MOUSE MONOCLONAL ANTIBODIES AGAINST GALACTOSE-DEFICIENT IGA1,PREPARATION METHOD THEREOF, AND USE THEREOF
20220275106 · 2022-09-01
Inventors
Cpc classification
C07K2317/41
CHEMISTRY; METALLURGY
G01N2800/347
PHYSICS
C07K16/44
CHEMISTRY; METALLURGY
C07K16/4283
CHEMISTRY; METALLURGY
International classification
Abstract
The current invention provides high specificity mouse monoclonal antibodies, which can specifically bind to Gd-IgA as a novel non-invasive method for rapid diagnosing of IgAN subjects, can be applied to unravel the mechanisms of IgA nephropathy and establish therapeutical strategies.
Claims
1. A kit for unraveling the mechanisms of IgA nephropathy and establishing therapeutical strategies, comprising an antibody.
2. A kit according to claim 1, wherein the antibody is acquired from using a human Gd-IgA1 protein system.
3. A kit according to claim 2, wherein the 6.sup.th to 11.sup.th amino acids counted from the N-terminal of the antibody are QSGPEL, wherein the 19.sup.th to 27.sup.th amino acids counted from the N-terminal of the antibody are KISCKASGY.
4. A kit according to claim 3, wherein the antibody is select from NDMC-ASK1 (SEQ ID NO: 1), NDMC-ASK2 (SEQ ID NO: 2), and NDMC-ASK3 (SEQ ID NO: 3).
5. A method for detecting galactose-deficient IgA1 in a subject, comprising: (a) obtaining a biological sample from a subject; and (b) using an antibody in an immunoassay to detect a galactose-deficient glycopeptide of IgA1 in the subject.
6. A method according to claim 5, wherein the 6.sup.th to 11.sup.th amino acids counted from the N-terminal of the antibody are QSGPEL, wherein the 19.sup.th to 27.sup.th amino acids counted from the N-terminal of the antibody are KISCKASGY.
7. A method according to claim 6, wherein the antibody is select from NDMC-ASK1 (SEQ ID NO: 1), NDMC-ASK2 (SEQ ID NO: 2), and NDMC-ASK3 (SEQ ID NO: 3).
8. A method according to claim 7, wherein the biological sample is selected from plasma, serum, or blood; wherein the subject is selected from IgA nephropathy (IgAN) subjects, lupus nephritis (LN) subjects, and healthy subjects.
9. A method of diagnosing IgA nephropathy in a subject, comprising: (a) using an antibody in an immunoassay; and (b) determining whether the antibody binds to a galactose-deficient glycopeptides of IgA1, binding of the antibody to the galactose-deficient glycopeptide of IgA1 indicating the subject has or is at risk of developing IgA nephropathy.
10. A method according to claim 9, wherein the 6.sup.th to 11.sup.th amino acids counted from the N-terminal of the antibody are QSGPEL, wherein the 19.sup.th to 27.sup.th amino acids counted from the N-terminal of the antibody are KISCKASGY.
11. A method according to claim 10, wherein the antibody is select from NDMC-ASK1 (SEQ ID NO: 1), NDMC-ASK2 (SEQ ID NO: 2), and NDMC-ASK3 (SEQ ID NO: 3).
12. A method according to claim 11, wherein the biological sample is selected from plasma, serum, or blood.
13. A method for monitoring a subject undergoing a treatment or therapy for an immune response to determine whether the subject is responsive to the treatment or therapy comprising detecting a level of expression, activity and/or function of a biomarker or a biomarker in the absence of the treatment or therapy and comparing the level of expression, activity and/or function of a biomarker in the presence of the treatment or therapy, wherein a difference in the level of expression, activity and/or function of the biomarker in the presence of the treatment or therapy indicates whether the patient is responsive to the treatment or therapy, wherein the biomaker is a galactose-deficient glycopeptide on hinge region of IgA1 and wherein the biomaker is specific for an antibody.
14. A method according to claim 13, wherein the 6.sup.th to 11.sup.th amino acids counted from the N-terminal of the antibody are QSGPEL, wherein the 19.sup.th to 27.sup.th amino acids counted from the N-terminal of the antibody are KISCKASGY.
15. A method according to claim 14, wherein the galactose-deficient glycopeptide is select from Thr225, Thr228, Ser230, Ser232, Thr233, Thr236, or All-GalNAc motif.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0014] The foregoing summary, as well as the following detailed description of the invention, will be better understood when reading in conjunction with the appended drawings.
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
DETAILED DESCRIPTION OF THE INVENTION
[0024] While preferred embodiments of the invention are shown and described herein, such embodiments are provided by way of example only and are not intended to limit the scope of the invention otherwise. Various alternatives to the described embodiments of the invention may be employed in practicing the invention.
[0025] Unless otherwise defined, all technical terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs.
[0026] The term “O-linked sugar chain” means a structure in which a sugar chain is bound via an —OH group contained in each amino acid side chain of an amino acid residue of serine (Ser) or threonine (Thr) of a protein. Specific examples of the O-linked sugar chain include T antigen (TF antigen), sialyl T antigen, Tn antigen, sialyl-Tn antigen, and the like.
[0027] Examples of the amino acid residue of a polypeptide to which an O-linked sugar chain is bound include an amino acid residue of serine (Ser) or threonine (Thr) in an amino acid sequence of the hinge region of the IgA1 heavy chain polypeptide.
[0028] In the present invention, as the amino acid residue of the hinge region polypeptide to which the O-linked sugar chain on the IgA1 heavy chain polypeptide is bound, any of Ser or Thr residues in the amino acid sequence of the hinge region of IgA1 heavy chain polypeptide is available. Examples of these preferably include a sugar chain binding site comprising at least one amino acid residue selected from the group consisting of threonine at position 225, threonine at position 228, serine at position 230, serine at position 232 and threonine at position 236, in the amino acid sequence of human IgA1 heavy chain polypeptide.
[0029] The monoclonal antibody of the present invention has a binding activity to the sugar chain-deficient IgA1. The monoclonal antibody of the present invention includes, not limited, an antibody produced by a hybridoma. The anti-sugar chain-deficient IgA1 antibody can be obtained by culturing the hybridoma or administering the hybridoma cell into an animal to cause ascites tumor in the animal and separating and purifying the culture or the ascites.
[0030] The animal immunized with an antigen may be any animal, so long as a hybridoma can be prepared, and mouse, rat, hamster, rabbit or the like is suitably used.
[0031] The monoclonal antibody is an antibody secreted by a single clone of antibody-producing cells, and recognizes only one epitope (also called antigen determinant) and has the uniformity in amino acid sequence (primary structure).
[0032] Examples of the epitope include a single amino acid sequence, a three-dimensional structure consisting of an amino acid sequence, an amino acid sequence having a sugar chain bound thereto, a three-dimensional structure consisting of an amino acid sequence having a sugar chain bound thereto, and the like, which a monoclonal antibody recognizes and binds to. Examples of the epitope of the monoclonal antibody of the present invention include a three-dimensional structure of the sugar chain-deficient IgA1 protein.
[0033] Examples of the monoclonal antibody of the present invention include any monoclonal antibody, so long as it recognizes and also binds to the heavy chain hinge region of the sugar chain-deficient IgA1. Specific examples of the monoclonal antibody include monoclonal antibodies 5-2E4E4, 8-E8, 9-E2, 10-D10, 1H5E2, 1H5E7, 1H5F11, and the like.
[0034] More specifically, examples of the monoclonal antibody of the present invention include a monoclonal antibody 5-2E4E4 produced by hybridoma 5-2E4E4, a monoclonal antibody which competes with the monoclonal antibody 5-2E4E4 in the binding to the heavy chain hinge region of the sugar chain-deficient IgA1, and a monoclonal antibody that binds to an epitope present in the hinge region of the sugar chain-deficient IgA1 heavy chain to which the monoclonal antibody 5-2E4E4 binds.
[0035] Examples of the monoclonal antibody which competes with the monoclonal antibody of the present invention include, specifically, a monoclonal antibody which has a competitive reaction for a variety of monoclonal antibodies and the epitope present in the heavy chain hinge region of the sugar chain-deficient IgA1, as described above.
[0036] Optionally, in an exemplary embodiment of the present invention, the monoclonal antibodies of the present invention includes, but is not limited to, NDMC-ASK1 (SEQ ID NO:1), NDMC-ASK2 (SEQ ID NO:2), and NDMC-ASK3(SEQ ID NO:3).
[0037] Sequences that can be employed in accordance with the invention are shown herein below:
TABLE-US-00001 SEQ ID NO: 1 (NDMC-ASK1): EVQLQQSGPELVKPGASMKISCKASGYSFTGYTMNWVKQSRGKNLEWIG LINPYNGVTSYNQKFKGKATLTVDKSSITAYMEFLSLTSEDSAVYYCAR SGYGNYALAYWGQGTLVTVSA SEQ ID NO: 2 (NDMC-ASK2): QIQLVQSGPELKKPGETVKISCKASGYTFTNCGMNWVRQAPGKGLKWMG WINTYTGKPTYADDFKGRFAFSLETSASTAYLQINNLKNEDMATYFCTK YGYDPFDYWGQGTTLTVSS SEQ ID NO: 3 (NDMC-ASK3): QVQLQQSGPELVKPGASVKISCKASGYTFTSYYIHWVKQRPGQGLEWIG YIYPRDGSTNYNEKFKGKATLTADTSSSTAYMQLSSLTSEDSAVYFCAR QLGLPAWFAYWGQGTLVTVSA
[0038] A subject may be a human being or a non-human animal, such as cat, dog, rabbit, cattle, horse, sheep, goat, monkey, mouse, rat, gerbil, guinea pig, pig, but is preferably a human.
[0039] Optionally, determining binding level to the galactose-deficient IgA1 comprises performing an assay from the group consisting of a Western blot, an enzyme-linked immunosorbent assay (ELISA), an immunoaffinity assay, and a dot-blot assay.
EXAMPLES
[0040] The embodiments encompassed herein are now described with reference to the following examples. These examples are provided for the purpose of illustration only, and the disclosure encompassed herein should in no way be construed as being limited to these examples, but rather should be construed to encompass any and all variations which become evident as a result of the teachings provided herein.
[0041] Experimental data were analyzed with GraphPad Prism 7 (GraphPad Software, Inc., CA, USA) or SPSS version 22.0 (IBM, NY, USA). All data are presented as mean ±standard error of mean (SEM). Student's t test (t test) was used in the testing of hypothesis for comparison of means between the groups. A p-value less than 0.05 (typically≤0.05) is statistically significant. Further, ROC curve and logistic regression analyses were plotted by SPSS.
Example 1
Aberrantly glycosylated-specific Monoclonal antibody NDMC-ASK2 discriminates normally and abnormally glycosylated IgA1
[0042] Hybridoma system was applied to obtain monoclonal antibodies (Mouse anti-human-Gd-IgA1 IgG) that can specifically bind to galactose-deficient glycoform on hinge region of IgA1. To ensure the monoclonal antibody bear the identity to recognize Gd-IgA1 in human serum, the immunogen were customized by purifying IgA1 from human serum, and treated it with enzyme to secure F(ab')2-Gd-IgA1. The immunization, then, used the tailor-made immunogen on BALB/c mice for months and derived arrays of hybridoma clones.
[0043] In the process of selecting anti-Gd-IgA1 monoclonal antibody (NDMC-ASK2), we first used enzymatically-generated Gd-IgA1 from plasma-derived IgA1 to examine the supernatant from hybridoma cells in dot blot (
Example 2
Clinical IgAN subjects were unveiled among different type of subjects by NDMC-ASK2 ELISA
[0044] In the wake of preliminary test from dot blot and western blot analysis, NDMC-ASK2 was put in clinical binding assay, sandwich ELISA coated with NDMC-ASK2. In plates, serum Gd-IgA1 were captured by immobilized NDMC-ASK2 and subsequently detected by Biotin goat F(ab')2-IgG anti-human IgA and Streptavidin-HRP. Following this assay, the standard curve, which were established by applying a human Gd-IgA1, is acquired.
[0045] This clinical trial incorporated five different groups, including healthy control (HC), IgAN group, Systemic Lupus Erythematosus group, Lupus Nephritis group, and Diabetic Nephropathy, to be determined NDMC-ASK2′s characteristic of discriminating IgAN patients from healthy group and kidney- and immune-related diseases. the OD value of serum samples were extrapolated from the standard curve and expressed in units/ml. In this embodiment, 1 unit was defined as 1 μg of standard. The result showed that NDMC-ASK2 had superior capability to discriminate IgAN serum samples from others, healthy and disease controls (
[0046] As an illustration, please refer to Table 1, IgAN patients and non-IgAN patients were divided into two groups according to the optimal cut-off value of serum Gd-IgA1, which was obtained by NDMC-ASK2-base ELISA: non-IgAN patients group (Gd-IgA1<1.2993 n=105, 74.5%) and IgAN patients Gd-IgA1 group (Gd-IgA1≥1.2993 μg/mL, n=60, 83.3%).
TABLE-US-00002 TABLE 1 Subject Non- IgAN IgAN Total NDMC-ASK2 < cut-off value Count 105 12 117 % within subjects 74.5% 16.7% 54.9% >= cut-off value Count 36 60 96 % within subjects 25.5% 83.3% 45.1% Total Count 141 72 213 % within subjects 100.0% 100% 100.0%
[0047] According to the sensitivity and specificity this embodiment was acquired, 105 non-IgAN subjects are determined to be negative, with 74.5% True Negative Rate, and 60 IgAN subjects were determined to be positive, with 83.3 True Positive Rate (Table 1).
EXAMPLE 3
Comparison of NDMC-ASK2 ELISA and KM55 ELISA for detection of serum Gd-IgA1 levels in subjects with IgAN and non-renal diseases
[0048] NDMC-ASK2 was further compared with commercially available KM55 (Rat anti-Gd-IgA1 IgG) for serum Gd-IgA1 levels in patients with IgAN and non-renal diseases via measured by ELISA combined with ROC curve analyses. The above-mentioned serum of individuals was treated with or not treated with neuraminidase for ELISA test. The results showed in
[0049] On the other hand, please refer to
[0050] There were statistically significant differences (p<0.01) between HC and IgAN under the serum not treated with neuraminidase by T test analysis (
[0051] Therefore, it is proved that NDMC-ASK2 ELISA test is far superior to KM55 ELISA test in Gd-IgA1 in serum either not treated with neuraminidase or treated with neuraminidase.
Example 4
Circular immune complex detection by NDMC-ASK2
[0052] Abundant of Former studies have proved that Gd-IgA1 IgG IC play a vital role in the onset of IgA nephropathy, therefore, a NDMC-ASK2 binding assay for detecting serum Gd-IgA1 IgG immune complex (IC) was established in this embodiment. In plates, serum Gd-IgA1 IgG IC were captured by immobilized NDMC-ASK2 and subsequently detected by goat anti human IgG Fc-HRP. The standard curve, which were also established by applying human Gd-IgA1 and IgG protein, is in this embodiment.
[0053] Please refer to
Example 5
Combined NDMC-ASK2 and IC analysis increased sensitivity and specificity by ROC curve and logistic regression analyses
[0054] A combined NDMC-ASK2 and partial immune-complex with NDMC-ASK2 assay were established by combining ROC curve and logistic regression analyses, which helps increase the sensitivity to 0.906 although the specificity is 0.974 (
TABLE-US-00003 TABLE 2 Area Under the Curve. Test Result Variable (s) Area Gd-IgAa-IgG IC 0.778 NDMC-ASK2 0.797 Combination 0.880
TABLE-US-00004 TABLE 3 Positive if greater than or equal to Sensitivity Specificity One positive 0.906 0.538 Two positive 0.516 0.974
Example 6
Clinical IgAN patients were unveiled among different type of subjects by NDMC-ASK1 ELISA
[0055] In this embodiment, NDMC-ASK1 was put in clinical binding assay, sandwich ELISA coated with NDMC-ASK1. In plates, serum Gd-IgA1 were captured by immobilized NDMC-ASK1 and subsequently detected by Biotin goat F(ab')2-IgG anti-human IgA and Streptavidin-HRP. Following this assay, the standard curve, which were established by applying a human Gd-IgA1, is acquired.
[0056] This clinical trial incorporated five different groups, including healthy control (HC), IgAN group, Systemic Lupus Erythematosus group, Lupus Nephritis group, and Diabetic Nephropathy, to determined NDMC-ASK1's characteristic of discriminating IgAN patients from healthy group and kidney- and immune-related diseases. the OD value of serum samples were extrapolated from the standard curve and expressed in units/ml. In this embodiment, 1 unit was defined as 1 μg of standard. The result showed that NDMC-ASK1 had superior capability to discriminate IgAN serum samples from others, healthy and disease controls (
Example 7
Clinical IgAN patients were unveiled among different type of subjects by NDMC-ASK3 ELISA
[0057] In this embodiment, NDMC-ASK3 was put in clinical binding assay, sandwich ELISA coated with NDMC-ASK3. In plates, serum Gd-IgA1 were captured by immobilized NDMC-ASK3 and subsequently detected by Biotin goat F(ab')2-IgG anti-human IgA and Streptavidin-HRP. Following this assay, the standard curve, which were established by applying a human Gd-IgA1 protein, is acquired.
[0058] This clinical trial incorporated five different groups, including healthy control (HC), IgAN group, Systemic Lupus Erythematosus group, Lupus Nephritis group, and Diabetic Nephropathy, to determined NDMC-ASK3′s characteristic of discriminating IgAN patients from healthy group and kidney- and immune-related diseases. the OD value of serum samples were extrapolated from the standard curve and expressed in units/ml. In this embodiment, 1 unit was defined as 1μg of standard. The result showed that NDMC-ASK3 had superior capability to discriminate IgAN serum samples from others, healthy and disease controls (
[0059] As an illustration, please refer to Table 4, IgAN patients and non-IgAN patients were divided into two groups according to the optimal cut-off value of serum Gd-IgA1, which was obtained by NDMC-ASK3-base ELISA: non-IgAN patients group (Gd-IgA1<9165.4625 n=70, 72.9%) and IgAN patients Gd-IgA1 group (Gd-IgA1>9165.4625, n =52, 74.3%).
TABLE-US-00005 TABLE 4 Subject Non- IgAN IgAN Total NDMC-ASK3 cut-off value < Count % 70 18 88 9165.4625 within subjects 72.9% 25.7% 53.0% cut-off value >= Count % 26 52 78 9165.4625 within subjects 27.1% 74.3% 47.0% Total Count % 96 70 166 within subjects 100.0% 100% 100.0%
EXAMPLE 8
The epitopes and pathogenic form on hinge region of IgA1 recognized by NDMC-ASK2, NDMC-ASK1 and NDMC-ASK3
[0060] To figure out the detailed recognition characteristic of NDMC-ASK2, a series of glycopeptides, with six different single GalNAc-modified hinge region peptides, previous study reported to observe aberrant glycosylation on human IgA1 in serum, were synthesized and conjugated with BSA, which were employed in binding assay. The result indicated that NDMC-ASK2 strongly bound to Thr225—, Thr228—, Ser230—, Thr236—, and All-GalNAc-attached peptide, whereas only weak recognition on Ser232, Thr233, and pure peptide (
[0061] Meanwhile, the result indicated that NDMC-ASK1 would recognize on Ser232, Thr233, and pure peptide (
[0062] On the other hand, the result indicated that NDMC-ASK3 strongly bound to Thr228—, Thr233—, Thr236—, and All-GalNAc-attached peptide, whereas only weak recognition on Ser232, and pure peptide (
[0063] To sum up, this invention disclosed that (1) after several times of immunization on BALB/c mice for months, B cells were took from the spleen to manufacture hybridoma cells and conducted limiting dilution to obtain single hybridoma cell subsequently. Further examinations were conducted to test the binding ability of monoclonal antibodies with Gd-IgA1; (2) NDMC-ASK2 can specifically bind with Gd-IgA1 at dot blot analysis, Western blot analysis, and Enzyme-linked immunosorbent assay (ELISA); (3) NDMC-ASK2 can well discriminate IgAN patients from healthy controls (HCs), without treating sera with neuraminidase for desialylation of glycans. Importantly, when serum samples were treated with neuraminidase, the sensitivity involving the ELISA-based analysis with NDMC-ASK2 was shown to be greatly enhanced, with a AUC value as: 0.884; sensitivity as: 0.872 and specificity as: 0.75; (4) compared with KM55, a published rat IgG anti-Gd-IgA1, which binds to T225 and T233 only, NDMC-ASK2 was able to bind with a much broad range of sites, including T225, T228, S230, S232, T233 and T236 to which Tn antigen is attached on the hinge region of IgA1; (5) NDMC-ASK2 exhibited significantly higher sensitivity and specificity in differentiating HCs from IgAN patients than KM55; (6) Detection of serum IgG autoantibodies using a combined immune-complex (IC)-based assay and NDMC-ASK2-based ELISA analysis was shown to significantly increased the specificity of discriminating IgAN from HCs. Notably, a combined NDMC-ASK2 and IC-based assay detected by NDMC-ASK2-based assay helped increase sensitivity to 0.913 and specificity 0.667; (7) IgM (NDMC-ASK3) can well discriminate IgAN patients from HCs. In other words, the results form combined serum levels of Gd-IgA1 and IC-based assays an example to fustily NDMC-ASK-based assay, especially NDMC-ASK2-based assay can be further developed as promising rapid, early, non-invasive diagnostic kits for IgAN soon. (please refer to Table 5-Table 8; AUC: Area under the curve; n.s.:No signifince; BLI: Bio-layer interferometry; KD: Affinity constant; Kon: association rate constant; Kdis: dissociation rate constant.).
TABLE-US-00006 TABLE 5 Neu-treated serum (HC: n = 19; IgAN: n = 36) Mean (SD) (OD 450 nm or ng/ml) AUC NDMC-ASK2 1.208 (0.203) P < 0.0001 0.824 1.515 (0.249) KM55 5837.905 (2793.477) n.s. 0.613 6992.056 (3973.910)
TABLE-US-00007 TABLE 6 Intact serum (HC: n = 19; IgAN: n = 36) Mean (SD) (OD 450 nm or ng/ml) AUC NDMC-ASK2 0.923 (0.195) P < 0.001 0.725 1.139 (0.292) KM55 2785.312 (2790.280) n.s. 0.662 3353.471 (2029.171)
TABLE-US-00008 TABLE 7 BLI KD (M) Kon (1/Ms) Kdis (1/s) NDMC-ASK2 1.83 × 10.sup.−6 4.6 × 10.sup.4 8.4 × 10.sup.−2 KM55 7.4 × 10.sup.−8 1.68 × 10.sup.4 1.24 × 10.sup.−3
TABLE-US-00009 TABLE 8 GalNAc moiety epitope T225 T228 S230 S232 T233 T236 All-HR-C Immunogen NDMC-ASK2 + + + − − + + Gd-Fab KM55 + − − − + − + Glycopeptide
[0064] The particular embodiments disclosed above are illustrative only as the invention may be modified and practiced in different but equivalent manners apparent to those skilled in the art having the benefit of the teachings herein. Furthermore, no limitations are intended to the details of construction or design herein shown other than as described in the claims below. It is, therefore, evident that the particular embodiments disclosed above may be altered or modified and all such variations are considered within the scope and spirit of the invention. Accordingly, the protection sought herein is as set forth in the claims below.