bond (e.g. an amide bond, such as found in peptide nucleic acids (PNA). The term “nucleic acid molecule” refers to any one or more nucleic acid segments, e.g. DNA or RNA fragments, present in a polynucleotide. In some aspects, one or more vectors (particularly expression vectors) comprising such nucleic acids are provided. In one aspect, a method for making a polypeptide of the present disclosure is provided, wherein the methods comprises culturing a host cell comprising a nucleic acid encoding the polypeptide under conditions suitable for expression of the polypeptide and recovering the polypeptide from the host cell. “Recombinant” means the proteins are generated using recombinant nucleic acid techniques in exogeneous host cells. Recombinantly produced proteins expressed in host cells are considered isolated for the purpose of the present disclosure, as are native or recombinant proteins which have been separated, fractionated, or partially or substantially purified by any suitable technique.
[0075] “Isolated,” when used to describe the various polypeptides disclosed herein, means a polypeptide that has been identified and separated and/or recovered from a cell or cell culture from which it was expressed. Typically, an isolated polypeptide will be purified by at least one purification step. There is no required level of purity; “purification” or “purified” refers to increase of the target protein concentration relative to the concentration of contaminants in a composition as compared to the starting material. An “isolated protein,” as used herein refers to a target protein which is substantially free of other proteins having different binding specificities.
[0076] The terms “cancer” refers the physiological condition in mammals that is typically characterized by unregulated and abnormal cell growth with the potential to invade or spread to other parts of the body. Examples of cancer include but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular examples of such cancers include lung cancer, small-cell lung cancer, non-small cell lung (NSCL) cancer, bronchioloalveolar cell lung cancer, squamous cell cancer, adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, head and neck cancer, bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular melanoma, thyroid cancer, uterine cancer, gastrointestinal cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, gastric cancer, colon cancer, breast cancer, endometrial carcinoma, uterine cancer, carcinoma of the fallopian tubes, carcinoma of the cervix, carcinoma of the vagina, vulval cancer, Hodgkin's Disease, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, prostate cancer, cancer of the bladder, cancer of the kidney or ureter, renal cell carcinoma, carcinoma of the renal pelvis, mesothelioma, bladder cancer, liver cancer, hepatoma, hepatocellular cancer, cervical cancer, salivary gland carcinoma, biliay cancer, neoplasms of the central nervous system (CNS), spinal axis tumors, brain stem glioma, glioblastoma multiforme, astrocytomas, schwannomas, ependymomas, medulloblastomas, meningiomas, squamous cell carcinomas, pituitary adenoma and Ewings sarcoma, including refractory versions of any of the above cancers, or a combination of one or more of the above cancers.
Mutant IL-2 Polypeptides
[0077] The present disclosure provides, inter alia, mutant IL-2 polypeptides that exhibit less than 50% of binding affinity to IL-2Rα(e.g., comprising the amino acid sequence of SEQ ID NO:2 or as shown in
[0078] The mutant IL-2 polypeptides of the present disclosure have one or more, two or more, or three or more affinity-reducing amino acid substitutions relative to the wild-type mature IL-2 polypeptide having an amino acid sequence as depicted in
[0079] In some embodiments, the mutant IL-2 polypeptide comprises an F42A or F42K amino acid substitution relative to the wild-type mature IL-2 amino acid sequence, e.g., as depicted in
[0080] In some embodiments, the mutant IL-2 polypeptides of the present disclosure also contain other modifications, including but not limited to mutations and deletions, that provide additional advantages such as improved biophysical properties. Improved biophysical properties include but are not limited to improved thermostability, aggregation propensity, acid reversibility, viscosity, and production in a mammalian or bacterial or yeast cell. For example, residue C125 may be replaced with a neutral amino acid such as serine, alanine, threonine or valine; and N terminal A1 residue could be deleted, both of which were described in U.S. Pat. No. 4,518,584. Mutant IL-2 polypeptides may also include a mutation of the residue M104, such as M104A, as described in U.S. Pat. No. 5,206,344. Thus, in certain embodiments the mutant IL-2 polypeptide of the present disclosure comprises the amino acid substitution C125A. In other embodiments, one, two, or three N-terminal residues are deleted.
Fusion Proteins
[0081] The present disclosure provides fusion proteins comprising the mutant IL-2 polypeptides of the present disclosure and antigen binding molecules binding to one of the following antigens: CD8α, CD8β, and PD1 wherein said fusion proteins preferentially activate immune cells expressing the antigen for the antigen binding molecule of the fusion over immune cells not expressing said antigen.
[0082] Preferential activity of the targeted IL-2 fusion proteins comprising the mutant IL-2 polypeptides on antigen-expressing cells is demonstrated in assays that contain antigen-expressing and antigen-non expressing cells that also express IL-2Rβγ or IL-2Rαβγ. One such assay is an in vitro assay that measures STAT5 (pSTAT5) phosphorylation and/or expression of the proliferation marker Ki-67 in human immune cells, such as human peripheral blood and/or tumor-infiltrating immune cells upon exposure to IL-2 polypeptides. In one format of the assay, the activity of the targeted IL-2 fusion protein is measured on antigen-expressing and non-expressing cells to demonstrate the selectivity on antigen-expressing cells. In another format of the assay, the activity of the targeted IL-2 fusion protein comprising the mutant IL-2 polypeptide on antigen-expressing cells is compared to that of the untargeted IL-2 fusion protein comprising the same mutant IL-2 polypeptide and a control antibody not recognizing any antigens on antigen-expressing cells to demonstrate the magnitude of rescue in signaling of the mutant IL-2 polypeptide when fused to an antigen binding molecule.
[0083] In some embodiments, the fusion protein of the present disclosure containing CD8α antigen binding molecules activates CD8α+IL-2Rβ+ cells over CD8α−IL-2Rβ+ cells, by at least 10-fold, at least 50-fold, or at least 100-fold. In some embodiments, said fusion protein activate CD8α+IL-2Rβ+ cells more than 50-fold, 100 fold, or 200 fold compared to a fusion molecule comprising the said IL-2 mutant polypeptide and a control antibody not binding to any antigens expressed on said cells. Said cell activation by the IL-2 fusion protein is determined by measuring the expression of pSTAT5 or the cell proliferation marker Ki67 in said cells following the treatment with said IL-2 fusion protein.
[0084] In some embodiments, the fusion protein of the present disclosure containing CD8β antigen binding molecules activates CD8β+IL-2Rβ+ cells over CD8β− IL-2Rβ+ cells by at least 10-fold, at least 50-fold, or at least 100-fold. In some embodiments, said fusion protein activates CD8β+IL-2Rβ+ cells more than 50-fold, 100 fold, or 200 fold compared to a fusion molecule comprising the said IL-2 mutant polypeptide and a control antibody not binding to any antigens expressed on said cells. Said cell activation by the IL-2 fusion protein is determined by measuring the expression of pSTAT5 or the cell proliferation marker Ki67 in said cells following the treatment with said IL-2 fusion protein
[0085] In some embodiments, fusion protein of the present disclosure containing PD1 antigen binding molecules activates PD1+IL-2Rβ+ cells over PD1−IL-2Rβ+ cells by at least 10-fold, at least 50-fold, or at least 100-fold. In some embodiments, said fusion protein activates PD1+IL-2Rβ+ cells more than 50-fold, 100 fold, or 200 fold compared to a fusion protein comprising the said IL-2 mutant polypeptide and a control antibody not binding to any antigens expressed on said cells. Said cell activation by the IL-2 fusion protein is determined by measuring the expression of pSTAT5 or the cell proliferation marker Ki67 in said cells following the treatment with said IL-2 fusion protein.
[0086] In some embodiments, a fusion protein of the present disclosure displays one or more of the following: binds human CD8 and does not block an interaction of CD8 with MHC class I; and activates CD8+ T cells with at least 10-fold, 25-fold, 50-fold, 100-fold, 250-fold, 500-fold, or 1000-fold greater potency, e.g., as compared to activation of NK cells. In some embodiments, whether an anti-CD8 antibody or fusion protein of the present disclosure blocks the interaction of CD8 with MHC class I can be assayed, e.g., by assaying activation status of CD8+ T cells (e.g., upon antigen stimulation) in the presence or absence of the anti-CD8 antibody or fusion protein. For an exemplary assay and conditions, see, e.g., Example 3. In some embodiments, activation of CD8+ T cells and/or NK cells can be measured, e.g., by assaying one or more markers (e.g., proportion of treated cells expressing one or more markers) of proliferation (e.g., Ki67), IL-2Rβ/γ downstream signaling, and/or STAT5 downstream signaling. For an exemplary assay and conditions, see, e.g., Example 5.
[0087] By extension of these findings, the fusion proteins of the disclosure may contain polypeptides that bind to IL-2Rαβγ for which reduction in binding affinity to IL2Rα was achieved by methods other than introducing a small number of mutations in the sequence of the wild-type IL-2 polypeptide. Therefore, the fusion proteins of the invention may include IL-2 polypeptides that were fused to IL-2Rα as described in Lopes et al, J Immunother Cancer. 2020; 8 (1): e000673; or synthetic polypeptide mimics computationally designed to bind to IL-2Rβγ, but not to IL-2Rα, such as the one described in Silva et al, Nature. 2019 January; 565(7738):186-191; or by using an antigen binding domain polypeptide that is agonistic to IL-2Rγγ. Such polypeptides can be fused to CD8 antibodies to construct fusions resulting in their selective potency for CD8+ T cells compared to NK cells of 10 fold or more.
Fusion Protein Formats
[0088] Said fusion proteins have different formats as depicted in
[0089] In some embodiments, the fusion protein comprises two moieties as depicted in
[0090] In some embodiments, the fusion protein comprises two moieties as depicted in
[0091] In some embodiments, said first and second Fc domains of the fusion protein contain the following Fc mutations to decrease effector function according to EU numbering: L234A, L235A, G237A, and K322A. In some embodiments, said first and second Fc domains of the fusion protein contain the following Fc mutations to decrease effector function according to EU numbering: L234A, L235A, G237A, and K322A. In some embodiments, said first and second Fc domains of the fusion protein contain the following amino acid substitutions to facilitate heterodimeric formation: Y349C/T366W (knob) and S354C, T366S, L368A and Y407V (hole).
[0092] In some embodiments, the recombinant bispecific antibodies and/or fusion proteins disclosed herein can be very roughly classified in two categories, namely i) formats resulting from the combination of variable regions only and ii) formats combining variable regions with Fc domains. Representatives of the first category are tandem scFv (taFv), diabodies (db), DART, single-chain diabodies (scDbs), Fab-Fc, tandem Fab, Dual variable region Fab and tandem dAb/VHH. The two variable regions can be linked together via covalent bonds or non-covalent interaction.
[0093] In some embodiments, bispecific antibodies/fusion proteins are generated on the natural immunoglobulin architecture containing two pairs of heavy chain and light chain combination with each pair having distinct binding specificity. Homodimerization of the two heavy chains in an IgG is mediated by the CH3 interaction. To promote heterodimeric formation, genetic modifications are introduced to the two respective CH3 regions. There heterodimerization mutations often involve steric repulsion, charge steering interaction, or interchain disulfide bond formation. Exemplary Fc modifications to promote heterodimerization include, without limitation, the following:
TABLE-US-00001 TABLE A Fc modifications (EU numbering) that promote heterodimerization. Strategy CH3 domain 1 CH3 domain 2 References knobs-into-holes 1 T366Y Y407T Brinkmann & Kontermann, knobs-into-holes 2 T366W T366S-L368A-Y407V MAbs. knobs-into-holes 3 S354C, T366W Y349C, T366S, L368A, 2017 February-March; 9(2): 182-212; Y407V Atwell et al, J Mol knobs-into-holes 4 Y349C, T366W S354C, T366S, L368A, Biol 1997; 270: 26-35; Y407V Merchant et al, Nat Biotechnol 1998; 16: 677-681 HA-TF S364H, F405A Y349T, T394F Moore et al, MAbs 2011; 3: 546-557 ZW1 T350V, L351Y, T350V, T366L, K392L, Von Kreudenstein et al, MAbs F405A, Y407V T394W 2013; 5: 646-54 CH3 charge pairs (DD- K392D, K409D E356K, D399K Gunasekaran et al, J Biol KK) Chem 2010; 285: 19637-46 IgG1 hinge/CH3 IgG1: D221E, IgG1: D221R, P228R, Strop P et al, J Mol charge pairs (EEE-RRR) P228E, L368E K409R Biol 2012; 420: 204-19 IgG2 hinge/CH3 IgG2: C223E, IgG2: C223R, E225R, charge pairs (EEE- P228E, L368E P228R, K409R RRRR) EW-RVT K360E, K409W, Q347R, D399V, F405T Choi et al, Mol Cancer Ther 2013; 12: 2748-59 EW-RVY.sub.S-S K360E, K409W, Q347R, D399V, F405T, Choi et al, Mol Y349C S354C Immunol 2015; 65: 377-83 Biclonic 366K (+351K) 351D or E or D at 349, Geuijen et al, ournal of Clinical 368, 349, or 349 + 355 Oncology 2014; 32: suppl: 560 DuoBody (L-R) 1 F405L K409R Labrijn et al, Nat DuoBody (L-R) 2 F405L-R409K WT (R409) Protoc 2014; 9: 2450-63; Labrijn et al, PNAS 2013; 110(13): 5145-50 SEEDbody IgG/A chimera IgG/A chimera Davis et al, Protein Eng Des Sel 2010; 23: 195-202 BEAT residues from residues from TCRβ Moretti et al, BMC TCRα interface interface Proceedings 2013; 7(Suppl 6): O9 Mixed interface (MI) IgG-CH3 variants igA/D/M CH3 variants Skegro et al, J Biol Chem. 2017 heterodimers or IgM CH4 variants 292(23): 9745-9759. XmAb E357Q-S364K L368D-K370S Moore et al, Methods. 2019 154: 38-50 DEKK Fc L351D-L368E L351K-T366K De Nardis et al., J Biol Chem. 2017; 292(35): 14706-14717. Charge pair E356K or E357K K370E, K409D, K439E Igawa T, Tsunoda H. or D399K WO2006106905. 2006. KKA-DDW D356K-D399K- K392D-K409D- Zhou et al, WO2014079000A1 Y407A T366W Charge pair L368E-Y407E E357K-D399K Labrijn et al, Nat Review Drug Discovery 2019; 18, 585-608 Knob-hole- S354C-T366W- Y349C-T366S-L368A- Wei et al., Oncotarget. 2017; electrostatic K409A Y407-F405K 8(31): 51037-51049 KA F405K K409A Wei et al., Oncotarget. 2017; 8(31): 51037-51049 PPV-TPP P395K-P396K- T394D-P395D-P396D, Wenjun Zhang US10538595B2 V397K, P395K- T394C-P395D-P396D P396K-V397C or T394E-P395E-P396E or P395R- P396R-V397R
[0094] In some embodiments, bispecific antibody can be generated by post-production assembly from half-antibodies, thereby solving the issues of heavy and light chain mispairing. These antibodies often contain modification to favor heterodimerization of half-antibodies. Exemplary systems include but not limited to the knob-into-hole, IgG1 (EEE-RRR), IgG2 (EEE-RRRR) (Strop et al. J Mol Biol (2012)) and DuoBody (F405L-K409R), listed in Table A. In such case, half-antibody is individually produced in separate cell line and purified. The purified antibodies were then subjected to mild reduction to obtain half-antibodies, which were then assembled into bispecific antibodies. Heterodimeric bispecific antibody was then purified from the mixture using conventional purifications methods.
[0095] In some embodiments, strategies on bispecific antibody generation that do not rely on the preferential chain pairing can also be employed. These strategies typically involve introducing genetic modification on the antibody in such a manner that the heterodimer will have distinct biochemical or biophysical properties from the homodimers; thus the post-assembled or expressed heterodimer can be selectively purified from the homodimers. One example was to introduce H435R/Y436F in IgG1 CH3 domain to abolish the Fc binding to protein A resin and then co-express the H435R/Y436F variant with a wildtype Fc. The resulting homodimeric antibodies containing two copies of H435R/Y436F cannot bind to the Protein A column, while heterodimeric antibody comprising one copy of H435R/Y436F mutation will have a decreased affinity for protein A as compared to the strong interaction from homodimeric wildtype antibody (Tustian et al Mabs 2016). Other examples include kappa/lambda antibody (Fischer et al., Nature Communication 2015) and introduction of differential charges (E357Q, S267K or N208D/Q295E/N384D/Q418E/N421D) on the respective chains (US 2018/0142040 A1; (Strop et al. J Mol Biol (2012)).
[0096] In some embodiments, bispecific antibody can be generated via fusion of an additional binding site to either the heavy or light chain of an immunoglobulin. Examples of the additional binding site include but not limited to variable regions, scFv, Fab, VHH, and peptide.
[0097] In some embodiments, the heterodimeric mutations and/or mutations to modify Fc gamma receptor binding resulted in reduction of Fc stability. Therefore, additional mutation(s) was added to the Fc region to increase its stability. For example, one or more pairs of disulfide bonds such as A287C and L306C, V259C and L306C, R292C and V302C, and V323C and I332C are introduced into the Fc region. Another example is to introduce S228P to IgG4 based bispecific antibodies to stabilize the hinge disulfide. Additional example includes introducing K338I, A339K, and K340S mutations to enhance Fc stability and aggregation resistance (Gao et al, 2019 Mol Pharm. 2019; 16:3647).
Antigen Binding Molecules
[0098] In some embodiments, the fusion protein binds human CD8, and the binding of the fusion protein to CD8 does not block the interaction of CD8 with MEC class I. In some embodiments, the antigen binding molecule of the present disclosure binds to an epitope on CD8α wherein the binding of the antigen binding molecule to CD8α does not block the interaction of CD8αα or CD8αβ with MHC class I molecules on target cells or antigen presenting cells. In some embodiments, the antigen binding molecule of the present disclosure binds to an epitope on CD8β wherein the binding of the antigen binding molecule to CD8β does not block the interaction of CD8αβ with MEC class I molecules on target cells or antigen presenting cells. In some embodiments, whether an anti-CD8 antibody or fusion protein of the present disclosure blocks the interaction of CD8 with MEC class I can be assayed, e.g., by assaying activation status of CD8+ T cells (e.g., upon antigen stimulation) in the presence or absence of the anti-CD8 antibody or fusion protein. For an exemplary assay and conditions, see, e.g., Example 3.
[0099] In some embodiments, an anti-CD8 antibody or fusion protein of the present disclosure comprises a VH domain comprising the sequence of EVQLVESGGGLVQPGRSLKLSCAASGFTFSNYYMAWVRQAPTKGLEWVAYINTGGGTT YYRDSVKGRFTISRDDAKSTLYLQMDSLRSEDTATYYCTTAIGYYFDYWGQGVMVTVS S (SEQ ID NO:10) and a VL domain comprising the sequence of DIQLTQSPASLSASLGETVSIECLASEDIYSYLAWYQQKPGKSPQVLIYAANRLQDGVPS RFSGSGSGTQYSLKISGMQPEDEGDYFCLQGSKFPYTFGAGTKLELK (SEQ ID NO:11).
[0100] In some embodiments, an anti-CD8 antibody or fusion protein of the present disclosure comprises a VH domain comprising the sequence of EVKLQESGPSLVQPSQTLSLTCSVSGFSLISDSVHWVRQPPGKGLEWMGGIWADGSTDY NSALKSRLSISRDTSKSQGFLKMNSLQTDDTAIYFCTSNRESYYFDYWGQGTMVTVSS (SEQ ID NO:12) and a VL domain comprising the sequence of DIQMTQSPASLSASLGDKVTITCQASQNIDKYIAWYQQKPGKAPRQLIHYTSTLVSGTPS RFSGSGSGRDYSFSISSVESEDIASYYCLQYDTLYTFGAGTKLELK (SEQ ID NO:13). In some embodiments, an anti-CD8 antibody or fusion protein of the present disclosure comprises a VH domain comprising the sequence of EVKLQESGPSLVQPSQTLSLTCSVSGFSLISDSVHWVRQPPGKGLEWMGGIWADGSTDY NSALKSRLSISRDTSKSQGFLKMNSLQTDDTAIYFCTSARESYYFDYWGQGTMVTVSS (SEQ ID NO:14) and a VL domain comprising the sequence of DIQMTQSPASLSASLGDKVTITCQASQNIDKYIAWYQQKPGKAPRQLIHYTSTLVSGTPS RFSGSGSGRDYSFSISSVESEDIASYYCLQYATLYTFGAGTKLELK (SEQ ID NO:15). In some embodiments, an anti-CD8 antibody or fusion protein of the present disclosure comprises a VH domain comprising the sequence of EVQLVESGGALVQPGRSLKLSCAASGLTFSDCYMAWVRQTPTKGLEWVSYISSDGGST YYGDSVKGRFTISRDNAKSTLYLQMNSLRSEDMATYYCACATDLSSYWSFDFWGPGT MVTVSS (SEQ ID NO:16) and a VL domain comprising the sequence of DIQMTQSPSSLPVSLGERVTISCRASQGISNNLNWYQQKPDGTIKPLIYHTSNLQSGVPSR FSGSGSGTDYSLTISSLEPEDFAMYYCQQDATFPLTFGSGTKLEIK (SEQ ID NO:17).
[0101] In some embodiments, the antigen binding molecule of the present disclosure binds to an epitope on PD1 wherein the binding of the antigen binding molecule to PD1 does not block the interaction of PD1 with PD-L1 expressed on target cells or other immune cells. Such fusion proteins are particularly useful as they can be administered as therapeutics in combination with anti-PD1 therapeutic antibodies, including but not limited to nivolumab, pembrolizumab, and cemiplimab.
[0102] In some embodiments, the antigen binding molecule of the present disclosure binds to an epitope on PD1 wherein the binding of the antigen binding molecule to PD1 blocks the interaction of PD1 with PD-L1 on target cells or other immune cells. Such fusion proteins are particularly useful as they can be administered as therapeutics in combination with anti-PDL1 therapeutic antibodies, including but not limited to atezolizumab, avelumab, and durvalumab.
[0103] Certain aspects of the present disclosure relate to methods of treating cancer or chronic infection. In some embodiments, the methods comprise administering an effective amount of a fusion protein, or a pharmaceutical composition comprising the fusion protein and a pharmaceutically acceptable carrier, to a patient. In some embodiments, the patient in need of said treatment has been diagnosed with cancer.
[0104] In some embodiments, the fusion protein or composition is administered in combination with a T cell therapy, cancer vaccine, chemotherapeutic agent, or immune checkpoint inhibitor (ICI). In some embodiments, the chemotherapeutic agent is a kinase inhibitor, antimetabolite, cytotoxin or cytostatic agent, anti-hormonal agent, platinum-based chemotherapeutic agent, methyltransferase inhibitor, antibody, or anti-cancer peptide. In some embodiments, the immune checkpoint inhibitor targets PD-L1, PD-1, CTLA-4, CEACAM, LAIR1, CD160, 2B4, CD8β, CD86, CD276, VTCN1, HVEM, KIR, A2AR, MEW class I, MHC class II, GALS, adenosine, TGFR, OX40, CD137, CD40, IDO, CSF1R, TIM-3, BTLA, VISTA, LAG-3, TIGIT, IDO, MICA/B, LILRB4, SIGLEC-15, or arginase, including without limitation an inhibitor of PD-1 (e.g., an anti-PD-1 antibody), PD-L1 (e.g., an anti-PD-L1 antibody), or CTLA-4 (e.g., an anti-CTLA-4 antibody). Examples of T cell therapies include, without limitation, CD4+ or CD8+ T cell-based therapies, adoptive T cell therapies, chimeric antigen receptor (CAR)-based T cell therapies, tumor-infiltrating lymphocyte (TIL)-based therapies, autologous T cell therapies, and allogeneic T cell therapies. Exemplary cancer vaccines include, without limitation, dendritic cell vaccines, vaccines comprising one or more polynucleotides encoding one or more cancer antigens, and vaccines comprising one or more cancer antigenic peptides.
[0105] In some embodiments, a fusion protein of the present disclosure is part of a pharmaceutical composition, e.g., including the fusion protein and one or more pharmaceutically acceptable carriers. Pharmaceutical compositions and formulations as described herein can be prepared by mixing the active ingredients (such as a fusion protein) having the desired degree of purity with one or more optional pharmaceutically acceptable carriers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions. Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives; low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as polyethylene glycol (PEG). In some embodiments, a fusion protein of the present disclosure is lyophilized.
Enumerated Embodiments
[0106] The following enumerated embodiments are representative of some aspects of the invention. [0107] 1. A fusion protein comprising two moieties, wherein: [0108] i) The first moiety is a polypeptide comprising an antibody heavy chain VH—CH1-hinge-CH2-CH3 monomer wherein VH is a variable heavy chain and CH2-CH3 is a Fc domain, an antibody light chain VL-CL wherein VL is a variable light chain and CL is a constant light chain, and a mutant IL-2 polypeptide, wherein the N-terminus of the mutant IL-2 polypeptide is fused to the C-terminus of the Fc domain via a linker; [0109] ii) The second moiety is a polypeptide comprising an antibody heavy chain VH—CH1-hinge-CH2-CH3 monomer and an antibody light chain VL-CL; [0110] and wherein, both the first and second moiety bind to an epitope on one antigen selected from the following group: human CD8α, human CD8β, and human PD1. [0111] 2. A fusion protein comprising two moieties, wherein: [0112] i) The first moiety is a polypeptide comprising an antibody hinge-CH2-CH3 monomer wherein CH2-CH3 is a Fc domain, and a mutant IL-2 polypeptide, wherein the N-terminus of the mutant IL-2 polypeptide is fused to the C-terminus end of the Fc domain via a linker; [0113] ii) The second moiety is a polypeptide comprising an antibody heavy chain VH—CH1-hinge-CH2-CH3 monomer and an antibody light chain VL-CL; [0114] and wherein the second moiety binds to an epitope on one antigen selected from the following group: human CD8α, human CD8β, and human PD1. [0115] 3. A fusion protein comprising two moieties, wherein: [0116] i) The first moiety is a polypeptide comprising an antibody hinge-CH2-CH3 monomer wherein CH2-CH3 is a Fc domain, and a mutant IL-2 polypeptide, wherein the C-terminus of the mutant IL-2 polypeptide is fused to the N-terminus end of the Fc domain via a linker; [0117] ii) The second moiety is a polypeptide comprising an antibody heavy chain VH—CH1-hinge-CH2-CH3 monomer and an antibody light chain VL-CL; [0118] and wherein the second moiety binds to an epitope on one antigen selected from the following group: human CD8α, human CD8β, and human PD1. [0119] 4. The fusion protein of any one of embodiments 1 to 3 wherein said mutant IL-2 polypeptide exhibits reduced binding affinity by 50% or more to IL-2Rα polypeptide having an amino acid sequence depicted in
EXAMPLES
Example 1
Recombinant DNA Techniques
[0132] Techniques involving recombinant DNA manipulation were previously described in Sambrook et al., Molecular cloning: A laboratory manual; Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989. All reagents were used according to the manufacturer's instructions. DNA sequences were determined by double strand sequencing.
Gene Synthesis
[0133] Desired gene segments were either generated by PCR using appropriate templates or synthesized at Thermo Scientific (Pleasanton, Calif.), ATUM (Newark, Calif.), Genewiz (South Plainfield, N.J.), or GeneScript (Piscataway, N.J.) from synthetic oligonucleotides. The gene segments flanked by designed restriction endonuclease cleavage sites were digested out and later cloned into their respective expression vectors. DNA was purified from transformed bacteria and concentration determined by UV visible spectroscopy. DNA sequencing was used to confirm the DNA sequences of the subcloned gene fragments.
Isolation of Antibody Genes
[0134] Antibodies binding to CD8 or PD1 antigens were generated using either in vitro display system or in vivo immunizations. For in vitro display method, a non-immune human antibody phage library was panned for 5 to 6 rounds to isolate antibodies against the target antigen. After the panning, individual phage clones that exhibited specific binding to target antigen over non-specific antigens in ELISA were identified. DNA fragments of heavy and light chain V-domain of the specific binders were subsequently cloned and sequenced. Meanwhile, antibodies were also generated from immunizing mice and llamas with the recombinant form of the antigens. From the mouse immunization, hybridoma method was used to isolate the antibody. Briefly, after immunization, B cells from spleen and/or lymph nodes were fused with a myeloma cell line to generate the hybridoma cells. Hybridoma clones were then individually screened using ELISA to identify the clones expressing antibodies specific for the antigen. Finally, DNA fragments of heavy and light chain V-domain of the antibody were cloned from the specific hybridoma and later sequenced. For the llama immunization, antibody genes were cloned from peripheral B cells and ligated into the phagemid vector to generate a phage display antibody library. Antibodies were then isolated through panning the phage library against the antigens of interest. After the panning, individual phage clones that exhibited specific binding to target antigen over non-specific antigens were identified using ELISA. DNA fragments of heavy and light chain V-domain of the specific binders were then subsequently cloned and sequenced. Antibodies from non-human origins (mouse and llama) were then humanized to remove non-human framework and complementarity-determining region mutations.
Cloning of Fusion Constructs
[0135] General information regarding the nucleotide sequences of human immunoglobulins light and heavy chains is given in: IMGT® (the international ImMunoGeneTics information System®) from Lefranc et al. IMGT®, the international ImMunoGeneTics information System® 25 years on. Nucleic Acids Res. 2015 January; 43. The amplified DNA fragments of heavy and light chain V-domains were inserted in frame into the human IgG1 containing mammalian expression vector. The IL-2 portions of the constructs were cloned in frame with the heavy chain using a (G4S)3 15-mer linker between the C-terminus of the IgG heavy chain and the N-terminus of IL-2. The C-terminal lysine residue of the IgG heavy chain was eliminated after fusing the IL-2 portion. To generate the construct in which a single IL-2 gene was fused to a full IgG, two heavy chain plasmids needed to be constructed and transfected for heterodimerization facilitated by a knob-into-hole modification in the IgG CH3 domains. The “hole” heavy chain connected to the IL-2 portion carried the Y349C, T366S, L368A and Y407V mutations in the CH3 domain, whereas the unfused “knob” heavy chain carried the S354C and T366W mutations in the CH3 domain (EU numbering). To abolish FcγR binding/effector function and prevent FcR co-activation, the following mutations were introduced into the CH2 domain of each of the IgG heavy chains: L234A/L235A/G237A (EU numbering). The expression of the antibody-IL-2 fusion constructs was driven by an CMV promoter and transcription terminated by a synthetic polyA signal sequence located downstream of the coding sequence.
Preparation of Fusion Proteins with IL-2 Polypeptides
[0136] Constructs encoding fusion proteins with IL-2 polypeptides as used in the examples were produced by co-transfecting exponentially growing Expi293 cells with the mammalian expression vectors using polyethylenimine (PEI). Briefly, IL-2 fusion constructs were first purified by affinity chromatography using a protein A matrix. The protein A column was equilibrated and washed in phosphate-buffered saline (PBS). The fusion constructs were eluted with 20 mM sodium citrate, 50 mM sodium chloride, pH 3.6. The eluted fractions were pooled and dialyzed into 10 mM IVIES, 25 mM sodium chloride pH 6. The proteins were further purified using ion-exchange chromatograph (Mono-S, GE Healthcare) to purify the heterodimers over the homodimers. After loading the protein, the column is washed with 10 mM MES 25 mM sodium chloride pH 6. The protein was then eluted with increasing gradient of sodium chloride from 25 mM up to 500 mM MES in 10 mM MES pH 6 buffer. The major eluent peak corresponding to the heterodimer was collected and concentrated. The purified protein was then polished by size exclusion chromatography (Superdex 200, GE Healthcare) in PBS.
[0137] The protein concentration of purified IL-2 fusion constructs was determined by measuring the optical density (OD) at 280 nm, using the molar extinction coefficient calculated on the basis of the amino acid sequence. Purity, integrity and monomeric state of the fusion constructs were analyzed by SDS-PAGE in the presence and absence of a reducing agent (5 mM 1,4-dithiothreitol) and stained with Coomassie blue (SimpleBlue™ SafeStain, Invitrogen). The NuPAGE® Pre-Cast gel system (Invitrogen) was used according to the manufacturer's instructions (4-20% Tris-glycine gels or 3-12% Bis-Tris). The aggregate content of immunoconjugate samples was analyzed using a Superdex 200 10/300 GL analytical size-exclusion column (GE Healthcare).
pSTAT5 and Ki-67 Assays to Measure Selective Activation of Antigen-Expressing Blood Immune Cells
[0138] Activity of IL-2 fusion proteins was determined in an assay with human peripheral blood mononuclear cells (PBMCs) measuring the phosphorylation of STAT5. PBMCs were isolated from blood of healthy donors using Ficoll-Paque Plus (GE Healthcare) and red blood cells were lysed using ACK lysis buffer (Gibco) according to manufacturer's instructions. Typically, PBMCs were resuspended in serum-free RPMI1640 media at 2×10.sup.6 cells/ml and aliquoted into 96-well U-bottom plates (50 μl per well). IL-2 fusion proteins and control proteins, such as recombinant human IL-2 and control (HA-targeted) fusion proteins, were diluted to desired concentrations and added to wells (50 μl added as 2× stimulus). Incubation was typically performed for 30 min at 37° C., after which it was stopped with 100 μl pre-warmed 4% PFA (2% final) for 10 min at 37° C. Cells were then stained with antibodies against surface markers: CD45 (clone HI30), CD3 (UCHT1, BD Biosciences), CD8α (SK1, Biolegend; RPA-T8, Biolegend), CD4 (RPA-T4, Biolegend), and CD25 (M-A251, Biolegend). Cells were washed 2× with wash buffer (2% FBS in PBS) and fixed with 4% PFA at room temperature for 10 min. After fixation, cells were permeabilized in pre-chilled Phosflow Perm buffer III (BD Biosciences) according to manufacturer's protocol. After permeabilization, cells were stained with antibodies against intracellular markers (pSTAT5 [pY694], clone 47, BD Biosciences, and/or perforin, clone δG9, BD Biosciences) and analyzed on a flow cytometer. Data were expressed as percent pSTAT5 positive, and in some cases as pSTAT5 mean fluorescence intensity (MFI), and imported into GraphPad Prism to determine EC.sub.50 values for each construct.
[0139] To measure cellular changes induced by IL-2 fusion proteins further downstream from pSTAT5 such as proliferation, a flow cytometry assay was used to detect the expression of the intracellular proliferation marker Ki-67. Briefly, PBMCs were isolated as described above and incubated in the presence of IL-2 fusion proteins and controls in serum-supplemented RPMI1640 (10% FBS) for 4 to 6 days or serum free AIM V media (Gibco). Staining for Ki-67 (clone Ki-67, Biolegend) was performed with Foxp3/Transcription Factor Staining Buffer Set (Thermo Fisher Scientific) according to manufacturer's protocol. Data were expressed as percent Ki-67 positive and imported into GraphPad Prism to determine EC.sub.50 values for each construct when possible.
pSTAT5 and Ki67 Assays to Measure Activation of Mouse Immune Cells
[0140] Splenocytes were isolated from spleens of B6 mice by placing a spleen onto a 70 mM strainer and using a plunger to wash the cells with PBS through the strainer. Red blood cells were lysed with ACK lysis buffer and cells resuspended at 20×106/m1 of RPMI media. Cells were plated in U-bottom plates at 50 ml per well. IL-2 fusion proteins and control proteins were added to cells (50 μl as 2× stimulus). CD49b antibody (5 ml, DX5 clone) was added to each well prior to incubating the cells at 37° C. for 30 min. Cells were fixed with 8% PFA (4% final). Cells were washed 2× with PBS-2% FBS and resuspended in 75 ml Phosflow Perm buffer III buffer and incubated for 1 hr at 4° C. Cells were washed 3× with PBS-2% FBS and stained in 50 μl of FACS buffer containing antibodies against CD3 (17A2), CD4 (GK1.5), CD8α (53-6.7), CD8b (YTS156.7.7), CD25 (7D4), and pSTAT5 (clone 47). Samples were washed 2× and analyzed on a flow cytometer. For Ki67 assay, 1×105 splenocytes were plated in 96 well U-bottom plates in RPMI media supplemented with 10% FBS and cultured at 37° C. for 5 days prior to staining for Ki-67. Briefly, cells were surface stained with antibodies against CD3 (145-2C11), CD4 (GK1.4), CD8 (53-6.7), CD25 (PC61), and NK1.1 (PK136), then fixed and permeabilized using Foxp3/Transcription Factor Staining Buffer Set (Thermo Fisher Scientific) according to manufacturer's protocol. Ki67 antibody (clone 16A8) was added for 45 min at 4° C., after which the cells were washed and analyzed on a flow cytometer.
Binding Affinity Determination by Surface Plasmon Resonance (SPR) for IL-2Rα and IL-2Rβ
[0141] Kinetic rate constants (kon and koff) as well as affinity (Ku) of IL-2 fusion proteins for human and cynomolgus CD8α, CD8β and PD1 antigens, and for human IL-2Rα and IL-2Rβ were measured by surface plasmon resonance (SPR) using a BIAcore (GE Healthcare) (10 mM phosphate, 150 mM sodium chloride pH 7.4, 0.005% Tween 20) at 37° C. Briefly, to determine the affinities, IL-2 fusion proteins were captured onto the CM4 sensor chip via their Fc by a covalently immobilized anti-human Fc capture antibody at 0.75 μg/mL and a flow rate of 10 μL/min for 30s. Antibody was not captured on flow cell 1 to serve as a reference surface. Various concentrations of antigens (3-fold dilution from 1m1V1 to 1.4 nM to) or IL-2 receptors (3-fold dilution from 3 mM to 12 nM) were injected as analytes over the captured IL-2 fusion proteins. Association phase was recorded for 120s, dissociation phase for 600s. Sensorgrams were double-referenced and fit globally to the 1:1 Langmuir with mass transport model to determine the association rates (kon), dissociation rates (koff) and equilibrium dissociation constant (KD=koff/kon) using Biacore Evaluation Software.
[0142] In an alternative format of the assay antigens were first captured on the chip and IL-2 fusion proteins then injected as analytes. In this case, in-house generated or commercially purchased histidine-tagged IL-2 receptors were diluted in running buffer to 0.125 μg/mL and captured on the CM4 sensor chip amine-coupled with anti-HIS antibody for 1 minute at 10 μL/min. IL-2 receptors were not captured on flow cell 1 to serve as a reference surface. IL-2 fusion proteins from 1000 nM to 4.1 nM (3-fold dilution series) were injected over flowcell 1 and 2 for 2 min and allowed to dissociate for 1 min. Surfaces were regenerated with two 30s injections of 10 mM Glycine pH 1.7 between analysis cycles. Sensorgrams were double-referenced and fit globally to the 1:1 Langmuir to determine kon, koff, and KD using Biacore Evaluation Software.
Example 2: Ability of IL-2 and IL-2 Variants to Activate Splenic Cell Subsets
[0143] This example describes experiments to test the capacity of IL-2 fusion compounds to activate STAT5 in mouse NK cells and to induce NK-mediated toxicity in mice.
[0144] The ability of IL-2 and IL-2 variants with reduced binding to CD25/IL2Rα to activate splenic cell subsets was tested with a STAT5 assay. IL-2 and a previously published IL-2 variant (IL-2v) fused to control antibody (xHA), xHA-IL-2v, were used to stimulate mouse splenocytes containing CD8 T cells, CD4 T cells and NK cells. STAT5 activation in different splenic subsets was measured by flow cytometry, as described in Example 1. CD8 T cells were identified in the CD3+CD4− gate/subset, Treg cells were identified as CD3+CD4+CD25+, and NK cells were identified as CD3-CD49b+.
[0145]
[0146] To test for NK-cell induced toxicity, body weight loss was measured in mice treated with an IL-2 variant with reduced binding CD25/IL2Ra. NK-cell induced toxicity upon treatment with the IL-2 variants can manifest as body weight loss. For this experiment, B6 mice of 8-10 weeks of age were injected subcutaneously with a single dose of indicated compounds and their body weights recorded daily. xHA-IL-2v was dosed at 1 mg/kg or 5 mg/kg together with anti-PD1 (xPD1) at 2.5 mg/kg, while TAg-IL-2v was dosed alone at 5 mg/kg. NK cells were depleted with anti-NK1.1 antibody (PK136 clone) at 200 mg/mouse i.p. The depleting antibody was injected two days prior to TAg-IL-2v dosing and one day after dosing to maintain depletion.
[0147]
Example 3: Characterization of Anti-Mouse CD8 Antibodies
[0148] This example describes the characterization of anti-mouse CD8 antibodies.
Results
[0149] The binding affinity of anti-mouse CD8 antibodies was determined through flow cytometry analysis. Fresh splenocytes were incubated with the either xCD8ab1 (clone 2.43), xCD8ab2 (clone YTS156.7.7) or xCD8ab2.1 for 2 hours at 4° C. xCD8ab1 (clone 2.43) and xCD8ab2 (clone YTS156.7.7) sequences have been previously published. The xCD8ab2.1 clone is derived from xCD8ab2 by introduction of mutations N95A (VH) and D92A (VK). After incubation with the anti-mouse CD8 antibody, the cells were then stained with antibodies against CD3, CD4, CD8 and anti-hFc (HP6017, Biolegend), the latter of which was used to measure the binding of CD8-IL2 fusion containing hFc. Stained cells were washed and analyzed by flow cytometry and mean fluorescence intensity (MFI) of staining with anti-hFc was used to denote binding. As shown in
[0150] The MHC blocking status for anti-mouse CD8 antibodies was also tested. Binding of certain CD8 antibodies can interfere with interaction of CD8 molecules on T cells and MHC molecules on antigen presenting cells or tumor cells, thereby inhibiting T cell activation. For this experiment, CD8+ T cells were purified from splenocytes from OT-I transgenic mice and co-cultured with EL-4-OVA cancer line (ATCC), at 100,000 cells each for 24 hr. The cells were analyzed for upregulation of activation markers such as CD25 and CD69 by cell surface staining and flow cytometry. As shown in
Example 4: Characterization of IL-2 Muteins Fused to Anti-CD8 Antibodies
[0151] This example describes the characterization of IL-2 muteins fused to CD8 antibodies.
Methods
B16 Mouse Tumor Model
[0152] C57BL6 female mice (Jackson Labs) at 8-10 weeks of age were housed and acclimated at the vivarium facility. Cultured B16.F10 cells (ATCC, CRL-6475) were harvested and resuspended in serum free media (1×DMEM, Sigma D6429) at 5×106 cells/mL for implantation. Mice were shaved and 5×10{circumflex over ( )}5 cells (100 μL) are implanted subcutaneously above rear hind leg. Tumors were measured until tumor volume of 60-120 mm3 was reached at approximately 8 days post implantation (TV=width*width*length*0.5). Mice were then randomized into groups by tumor volume. Each mouse was weighed and dosed subcutaneously under the scruff of the neck. Tumor volumes and body weights were measured every 3-4 days until either end of study (30-40 days post initial dose) or max tumor volume (2000 mm.sup.3) was reached. At end of study mice were euthanized by CO2 with appropriate secondary euthanasia.
CT26 Mouse Tumor Model
[0153] BALB/c female mice were shaved, and 2×10.sup.5 cells (100 μL) of cultured CT26 wt cells (ATCC, CRL-2638) were implanted subcutaneously above the rear hind leg. Tumor volume was measured until it reached 60-120 mm.sup.3 was reached at approximately 8 days post implantation (TV=width*width*length*0.5). Each mouse was then weighed and dosed subcutaneously with the indicated compound (9 mice per group).
Analysis of CD8+ T Cells in Blood and Tumor of Mice with B16 Tumor
[0154] B6 mice were injected with B16 tumor cells and tumors allowed to grow to 200-250 mm.sup.3 before they were dosed with indicated IL-2 fusions at 1 mg/kg. Tumors were removed day 5 post dose, digested to single cells and profiled by flow cytometry to detect CD8+ T cells and NK cells (NK1.1+CD3-). Briefly, tumors were digested using Mouse Tumor Dissociation Kit (Miltenyi Biotec, 130-096-730) in Miltenyi Gentle MACS C tubes according to manufacturer's protocol. Isolated cells were counted and 10×10.sup.6 cells were stained with antibodies against CD45, CD3, CD4, CD8, CD25, and CD49b. Blood was also collected from mice (50 μl), lysed with ACK lysis buffer, washed with wash buffer (PBS/0.5% BSA/2 mM EDTA) and stained with lineage markers to identify CD8+ T cells and NK cells. Cell were analyzed on a flow cytometer.
Results
[0155] IL-2 mutein variants fused to CD8 antibodies were tested for selective targeting of CD8+ T cells over other immune cells expressing IL-2R. IL-2 muteins were fused to a previously published anti-mouse CD8 antibody, xmCD8ab1 (2.43 clone) in a B format. Mouse splenocytes were treated with the IL-2 mutein fusions and a STAT5 assay was performed as described in Example 1. Table 1 and
[0156] IL-2 muteins fused to CD8 antibody in format B selectively targeted CD8+ T cells over other cells that express IL-2R, including NK cells. Activity on Tregs was used as a proxy for IL-2Rα/CD25 binding, since Tregs express CD25 while other cells do not. Other sequences also preferentially targeted CD8 T cells over NK cells but had increased activity on Tregs as a result of higher CD25 binding. Given that activity of IL-2 in this assay is <0.001 nM (panel A of
TABLE-US-00002 TABLE 1 Identification of IL-2 muteins fused to CD8 antibodies with lowest selective activity on Tregs and highest activity on CD8 T cells, as measured by STAT5 assay (% pSTAT5+). IL-2 mutein fused to CD8 STAT5 assay (% pSTAT5+) antibody xmCD8ab1 (format B) EC.sub.50 EC.sub.50 EC.sub.50 EC.sub.50 IL-2 mutein Mutations (CD8) (NK) (Tconv) (Treg) IL-2m1 F42A 0.0047 7.08 36.7 0.308 IL-2m2 R38A, F42A 0.0046 6.93 71.6 0.979 IL-2m3 R38D, F42A 0.0071 6.55 133.3 7.78 IL-2m4 R38E, F42A 0.0142 7.69 244 9.11 IL-2m5 F42A, E62Q 0.0030 6.42 139.3 6.41 IL-2m6 F42A, E68A 0.0092 7.71 29.9 0.246 IL-2m7 F42A, E68Q 0.0093 5.81 28.7 0.195 IL-2m8 F42A, E68K 0.0095 9.23 57.1 0.677 IL-2m9 F42A, E68R 0.0064 5.38 72.1 0.894 IL-2m10 R38A, F42K 0.0146 12.8 1399 9.93
[0157] The efficacy of the CD8-IL-2 and TAg-IL-2v in combination with anti-PD1 was tested in a B16 tumor model. IL-2m10 mutein fused to one of 2 different CD8 antibodies, xmCD8ab1 (2.43 clone) and xmCD8ab2 (YTS1567.7 clone) in format C, were dosed as indicated in mice implanted with B16 tumors. As shown in
[0158] An effect on CD8+ T cell accumulation in the blood and tumor upon treatment with CD8-IL-2 fusions was tested using a B16 tumor model. IL-2 fusions at 1 mg/kg together with 5 mg/kg of xPD1 were dosed into mice implanted with B16 tumor cells. Levels of CD8+ T cells were measured in both tumors and blood samples by flow cytometry. As shown in
[0159] To compare the performance of CD8-IL-2 and TAg-IL-2v, tumor regression was assessed in mice implanted with CT26 tumor cells were treated with either CD8-IL-2 alone or TAg-IL-2v alone. As shown in
[0160] The impact of CD8 antibody affinity on potency was tested for the fusion with IL-2m4. For this experiment, IL-2 mutein IL-2m4 was fused to either xmCD8ab2 or xmCD8ab2.1 in format C. xmCD8ab2.1 is a lower affinity version of xmCD8ab2. A STAT5 assay on mouse splenocytes was performed as described in Example 1. As shown in
[0161] The xmCD8ab2-IL2m4 and xmCD8ab2.1-IL2m4 were also tested for their ability to expand CD8+ T cells in vivo. Blood was collected from naïve B6 mice treated with the indicated compounds at 1 mg/kg. Levels of NK cells and CD8+ T cells were determined by flow cytometry. As shown in
Example 5: Characterization of Anti-CD8:IL-2 Mutein Fusion Proteins with Decreased Binding to IL-2Rβ and IL-2Rγ
[0162] This example describes the characterization of xmCD8-IL-2 muteins with decreased binding to IL-2Rβ/γ.
Methods
STAT5 Assay
[0163] Splenocytes from B6 mice bearing B16 tumors were incubated with indicated protein for 30 min in RPMI media together with anti-CD49b staining antibody after which cells were stained for cell surface markers (CD3, CD4, CD8, CD25) and for intracellular STAT5, according to the protocol in Example 1. Data was represented as mean fluorescence intensity (MFI) for STAT5 in indicated cell subsets.
Ki67 Assay
[0164] Splenocytes from B6 mice bearing B16 tumors were incubated with indicated protein for 5 days in complete RPMI media after which cells were stained for cell surface markers (CD3, CD4, CD8, CD25, NK1.1) and for intracellular marker of proliferation, Ki67, a downstream signaling event from IL-2Rβ/γ and STAT5 according to the protocol in Example 1.
[0165] Results
[0166] Given that active doses of xmCD8ab2-IL2m4 induced detectable NK cell expansion, additional mutations in IL2m4 were introduced in order to further decrease its activity on IL2R+ cells, including NK cells. Mutations were selected that were at the interaction surface of IL-2Rβ/γ with IL-2 (predicted to reduce binding to IL-2Rbg). IL-2 muteins with selected mutations that disrupted binding to IL-2R were fused to xmCD8ab2 antibody in format C and tested in STAT5 assay on mouse splenocytes. Table 2 and
TABLE-US-00003 TABLE 2 STAT5 assay of IL-2 mutein sequences fused to higher affinity CD8 antibodies. IL-2 mutein fused to CD8 antibody xmCD8ab2 (format C) STAT5 assay (MFI STAT5) IL-2 EC.sub.50 EC.sub.50 mutein Mutations (CD8) (NK) IL-2m4 R38E, F42A 0.0184 86.7 IL-2m4.1 R38E, F42A, I92A 0.0648 >100 IL-2m4.2 R38E, F42A, V91T 0.216 >100 IL-2m4.3 R38E, F42A, N88T 0.388 >100 IL-2m4.4 R38E, F42A, N88S n.d n.d IL-2m4.5 R38E, F42A, N88A n.d n.d IL-2m4.6 R38E, F42A, V91E 1.076 >100 IL-2m4.7 R38E, F42A, Q126S 0.558 >100 IL-2m4.8 R38E, F42A, Q126E 3.94 >100
[0167] Fusions between IL-2 muteins with selected mutations and the xmCD8ab2.1 antibody in format C were also made and tested in STAT5 assay on mouse splenocytes. Table 3 and
TABLE-US-00004 TABLE 3 STAT5 assay of sequences of IL-2 muteins fused to lower affinity CD8 antibodies. IL-2 mutein fused to CD8 antibody xmCD8ab2 (foraat C) STAT5 assay (MFI STAT5) IL-2 EC.sub.50 EC.sub.50 mutein Mutations (CD8) (NK) IL-2m4 R38E, F42A n.d. n.d. IL-2m4.1 R38E, F42A, I92A 12.4 105.8 IL-2m4.2 R38E, F42A, V91T 35.9 >100 IL-2m4.3 R38E, F42A, N88T n.d. n.d. IL-2m4.4 R38E, F42A, N88S n.d n.d IL-2m4.5 R38E, F42A, N88A n.d n.d IL-2m4.6 R38E, F42A, V91E 320.4 >100 IL-2m4.7 R38E, F42A, Q126S 210.5 >100 IL-2m4.8 R38E, F42A, Q126E n.d. n.d.
[0168] The IL-2 muteins with selected mutations were fused to xmCD8ab2 antibody in format C and tested in Ki67 assay on mouse splenocytes. Ki67 is an intracellular marker of proliferation and represents a downstream signaling event of IL-2Rβ/γ and STAT5. Table 4 and
TABLE-US-00005 TABLE 4 Ki67 assay for sequences of IL-2 muteins fused to xmCD8ab2 anti-CD8 antibody. IL-2 mutein fused to CD8 antibody Ki67 assay (% positive) xmCD8ab2 (format C) EC.sub.50 EC.sub.50 IL-2 mutein Mutations (CD8) (NK) IL-2m4 R38E, F42A >0.01 25.1 IL-2m4.1 R38E, F42A, I92A n.d. n.d. IL-2m4.2 R38E, F42A, V91T 0.0199 >100 IL-2m4.3 R38E, F42A, N88T 0.0414 >100 IL-2m4.4 R38E, F42A, N88S 0.0197 >100 IL-2m4.5 R38E, F42A, N88A 0.117 >100 IL-2m4.6 R38E, F42A, V91E 0.159 >100 IL-2m4.7 R38E, F42A, Q126S 0.245 >100 IL-2m4.8 R38E, F42A, Q126E n.d. n.d. TAg-IL-2v F42A, Y45A, L72G* 43.1 4.11 *IL-2v was fused to TAg antibody in format B
[0169] IL-2 muteins with selected mutations listed in the table below were fused to xmCD8ab2.1 antibody in format C and tested in Ki67 assay on mouse splenocytes. Table 5 and
TABLE-US-00006 TABLE 5 Ki67 assay of preferred sequences of IL-2 muteins fused to xmCD8ab2.1 anti-CD8 antibody. IL-2 mutein fused to CD8 antibody Ki67 assay (% positive) xmCD8ab2.1 (format C) EC.sub.50 EC.sub.50 IL-2 mutein Mutations (CD8) (NK) IL-2m4 R38E, F42A 0.15 23.5 IL-2m4.1 R38E, F42A, I92A 2.28 47.3 IL-2m4.2 R38E, F42A, V91T 8.88 >100 IL-2m4.3 R38E, F42A, N88T n.d n.d IL-2m4.4 R38E, F42A, N88S n.d n.d IL-2m4.5 R38E, F42A, N88A n.d n.d IL-2m4.6 R38E, F42A, V91E 23.7 >100 IL-2m4.7 R38E, F42A, Q126S n.d n.d IL-2m4.8 R38E, F42A, Q126E n.d n.d
[0170] The potencies on CD8 T cells and NK cells for representative molecules are summarized in
Example 6: Testing Effects of CD8:IL2 Fusion Proteins in Combination with Anti-PD-1 in a B16 Tumor Model
Results
[0171] Four representative CD8-IL2 fusions with varying degrees of selectivity for CD8 T cells over NK cells were tested in the B16 tumor model as described in Example 4. All mice were dosed with 1 mg/kg of the indicated fusions together with 5 mg/kg of anti-PD1. As shown in
[0172] The performance of CD8-IL-2 was further tested by analyzing the expansion of tumor-antigen specific T cells upon treatment. B6 mice were injected with B16 tumor cells and tumors allowed to grow to 200-250 mm.sup.3 before they were dosed with indicated IL-2 fusions at 1 mg/kg together with 5 mg/kg of xPD1. Tumors were removed day 5 post dose, digested to single cells and profiled by flow cytometry to detect CD8+ T cells and NK cells (NK1.1+CD3−). Cells were also stained with p15E tetramer (TB-M507-2, MBL) according to manufacturer's protocol to detect T cells that recognize p15E tumor antigen. As shown in
[0173] A STAT5 assay was performed to compare the potency of a bivalent low affinity fusion and a high affinity monovalent fusion. Splenocytes from B6 mice bearing B16 tumors were incubated with a fusion protein for 30 min in RPMI media after which cells were stained for cell surface markers (CD3, CD4, CD8, CD25) and for intracellular STAT5, according to the protocol in Example 1. As shown in
[0174] To further test the affinity of a bivalent C-terminal format (format A), bivalent xmCD8ab2.1 antibody (in format A) was tested in the B16 tumor model as described in Example 4. Mice were dosed with PBS as control or 1 mg/kg of the indicated fusion together with 5 mg/kg of anti-PD1 (9 mice per group). As shown in
[0175] Blocking of CD8 T cell activation by CD8 antibodies was also tested. CD8+ T cells were purified from splenocytes from OT-I mice and co-cultured with EL-4-OVA line (ATCC), at 100,000 cells each for 24 hr. Cells were analyzed for upregulation of activation markers such as CD25 and CD69 by cell surface staining and flow cytometry as described in Example 3. As shown in
[0176] Blocking of CD8 T cell activation by CD8 antibodies was also tested. CD8+ T cells were purified from splenocytes from OT-I mice and co-cultured with EL-4-OVA line (ATCC), at 100,000 cells each for 24 hr. Cells were analyzed for upregulation of activation markers such as CD25 and CD69 by cell surface staining and flow cytometry as described in Example 3. As shown in
[0177] To compare the in vivo potency of the xmCD8ab2 and xmCD8ab3 fusions, splenocytes from B6 mice bearing B16 tumors were incubated with indicated protein for 30 min in RPMI media after which cells were stained for cell surface markers (CD3, CD4, CD8, CD25, NK1.1) and for intracellular STAT5, according to the protocol in Example 1. As shown in
[0178] IL-2m4.2 fused to MHC non-blocking antibodies were also tested in a B16 tumor model as described in Example 4. Mice were dosed with PBS, 0.3 mg/kg (
[0179] Preferential targeting of targeting of PD1+ T cells, both CD8+ and Treg by fusions of IL-2 muteins was also tested. B16 tumors 300-600 mm.sup.3 in size were removed from mice and digested to single cells. CD45+ cells were purified (Miltenyi's LS columns according to manufacturer's protocol) and stimulated with indicated fusion proteins for 30 min. Cells were stained for cell surface markers (CD3, CD4, CD8, CD25, CD49b, and PD1) and for intracellular phospho-STAT5. As shown in
Example 7: Impact of IL-2 Mutations on Activity and Selectivity of CD8-IL-2 Fusions in hPBMCs
[0180] This example describes the impact of IL-2 mutations on the activity and selectivity of CD8-IL-2 fusions in hPBMCs.
Results
[0181] To characterize the impact of IL-2 mutations on the activity of CD8-IL-2 fusions in hPBMCs, indicated IL-2 muteins were fused to xmCD8ab1 antibody and tested in STAT5 assay on hPBMCs. The xmCD8ab1 antibody does not recognize human CD8. The obtained data was used to rank each mutation according to its effect on STAT5 activity. Tables 6, 7 and 8 summarize the results of this experiment. Tregs are shown as representative examples of cells expressing IL-2Rγγ.
[0182] Table 6 depicts activity of IL-2 muteins IL-2 m1 to IL-2m10 fused to xmCD8ab1 on human Tregs as it compares to IL-2v fused to control xHA antibody, all in format B. Table 6 shows that IL-2 muteins IL-2 m1 to IL-2m10 fused to xmCD8ab1 all had significantly reduced activity on Tregs, thereby significantly reduced binding to IL-2Rα, compared to wild-type IL-2, and comparable to IL-2v which has no binding to IL-2Rα(Klein et al, Oncoimmunol. 2017; 6 (3); e1277306).
TABLE-US-00007 TABLE 6 Impact of IL-2 mutations on activity in hPBMCs xmCD8ab1 fusion (format B) % STAT5+ in human Tregs IL-2 mutein Mutation 100 nM 10 nM 1 nM 0.1 nM EC50 IL-2m1 F42A 93.3 90.6 87.7 44.4 <0.1 IL-2m2 R38A, F42A 91.9 91.3 66.1 15 0.37 IL-2m3 R38D, F42A 76 85.7 45 4.24 0.66 IL-2m4 R38E, F42A 89.4 84.6 34.8 6.02 1.54 IL-2m5 F42A, E62Q 87.4 85.5 41.4 6.46 1.09 IL-2m6 F42A, E68A 87 80.3 55.4 12.2 0.56 IL-2m7 F42A, E68Q 84.3 85.3 83 58.4 <0.1 IL-2m8 F42A, E68K 73.4 75.9 27.2 13 1.95 IL-2m9 F42A, E68R 89.3 75 28.1 8.64 2.64 IL-2m10 R38A, F42K 94.1 88.1 39.1 3.11 1.28 IL-2v* F42A, Y45A, 92.8 84.8 28.9 8.77 2.27 L72G *IL-2v was fused to control xHA antibody.
[0183] Table 7 depicts the activity of IL-2 muteins IL-2m10.1 to IL-2m10.11 fused to xmCD8ab1 on human Tregs as compared to IL-2m10 fused to xmCD8ab1, all in format B. Table 7 shows that IL-2m10.1 to IL-2m10.11 fused to xmCD8ab1 all have significantly reduced activity on Tregs compared to IL-2m10. IL-2m10 has reduced to no activity on IL2Ra, therefore additional mutations present in IL-2m10.1 to IL-2m10.11 reduced activity of the molecules by decreasing the binding to IL-2Rγγ.
TABLE-US-00008 TABLE 7 Impact of IL-2 mutations on activity of CD8-IL-2 fusions in hPBMCs xmCD8ab1 fusion (format B) Added % STAT5+ in human Tregs IL-2 mutein mutation 100 nM 10 nM 1 nM 0.1 nM EC50 IL-2m10 — 94.1 88.1 39.1 3.11 1.28 IL-2m10.1 T123A 91.3 59.4 7.56 7.95 7.72 IL-2m10.2 T123E 92.5 82.6 20.8 8.28 2.97 IL-2m10.3 T123K 92.1 64.6 10.3 6.88 6.11 IL-2m10.4 T123Q 85.1 68.2 22.2 10.6 3.80 IL-2m10.5 S127A 90.1 79.7 18.8 11.1 3.37 IL-2m10.6 S127E 91.3 71.3 17.6 10.2 4.52 IL-2m10.7 S127K 87.3 70/9 19.8 12.7 4.16 IL-2m10.8 S127Q 85.3 76.2 19.6 10.7 3.18 IL-2m10.9 Q126S 85.8 27.6 3.61 4.25 35.2 IL-2m10.10 Q126T 76.8 24.3 3.21 5.7 39.7 IL-2m10.11 Q126E 43.5 17.1 13.1 8.12 64.7
[0184] Table 8 depicts the activity of IL-2 muteins IL-2m4.1 to IL-2m4.6 and IL-2m4.9 to IL-2m4.24 fused to xmCD8ab1 on human Tregs as compared to IL-2m4 fused to xmCD8ab1, all in format B. IL-2m4 has reduced to no activity on IL2Rα, therefore additional mutations present in the IL-2 mutein fusion proteins shown in Table 8 reduced activity of the molecules by decreasing the binding to IL-2Rγγ. Decrease in activity on Tregs and therefore in binding to IL-2Rbg was observed for all of the IL-2 mutein fusions except for IL-2m4.9, IL-2m4.10, IL-2m4.12, and IL-2m4.16.
TABLE-US-00009 TABLE 8 Impact of IL-2 mutations on activity of CD8-IL-2 fusions in hPBMCs xmCD8ab1 fusion (format C) Added % STAT5+ in human Tregs IL-2 mutein mutation 300 nM 30 nM 3 nM 0.3 nM EC50 IL-2m4* — 94.8 78.3 24.8 4.57 2.822 IL-2m4.9 E15A 94.3 83.1 52.9 11.2 2.396 IL-2m4.10 R81E 94.1 94.6 73.7 47.4 1.899 IL-2m4.11 E95S 93.2 77.4 22.3 8.52 10.05 IL-2m4.12 R81Q 92.7 90.2 53.4 26.7 3.652 IL-2m4.13 E95A 92.5 79.5 25 6.99 8.21 IL-2m4.14 M23A 90 n.d. 18.2 3.63 13.76 IL-2m4.15 S87A 90 75.2 26 3.54 7.338 IL-2m4.16 E15Q 87.5 85.6 47.9 15.3 3.026 IL-2m4.17 V91A 83.3 59.9 11 6.33 16.88 IL-2m4.2 V91T 81.4 36.2 6.98 4.29 54.24 IL-2m4.1 I92A 77.1 33.7 6.7 4.92 58.04 IL-2m4.6 V91E 60.6 13.8 7.48 2.5 ~150 IL-2m4.18 E95R 58.7 13.7 3.22 3.47 ~150 IL-2m4.4 N88S 29.1 9.33 4.15 5.34 >250 IL-2m4.19 H16E 21.4 2.76 2.62 2.43 >250 IL-2m4.5 N88A 18.4 2.62 4.55 3.37 >250 IL-2m4.20 H16D 15.3 3.72 2.4 3.27 >250 IL-2m4.3 N88T 4.07 1.98 2.55 3.65 >1000 IL-2m4.21 D20N 4.0 3.8 4.48 3.14 >1000 IL-2m4.22 N88R 2.65 3 3.44 2.75 >1000 IL-2m4.23 N88I 2.38 2.17 3.24 3.82 >1000 IL-2m4.24 N88E 1.79 3.04 1.64 4.93 >1000
[0185] The selective stimulation of human CD8+ T cells by the CD8-IL-2 mutein fusions was also tested. Indicated IL-2 muteins were fused to previously published anti-human CD8 antibody clone OKT8 (xhCD8ab) in format C and tested in STAT5 assay on hPBMCs. Tables 9 and 10 summarize the results of this experiment. CD8-IL2 mutein fusions selectively and potently stimulated human CD8 T cells. IL-2m4 had reduced to no activity on IL2Ra, therefore additional mutations present in the IL-2 mutein fusion proteins shown in Table 9 reduced activity of the molecules by decreasing the binding to IL-2Rbg. Decrease in activity on Tregs and therefore in binding to IL-2Rbg was observed for all of the IL-2 mutein fusions except for IL-2m4.26, IL-2m4.27, IL-2m4.28 and IL-2m4.29.
[0186] Certain mutations were not useful because they resulted in very weak CD8 T cell activation (i.e. IL-2 mutein containing N88E mutation only very weakly activated CD8 T cells in the context of the fusion with xhCD8ab while N88A/S/T generated CD8-IL2 molecules with potent activity on CD8 T cells).
TABLE-US-00010 TABLE 9 Stimulation of human Tregs by CD8-IL-2 molecules. xhCD8ab fusion (format C) % STAT5+ in human Tregs IL-2 mutein Mut. 100 nM 10 nM 1 nM 0.1 nM 0.01 nM EC50 IL-2m4.26 E15R 96.4 98.1 83.2 22.4 4.25 0.262 IL-2m4.27 E15K 98 97.8 59 9.76 4.69 0.748 IL-2m4.28 M23E 97.6 93.3 53.4 6.73 1.85 0.866 IL-2m4.29 M23Q 96.9 93.2 50.2 7.21 7.77 1.083 IL-2m4.30 M23R 96.5 63.6 16.9 6.5 2.32 6.438 IL-2m4.31 D87K 94.2 63.4 13.3 4.18 3.35 6.376 IL-2m4.32 M23K 99 63.1 17.2 3.81 2.67 6.844 IL-2m4.33 D84L 93.2 36.5 6.02 2.79 3.39 22.96 IL-2m4.34 D84N 92 32.7 11.1 3.5 1.9 28.44 IL-2m4.35 D84V 91.4 32.4 6.12 5.71 6.96 32.63 IL-2m4.6 V91E 84 24.6 7.29 5.79 3.95 49.83 IL-2m4.36 D84H 82.9 17.9 5.75 9.15 6.37 196.9 IL-2m4.37 D84Y 78.6 18.1 4.51 3.12 5.93 93.42 IL-2m4.38 Q126S 79.8 33.1 15.8 9.04 7.54 26.71 IL-2m4.39 Q126E 41.7 8.68 6.38 3.59 2.81 >250 IL-2m4.4 N88S 37.9 11.6 6.51 7.69 8.24 >250 IL-2m4.5 N88A 35.7 8.61 3.86 3.7 10.9 >250 IL-2m4.20 H16D 30.7 6.99 4.7 1.94 4.21 >250 IL-2m4.19 H16E 31 5.23 1.6 4.04 2.39 >250 IL-2m4.40 D84R 17.9 3.72 2.14 2.58 6.54 >1000 IL-2m4.21 N88T 9.52 7.42 4.84 7.79 3.57 >1000 IL-2m4.41 D84K 10.7 3.16 5.65 2.81 2.5 >1000 IL-2m4.23 N88R 6.65 4.12 4.38 4.85 3.34 >1000 IL-2m4.25 N88E 3.41 3.32 2.55 3.36 1.84 >1000
TABLE-US-00011 TABLE 10 Stimulation of human CD8+ T cells by CD8-IL-2 molecules. xhCD8ab fusion (format C) % STAT5 in human CD8+ T cells IL-2 mutein Mut. 100 nM 10 nM 1 nM 0.1 nM 0.01 nM EC50 IL-2m4.26 E15R 93.8 92.4 88.2 79.7 73.2 <0.01 IL-2m4.27 E15K 94 90.6 81.2 76.4 72.6 <0.01 IL-2m4.28 M23E 95.4 91.7 82.2 76.5 70.5 <0.01 IL-2m4.29 M23Q 93.5 89.2 76.9 71.6 67.2 <0.01 IL-2m4.30 M23R 91.1 80.6 76.1 74.1 65.3 <0.01 IL-2m4.31 D87K 90.5 79.7 72.4 72.5 62.2 <0.01 IL-2m4.32 M23K 92.1 84.1 77.1 74.3 59.2 <0.01 IL-2m4.33 D84L 89.6 78.3 76 73.3 48.9 0.027 IL-2m4.34 D84N 87.8 76.9 73.6 75 44.2 0.007 IL-2m4.35 D84V 88.5 78.7 75.3 72.5 42.4 0.020 IL-2m4.6 V91E 85.7 79.2 75.7 71.9 49 0.029 IL-2m4.36 D84H 84.9 76.4 76 69.9 34.4 0.016 IL-2m4.37 D84Y 85.1 78.1 75.4 70.4 29 0.012 IL-2m4.38 Q126S 84.8 80.5 78.8 68 33.1 0.027 IL-2m4.4 N88S 80.3 75.6 77.4 56.3 18.1 0.042 IL-2m4.39 Q126E 70.6 71 67.3 40 6.03 0.072 IL-2m4.5 N88A 77.1 75.7 71.3 48.1 18.4 0.077 IL-2m4.20 H16D 76.4 76.5 71.9 50.3 8.04 0.046 IL-2m4.19 H16E 71.8 75.9 72.3 38.7 4.3 0.080 IL-2m4.40 D84R 76.1 74 67.2 35.7 7.37 0.118 IL-2m4.21 N88T 75.5 74.8 64.5 18.5 4.13 0.259 IL-2m4.41 D84K 74.9 76.8 64.7 23.3 3.46 0.213 IL-2m4.23 N88R 68.2 61.1 21.2 6.95 5.68 2.54 IL-2m4.25 N88E 12.1 6.78 3.83 3.75 3.37 >100
[0187] Tables 11 and Table 12 depict the activity of IL-2m10.12 mutein containing Q126A mutation in the context of the fusion to either control antibody (xHA) or xhCD8ab antibody. This mutation in the context of CD8-IL2 fusion decreased the activity of the CD8-IL2 fusion on human Tregs compared to that containing the IL-2m10 mutein (Tables 6 and 7) but enabled potent and selective activation of CD8+ T cells.
TABLE-US-00012 TABLE 11 Fusion (format B) Added % STAT5+ in human Tregs Antibody IL-2 mutein mutation 100 nM 10 nM 1 nM 0.1 nM EC50 xHA IL-2m10.12 Q126A 77.7 21.8 4.88 5.38 55.1 xhCD8ab IL-2m10.12 Q126A 66.6 19.9 8.39 6.46 60.8
TABLE-US-00013 TABLE 12 Fusion (format B) Added % STAT5+ in human CD8+ T cells Antibody IL-2 mutein mutation 100 nM 10 nM 1 nM 0.1 nM EC50 xHA IL-2m10.12 Q126A 19.4 0.79 0.60 0.67 >100 xhCD8ab IL-2m10.12 Q126A 68.1 69.1 68.2 55.9 <0.1