KAPPA MYELOMA ANTIGEN CHIMERIC ANTIGEN RECEPTORS AND USES THEREOF

20220193232 · 2022-06-23

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention provides compositions and methods for treating KMA-expressing malignancies including chimeric antigen receptors (CARs) and T cells containing CARs (CAR T-cells). The invention also provides methods and compositions comprising CAR T-cells co-expressing other anti-tumoral agents including cytokines and antibodies.

    Claims

    1. A chimeric antigen receptor (CAR) comprising one or more intracellular signaling domains and an extracellular antigen binding domain, wherein the extracellular antigen binding domain specifically recognizes kappa myeloma antigen (KMA).

    2. The CAR of claim 1, wherein the one or more intracellular signaling domains comprises one or more co-stimulatory endodomains.

    3. The CAR of claim 2, wherein the one or more co-stimulatory endodomains is one or more of a CD28 domain, a CD3ζ domain, a 4-1BB domain or OX-40 domain or combinations thereof.

    4. The CAR of claim 3, wherein the co-stimulatory endodomains are a CD3ζ domain and a CD28 domain.

    5. The CAR of claim 3, wherein the co-stimulatory endodomains are a CD3ζ domain and an OX-40 domain.

    6. The CAR of claim 4, further comprising an OX-40 domain.

    7. The CAR of claim 3, wherein the co-stimulatory endodomains are a CD3ζ domain and a 4-1BB domain.

    8. The CAR of claim 4, further comprising a 4-1BB domain.

    9. The CAR of claim 7, further comprising an OX-40 domain.

    10. The CAR of claim 1, wherein the extracellular binding domain comprises a single chain variable fragment (scFv) that specifically recognizes KMA.

    11. The CAR of claim 10, wherein the scFv comprises the complementarity determining regions (CDRs) derived from the KappaMab monoclonal antibody, wherein the KappaMAb CDRs comprise SEQ ID NOS: 3-8.

    12. The CAR of claim 10, wherein the scFv comprises the VL chain and VH chain from KappaMab wherein the VL chain comprises SEQ ID NO: 2 and a VH chain comprises SEQ ID NO: 1.

    13. The CAR of claim 11, wherein the VL chain and VH chain from KappaMab are attached via a glycine-serine linker.

    14. The CAR of claim 13, wherein the glycine-serine linker is a 15-20 amino acid linker.

    15. The CAR of claim 14, wherein the 15 amino acid linker comprises (Gly.sub.4Ser).sub.3.

    16. The CAR of claim 10, wherein the scFv is attached to the one or more intracellular signaling domains via a spacer.

    17. The CAR of claim 16, wherein the spacer is an immunoglobulin constant region or a CD8α chain.

    18. The CAR of claim 17, wherein the immunoglobulin constant region comprises one or more of an IgG hinge domain, an IgG CH2 domain and an IgG CH3 domain.

    19. The CAR of claim 18, wherein the immunoglobulin constant region comprises an immunoglobulin hinge domain.

    20. The CAR of claim 19, wherein the immunoglobulin constant region further comprises an IgG CH3 domain.

    21. The CAR of claim 19 or 20, wherein the immunoglobulin constant region further comprises an IgG CH2 domain.

    22. The CAR of any one of claims 17-21, wherein the spacer is attached to the scFV via a glycine-serine linker.

    23. The CAR of claim 22, wherein the glycine-serine linker is a 15-20 amino acid linker.

    24. The CAR of claim 23, wherein the 15 amino acid linker comprises (Gly.sub.4Ser).sub.3.

    25. A genetically modified T cell engineered to express the CAR of any one of claims 1-24.

    26. The genetically modified T cell of claim 25 further engineered to express one or more additional biological molecules.

    27. The genetically modified T cell of claim 26, wherein the one or more additional biological molecules comprises one or more of IL-12, GAL3C or SANT7.

    28. The genetically modified T cell of claim 26, wherein the one or more additional biological molecules is IL-12 and the IL-12 is expressed by a single chain polypeptide comprising one IL-12 p35 subunit and one IL-12 p40 subunit joined by a flexible linker.

    29. The genetically modified T cell of claim 28, wherein the flexible linker is a (G.sub.4S).sub.3 linker.

    30. The genetically modified T cell of claim 29, wherein the single chain polypeptide comprising one IL-12 p35 subunit and one IL-12 p40 subunit joined by a flexible linker forms a bioactive p70 IL-12 heterodimer.

    31. The genetically modified T cell of claim 26 engineered to express IL-12 and a selectable marker.

    32. The genetically modified T cell of claim 26 engineered to express SANT-7.

    33. The genetically modified T cell of claim 26 engineered to express SANT-7 and a selectable marker.

    34. The genetically modified T cell of claim 31 further engineered to express SANT7.

    35. The genetically modified T cell of claim 26 engineered to express GAL3C.

    36. The genetically modified T cell of claim 26 engineered to express GAL3C and a selectable marker. cm 37. The genetically modified T cell of claim 31 further engineered to express GAL3C.

    38. The genetically modified T cell of claim 31 further engineered to express GAL3C and SANT7.

    39. The genetically modified T cell of claim 33 further engineered to express GAL3C.

    40. A method for producing a genetically modified T cell comprising introducing an expression vector encoding a CAR comprising one or more intracellular signaling domain and an extracellular antigen binding domain, wherein the extracellular antigen binding domain specifically recognizes kappa myeloma antigen (KMA) into a T cell.

    41. The method of claim 40, wherein the expression vector is a transposable vector expression system.

    42. The method of claim 40, wherein the expression vector is a PiggyBac transposon expression vector.

    43. The method of claim 40, wherein the introducing comprises electroporation.

    44. The method of claim 40, wherein the one or more intracellular signaling domain comprises one or more co-stimulatory endodomains.

    45. The method of claim 44, wherein the one or more co-stimulatory endodomains is one or more of a CD28 domain, a CD3ζ domain, a 4-1BB domain or OX-40 domain or combinations thereof.

    46. The method of claim 45, wherein the co-stimulatory endodomains are a CD3ζ domain and a CD28 domain.

    47. The method of claim 45, wherein the co-stimulatory endodomains are a CD3ζ domain and an OX-40 domain.

    48. The method of claim 46, wherein the CAR further comprises an OX-40 domain.

    49. The method of claim 45, wherein the co-stimulatory endodomains are a CD3ζ domain and a 4-1BB domain.

    50. The method of claim 46, wherein the CAR further comprises a 4-1BB domain.

    51. The method of claim 50, wherein the CAR further comprises an OX-40 domain.

    52. The method of claim 40, wherein the extracellular binding domain comprises a scFv the specifically recognizes KMA.

    53. The method of claim 52, wherein the scFv comprises the complementarity determining regions (CDRs) derived from the KappaMab monoclonal antibody wherein the CDRs comprise SEQ ID NOS: 3-8.

    54. The method of claim 53, wherein the scFv comprises the VL chain and VH chain of the KappaMab monoclonal antibody, wherein the VL chain comprises SEQ ID NO: 2 and the VH chain comprises SEQ ID NO: 1.

    55. The method of claim 54, wherein the VL CDRs and VH CDRs are attached via a glycine-serine linker.

    56. The method of claim 55, wherein the glycine-serine linker is a 15-20 amino acid linker.

    57. The method of claim 56, wherein the 15 amino acid linker comprises (Gly.sub.4Ser).sub.3.

    58. The method of claim 52, wherein the scFv is attached to the one or more intracellular signaling domains via a spacer.

    59. The method of claim 58, wherein the spacer is an immunoglobulin constant region or a CD8α chain.

    60. The method of claim 59, wherein the immunoglobulin constant region comprises one or more of an IgG hinge domain, an IgG CH2 domain and an IgG CH3 domain.

    61. The method of claim 59, wherein the immunoglobulin constant region comprises an immunoglobulin hinge domain.

    62. The method of claim 61, wherein the immunoglobulin constant region further comprises an IgG CH3 domain.

    63. The method of claim 61 or 62, wherein the immunoglobulin constant region further comprises an IgG CH2 domain.

    64. The CAR of any one of claims 59-63, wherein the spacer is attached to the scFV via a glycine-serine linker.

    65. The CAR of claim 22, wherein the glycine-serine linker is a 15-20 amino acid linker.

    66. The CAR of claim 23, wherein the 15 amino acid linker comprises (Gly.sub.4Ser).sub.3.

    67. The method of claim 40, further comprising introducing one or more additional expression vectors capable of expressing one or more additional biological molecules.

    68. The method of claim 67, wherein the one or more additional biological molecules comprises one or more of IL-12, GAL3C or SANT7.

    69. The method of claim 68, wherein the one or more additional biological molecules is IL-12 and said IL-12 is expressed by a single chain construct comprising a IL-12 p35 subunit and a IL-12 p40 subunit joined by a flexible linker.

    70. The method of claim 69, wherein the flexible linker is a (G.sub.4S).sub.3 linker.

    71. The method of claim 70, wherein the single chain construct comprising an IL-12 p35 subunit and an IL-12 p40 subunit joined by a flexible linker forms a bioactive p70 IL-12 heterodimer.

    72. The method of claim 67, wherein the one or more additional biological agents is expressed via a construct further encoding a selectable marker.

    73. The method of claim 72, wherein the construct encodes IL-12 and a selectable marker, wherein the coding sequences for the selectable marker and IL-12 are joined by a sequence encoding a 2A ribosomal skip.

    74. The method of claim 72, wherein the construct encodes SANT7 and a selectable marker, wherein the coding sequences for the selectable marker and SANT7 are joined by a sequence encoding a 2A ribosomal skip.

    75. The method of claim 72, wherein the construct encodes GAL3C and a selectable marker, wherein the coding sequences of the selectable marker and GAL3C are joined by a sequence encoding a ribosomal skip

    76. The method of claim 74, wherein the construct further encodes GAL3C and wherein the coding sequence for GAL3C is joined to the coding sequence of SANT7 in the construct via an additional 2A ribosomal skip.

    77. The method of claim 73, wherein the construct further encodes SANT7 and wherein the coding sequence for SANT7 is joined to the coding sequence for IL-12 in the construct via an additional coding sequence for a 2A ribosomal skip.

    78. The method of claim 73, wherein the construct further encodes GAL3C and wherein the coding sequence for GAL3C is joined to the coding sequence for IL-12 in the construct via an additional coding sequence for a 2A ribosomal skip.

    79. The method of claim 78 wherein the construct further encodes SANT7 and wherein the coding sequence for each of IL-12, SANT7, GAL3C and the selectable marker are joined via a 2A ribosomal skip.

    80. A method of treating a KMA-expressing malignancy in a subject in need thereof comprising administering genetically modified T cells engineered to express one or more intracellular signaling domain and an extracellular antigen binding domain, wherein the extracellular antigen binding domain specifically recognizes kappa myeloma antigen (KMA).

    81. The method of claim 80, wherein the KMA-expressing malignancy is multiple myeloma, Waldenstroms macroglobulinemia, diffuse large B cell lymphoma (DLBCL), or amyloidosis.

    82. The method of claim 80, wherein the one or more intracellular signaling domain comprises one or more co-stimulatory endodomains.

    83. The method of claim 82, wherein the one or more co-stimulatory endodomains is one or more of a CD28 domain, a CD3ζ domain, a 4-1BB domain or OX-40 domain or combinations thereof.

    84. The method of claim 83, wherein the co-stimulatory endodomains are a CD3ζ domain and a CD28 domain.

    85. The method of claim 83, wherein the co-stimulatory endodomains are a CD3ζ domain and an OX-40 domain.

    86. The method of claim 84, wherein the intracellular signaling domain further comprises an OX-40 domain.

    87. The method of claim 83, wherein the co-stimulatory endodomains are a CD3ζ domain and a 41-BB domain.

    88. The method of claim 84, further comprising a 41-BB domain.

    89. The method of claim 80, wherein the extracellular binding domain comprises a scFv that specifically recognizes KMA.

    90. The method of claim 89, wherein the scFv recognizes KMA and comprises the complementarity determining regions (CDRs) derived from the KappaMab monoclonal antibody, wherein the CDRs comprise SEQ ID NOs: 3-8.

    91. The method of claim 89, wherein the scFv comprises the VL chain and VH chain of the KappaMab monoclonal antibody, wherein the VL chain comprises SEQ ID NO: 2 and the VH chain comprises SEQ ID NO:1.

    92. The method of claim 91, wherein the VL of SEQ ID NO: 2 and VH of SEQ ID NO: 1 are attached via a glycine-serine linker.

    93. The method of claim 92, wherein the glycine-serine linker is a 15-20 amino acid linker.

    94. The method of claim 93, wherein the 15 amino acid linker comprises (Gly.sub.4Ser).sub.3.

    95. The method of claim 89, wherein the scFv is attached to the one or more intracellular signaling domains via a spacer.

    96. The method of claim 95, wherein the spacer is an immunoglobulin constant region or a CD8a chain.

    97. The method of claim 96, wherein the immunoglobulin constant region comprises one or more of an IgG hinge domain, and IgG CH2 domain and an IgG CH3 domain.

    98. The method of claim 97, wherein the immunoglobulin constant region comprises an immunoglobulin hinge domain.

    99. The method of claim 98, wherein the immunoglobulin constant region further comprises an IgG CH3 domain.

    100. The method of claim 98 or 99, wherein the immunoglobulin constant region further comprises an IgG CH2 domain.

    101. The CAR of any one of claims 96-100, wherein the spacer is attached to the scFV via a glycine-serine linker.

    102. The CAR of claim 101, wherein the glycine-serine linker is a 15-20 amino acid linker.

    103. The CAR of claim 102, wherein the 15 amino acid linker comprises (Gly.sub.4Ser).sub.3.

    104. The method of claim 80, wherein the genetically modified T cells are further engineered to express one or more additional biological molecules.

    105. The method of claim 104, wherein the one or more additional biological molecules comprises one or more of IL-12, GAL3C or SANT7.

    106. The method of claim 104, wherein the one or more additional biological molecules is IL-12 and said IL-12 is expressed as a single chain polypeptide comprising an IL-12 p35 subunit and an IL-12p40 subunit joined by a flexible linker.

    107. The method of claim 106, wherein the flexible linker is a (G.sub.4S).sub.3 linker.

    108. The method of claim 106, wherein the single chain polypeptide comprising an IL-12 p35 subunit and an IL-12p40 subunit joined by a flexible linker forms a bioactive p70 IL-12 heterodimer.

    109. The method of claim 105, wherein the CAR T-cells are engineered to express IL-12 and a selectable marker.

    110. The method of claim 104, wherein the CAR T-cells are engineered to express SANT7 and a selectable marker.

    111. The method of claim 104, wherein the CAR-T cells are engineered to express GAL3C and a selectable marker.

    112. The method of claim 104, wherein the CAR T-cells are engineered to express SANT7, IL-12 and a selectable marker.

    113. The method of claim 104 wherein the CAR T-cells are engineered to express SANT7, GAL3C and a selectable marker.

    114. The method of claim 104, wherein the CAR T-cells are engineered to express IL-12, GAL3C and selectable marker.

    115. The method of claim 104, wherein the CAR T-cells are engineered to express IL-12, GAL3C, SANT7 and a selectable marker.

    116. The method of claim 80, further comprising administering one or more additional biologically or pharmaceutically active agents.

    117. The method of claim 116, wherein the one or more additional biologically active agents comprises IL-12, an IL-6 receptor antagonist or SANT7.

    118. The method of claim 116, wherein the additional pharmaceutically active agents comprise one or more chemotherapeutic agent.

    119. The method of claim 116, wherein the additional pharmaceutically active agent is an immunomodulatory drug.

    120. The method of claim 119, wherein the immunomodulatory drug is thalidomide or an analog thereof.

    121. The method of claim 120, wherein the thalidomide analog is actimid, lenalidomide or pomalidomide.

    122. The method of claim 116, wherein the additional pharmaceutical active agent is a histone deacetylase inhibitor.

    123. The method of claim 122, wherein the histone deacetylase inhibitor is panobinostat, vorinostat, trichostatin A, depsipeptides, phenylbutyrate, valproic acid, belinostat, LAQ824, entinostat, C1944, or mocetinostat.

    124. The method of claim 116, wherein the one or more additional biologically or pharmaceutically active agents is administered before, during or after treatment with the genetically modified T cells.

    125. The method of claim 80, wherein the genetically modified T cells are administered intravenously.

    126. The method of claim 80, wherein the genetically modified T cells are derived from the patient.

    127. The method of claim 80, wherein the genetically modified T cells are not derived from the patient.

    128. The genetically modified T cell of claim 26 or 27 further engineered to express an HGF binding protein.

    129. The genetically modified T cell of claim 128, wherein the HGF binding protein is an HGF antibody or fragment thereof.

    130. The method of claim 67 or 104, wherein the one or more additional biological molecules is an HGF binding protein.

    131. The method of claim 130, wherein the HGF binding protein is an antibody or fragment thereof.

    132. The method of claim 80 wherein the genetically modified T cells are administered before, during or after a stem cell transplant.

    133. The method of claim 132, wherein the stem cell transplant is an allogenic stem cell transplant.

    134. The method of claim 132, wherein the stem cell transplant is an allogeneic stem cell transplant.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0018] The novel features of the invention are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present invention is obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention are utilized, and the accompanying drawings of which:

    [0019] FIGS. 1A-1B shows the structural relationship of CARs to Immunoglobulin (IgG) and the T-cell receptor (TCR) FIG. 1A shows a single chain variable fragment (scFv) consisting of the parent antibody's light chain variable region (VL) joined to the heavy chain variable region (VH) by a polypeptide linker confers antigen specificity to the CAR. A flexible hinge connects the scFv to the transmembrane and the intracellular signaling domain of a co-stimulatory molecule such as CD28, 4-1 BB or OX-40 followed by CD3 zeta. FIG. 1B shows T-cells transduced with the CAR are activated on encountering tumor cells bearing the target antigen (Ag) leading to tumor cell lysis.

    [0020] FIG. 2 shows the structural determinants of chimeric antigen receptor function.

    [0021] FIG. 3 shows KMA expression on primary myeloma cells.

    [0022] FIGS. 4A-4C shows KMA.CAR-28z function. FIG. 4A is flow cytometry analysis of KMA expression on various cell lines; FIG. 4B is interferon-gamma (IFNy) expression of KMA.CAR-28z transduced (upper plots) and non-transduced (lower plots) CD8.sup.+ T cells. FIG. 4C shows the specific lysis of KMA positive and negative cell lines by KMA.CAR-28z transduced T cells.

    [0023] FIG. 5A shows RPMI-Rag mice injected with 5×10.sup.5-5×10.sup.6 myeloma cells

    [0024] FIG. 5B shows infiltration of the bone marrow and spleen with CD138.sup.+ RPMI9226 cells

    [0025] FIG. 5C shows elevated levels of serum human lambda light chain on progressive disease

    [0026] FIG. 5D shows CD138.sup.+/cytoplasmic lambda light chain positive cells in the bone marrow FIG. 5E shows RPMI-Rag mice as a therapeutic model.

    [0027] FIGS. 6A-6C shows the optimization of KMA.CAR FIG. 6A show the initial KMA.CAR-28z construct; FIG. 6B shows constructs with Ig heavy chain hinge and CH3 or hinge alone FIG. 6C shows constructs combining optimal hinge region (opti) with combinations of various costimulatory molecule endodomains and CD3 zeta.

    [0028] FIG. 7 shows the IL-12 and SANT7 vectors.

    [0029] FIGS. 8A-8B shows KM.CAR T-cell expansion and CAR expression with constructs described in Example 3. FIG. 8A shows expansion of total cells in CAR T-cell cultures with (left) and without (right) the addition of the KMA expressing JJN3 cell line. FIG. 8B CAR expression as measured by GFP in cultures with (top plots) and without (bottom plots) the KMA expressing JJN3 cell line. hCH2CH3=KM.CAR_hCH2CH3_28z T-cells; hCH2CH3mut=KM.CAR hCH2CH3mut_28TM_41BBz T-cells; h=KM.CAR_h_28TM_41BBz T-cells; CD8a=KM.CAR_8a_28TM_41BBz T-cells.

    [0030] FIG. 9 shows the structure of the activation inducible transposon casette. IR=inverted repeats; Ins=Insulator flanking the two ends of the gene insert; NFATpro=activation inducible promoter; BGHpA=bovine growth hormone polyadenylation signal; EF1α=human elongation factor-1 alpha promoter; RQR8=marker; SV40=simian virus late polyadenylation signal.

    [0031] FIG. 10 shows expression of eGFP under activation induced promoter control. Transduced PBMCs stimulated with PMA and Ionomycin (right plot) were assessed for co-expression of RQR8 (x-axis) and eGFP (y-axis) and compared to unstimulated controls (left plot). Transduced cells did not express eGFP in the absence of stimulation. Fifty percent of transduced cells expressed eGFP with stimulation.

    [0032] FIG. 11 shows the structure of the activation inducible transposon cassette with CAR and biological. IR=inverted repeats; Ins=Insulator flanking the two ends of the gene insert; NFATpro=activation inducible promoter; BGHpA=bovine growth hormone polyadenylation signal; EF1α=human elongation factor-1 alpha promoter; SV40=simian virus late polyadenylation signal.

    [0033] FIGS. 12A-12B shows KMA-specific interferon-gamma production and cytotoxicity of KM.CAR_hCH2CH3_28z T-cells (FIG. 12A) or KM.CAR_h_28TM_41BBz T-cells (FIG. 12B) standard chromium release assay with KMA+ and KMA− cell lines. KMA positive cell lines used included JJN3, Pfeiffer, NCI-H929, while KMA negative cell lines included Nalm-6 and Molt

    DETAILED DESCRIPTION OF THE INVENTION

    [0034] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the invention pertains. Although any methods and material similar or equivalent to those described herein can be used in the practice for testing of the present invention, the preferred materials and methods are described herein. In describing and claiming the present invention, the following definitions will be used. It will also be understood that the terminology used herein is not meant to be limiting but rather is used herein for the purpose of describing particular embodiments.

    [0035] The articles “a” and “an” are used herein to refer to one or more than one (i.e. to at least one or to one or more) of the grammatical object of the article.

    [0036] The term “expression vector” as used herein refers to a vector comprising a recombinant nucleic acid sequence comprising at least one expression control sequence operatively linked to the nucleic acid sequence to be expressed. An expression vector comprises all necessary cis acting elements required for expression. Examples of expression vectors include, but are not limited to, plasmids, cosmids, and viruses that encode the recombinant polynucleotide to be expressed. In some embodiments, the expression vector comprises transposable elements that are capable of integrating into the genome, for example, the PiggyBac expression system. In some embodiments, the expression vector is a viral vector that allows for integration of the expression vector contents into the host genome, for example retroviral and lentiviral vectors.

    [0037] By “chimeric antigen receptor” or “CAR” is meant an engineered receptor that includes an extracellular antigen binding domain and an intracellular signaling domain. While the most common type of CAR comprises a single-chain variable fragment (scFv) derived from a monoclonal antibody fused to a transmembrane and intracellular domain of a T cell co-receptor, such as the CD3ζ chain, the invention described herein is not limited to these domains. Rather, as used herein “chimeric antigen receptor” or “CAR” refers to any receptor engineered to express and extracellular antigen binding domain fused or linked to any intracellular signaling molecule.

    [0038] As used herein the term “CAR-T cell” refers to a T lymphocyte that has been genetically engineered to express a CAR. The definition of CAR T-cells encompasses all classes and subclasses of T-lymphocytes including CD4.sup.+, CD8.sup.+ T cells as well as effector T cells, memory T cells, regulatory T cells, and the like. The T lymphocytes that are genetically modified may be “derived” or “obtained” from the subject who will receive the treatment using the generically modified T cells or they may “derived” or “obtained” from a different subject.

    [0039] By “intracellular signaling domain” is meant the portion of the CAR that is found or is engineered to be found inside the T cell. The “intracellular signaling domain” may or may not also contain a “transmembrane domain” which anchors the CAR in the plasma membrane of a T cell. In one embodiment, the “transmembrane domain” and the “intracellular signaling domain” are derived from the same protein (e.g. CD3ζ) in other embodiments; the intracellular signaling domain and the transmembrane domain are derived from different proteins (e.g. the transmembrane domain of a CD3ζ and intracellular signaling domain of a CD28 molecule, or vice versa).

    [0040] By “co-stimulatory endodomain” is meant an intracellular signaling domain or fragment thereof that is derived from a T cell costimulatory molecule. A non-limiting list of T cell costimulatory molecules include CD3, CD28, OX-40, 4-1BB, CD27, CD270, CD30 and ICOS. The co-stimulatory endodomain may or may not include a transmembrane domain from the same or different co-stimulatory endodomain.

    [0041] By “extracellular antigen binding domain” is meant the portion of the CAR that specifically recognizes and binds to the antigen of interest. The “extracellular binding domain” may be derived from a monoclonal antibody. For example, the “extracellular binding domain” may include all or part of an Fab domain from a monoclonal antibody. In certain embodiments, the “extracellular binding domain” includes the complementarity determining regions of a particular monoclonal antibody. In still another embodiment, the “extracellular binding domain” is a single-chain variable fragment (scFv).

    [0042] By “single-chain variable fragment” or “scFv” is meant a fusion protein of the variable heavy (VH) and variable light (VL) chains of an antibody with a peptide linker between the VL and VH. The linker length and composition vary depending on the antibody portions used, but generally are between about 10 and about 25 amino acids in length. In some embodiments, the peptide linker is a glycine rich to provide for flexibility. In some embodiments, the linker also includes serine and/or threonine which may, without being bound by theory, aid in solubility. In some embodiments, the linker is an amino acid with SEQ ID NO: 23. ScFvs are designed to retain the antigen binding specificity of the parent antibody from which their variable chains were derived despite lacking the immunoglobulin heavy chain. In some embodiments, only the complementary determining regions (CDRs) from the VH and VL are used in the scFV. In some embodiments, the entire VL and VH chains are used.

    [0043] The term “antibody” as used herein refers to an immunoglobulin molecule which specifically binds to an antigen. Antibodies can be intact immunoglobulins derived from natural sources or from recombinant sources and can be immunoreactive portions of intact immunoglobulins. The antibodies in the present invention may exist in a variety of forms including, for example, polyclonal antibodies, monoclonal antibodies, Fv, Fab and F(ab).sub.2, as well as single chain antibodies and humanized antibodies (Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, N.Y.; Harlow et al., 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, N.Y.; Houston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-5883; Bird et al., 1988, Science 242:423-426). As used herein the term “antibody” also encompasses antibody fragments.

    [0044] The term “antibody fragment” refers to a portion of an intact antibody and refers to the antigenic determining variable regions of an intact antibody. Examples of antibody fragments include, but are not limited to, Fab, Fab', F(ab')2, and Fv fragments, linear antibodies, scFv antibodies, and multispecific antibodies formed from antibody fragments.

    [0045] An “antibody heavy chain,” as used herein, refers to the larger of the two types of polypeptide chains present in all antibody molecules in their naturally occurring conformations.

    [0046] An “antibody light chain,” as used herein, refers to the smaller of the two types of polypeptide chains present in all antibody molecules in their naturally occurring conformations. κ and λ light chains refer to the two major antibody light chain isotypes.

    [0047] As used herein the term “complementarity determining region” or “CDR” refers to the part of the two variable chains of antibodies (heavy and light chains) that recognize and bind to the particular antigen. The CDRs are the most variable portion of the variable chains and provide the antibody with its specificity. There are three CDRs on each of the variable heavy (VH) and variable light (VL) chains and thus there are a total of six CDRs per antibody molecule.

    [0048] By “KappaMab” is meant the monoclonal antibody previously termed IST-1097 or MDX-1097. Furthermore, as used herein KappaMab may refer to the full antibody sequence of the KappaMab antibody (See e.g. U.S. Pat. Nos. 7,344,715 and 7,556,803 each of which are hereby incorporated by reference in their entireties.) Additionally, the term “KappaMab” as used herein is used to encompass any polypeptide containing the CDR sequences of SEQ ID NOs: 3-8 and/or the VL sequence of SEQ ID NO: 2 and the VH sequence of SEQ ID NO: 1. The term “KappaMab” as used herein can encompass any polypeptide containing the VL sequence of SEQ ID NO: 21 and the VH sequence of SEQ ID NO: 22. In the compositions and methods of the current invention, KappaMab may include the full monoclonal antibody or any antigen binding fragment thereof including Fab and scFv.

    [0049] The term “antigen” or “Ag” as used herein is defined as a molecule that is recognized by an immune cell receptor (e.g. a T cell receptor, B cell receptor/Immunogloblulin). In some embodiments, an antigen is a molecule that elicits an immune response. This immune response may involve either antibody production, or the activation of specific immunologically-competent cells, release of cytotoxic mediators or immunostimulatory or regulatory cytokines. The skilled artisan will understand that any macromolecule, including virtually all proteins or peptides, can serve as an antigen.

    [0050] As used herein the term “specifically binds” or “specifically recognizes” as used in connections with an antibody, antibody fragment or CAR refers to a an antibody, antibody fragment or CAR which recognizes a specific antigen but does not substantially recognize or bind other molecules in a sample.

    [0051] By “ribosomal skip” is meant an alternative mechanism of translation in which a specific peptide prevents the ribosome of a cell from covalently linking a new inserted amino acid and instead allows it to continue translation thus resulting in a co-translational cleavage of the polyprotein. This process is induced by a “2A ribosomal skip” element or cis-acting hydrolase element (e.g. CHYSEL sequence). In some embodiments, this sequence comprises a non-conserved amino acid sequence with a strong alpha-helical propensity followed by the consensus sequence -D(V/I)ExNPG P, where x=any amino acid. The apparent cleavage occurs between the G and P. In some embodiments, the ribosomal skip element is a 2A ribosomal skip element. The 2A ribosomal skip element can be a 5′ T2A ribosomal skip element.

    [0052] As used herein “immunomodulatory drug” or “IMiD” is a class of drugs that constitute thalidomide and its analogs. Thalidomide analogs include lenalidomide, pomalidomide and apremilast.

    [0053] As used herein the term “histone deacetyalse inhibitor” or “HDAC inhibitor” or “HDI” refers to a class of compounds that interferes with the function of histone deacetylase. Examples of HDIs include, but are not limited to, hyroxamic acids including, for example, trichostatin A, vorinostat (SAHA), belinostat (PXD101), LAQ824, panobinostat (LBH589); cyclic tripeptides, including for example, depsipeptides and tapoxin B; benzamides, including for example, entinostat (MS-275), CI994 and mocetinostat (MGCD0103); electrophilic ketones; and aliphatic compounds, such as for example, phenylbutyrate and valproic acid.

    Kappa Myeloma Antigen and Antibodies

    [0054] Kappa myeloma antigen or KMA is a cell membrane antigen that is found on the surface of myeloma cells. Specifically, KMA consists of free kappa light chains expressed in non-covalent association with actin on the cell membrane (Goodnow et al. (1985) J. Immunol. 135:1276). While any antibody that specifically binds to KMA may be used in accordance with the present invention, in a preferred embodiment the KappaMab monoclonal antibody will be used as a basis for the extracellular antigen binding domain of the CARs of the current invention. The monoclonal antibody designated KappaMab (formally designated IST-1097, also known as MDX-1097) binds to a conformational epitope in the switch region of human kappa free light chain that is only available when the kappa chain is not associated with a heavy chain and therefore does not bind to intact kappa-chain containing IgG, IgM, IgE or IgA (Hutchinson et al. (2011) Mol. Immunol.). Typical expression of KMA on primary myeloma cells derived from patient bone marrow biopsies is shown by KappaMab binding in FIG. 3. The KappaMab antibody can comprise the VH chain of SEQ ID NO: 1 and the VL chain of SEQ ID NO: 2. More specifically the KappaMab VH chain can comprise the CDRs of SEQ ID NO: 3-5 and the VL CDRs of SEQ ID NO: 6-8. Additionally, the KappaMab can comprise VH region of SEQ ID NO: 22 and a VL region of SEQ ID NO: 21.

    Chimeric Antigen Receptors

    [0055] Chimeric antigen receptors (CARs) are artificial receptors consisting of the tumor antigen binding regions of monoclonal antibodies and the intracellular activating portion of the T cell receptor complex in a single polypeptide chain held together by a series of linker(s) and spacer(s) (FIGS. 1A-1B). Most commonly, CARs are fusion proteins of single-chain variable fragments (ScFv) fused to the CD3ζ transmembrane domain. However, other intracellular signaling domains such as CD28, 41-BB and Ox40 may be used in various combinations to give the desired intracellular signal. In some embodiments, the CARs provided herein comprise an Ig Heavy Chain Leader peptide. The leader peptide can be SEQ ID NO: 20.

    I. Extracellular Antigen Binding Domain

    [0056] In one embodiment, the CAR of the current invention comprises an extracellular antigen binding domain from a monoclonal antibody that is specific for one or more KMA epitopes expressed on MM cells. In one embodiment, the CAR of the current invention comprises an extracellular antigen binding domain from KappaMab. In one embodiment, the extracellular binding domain comprises the VL CDRs of SEQ ID NOs: 6-8 and VH CDRs of SEQ ID NOs: 3-5. In a particular embodiment, the extracellular binding domain is a scFv comprising the VL (SEQ ID NO: 2) and VH (SEQ ID NO: 1) domains of KappaMab. In another embodiment, the extracellular binding domain is a scFv comprising the VL (SEQ ID NO: 21) and VH (SEQ ID NO: 22) domains of KappaMab.

    II. Linker between VL and VH Domains of KappaMab scFv

    [0057] In a further embodiment, the KappaMab VL is linked to the KappaMab VH via a flexible linker. Specifically, the flexible linker is a glycine/serine linker of about 10-30 amino acids (for example 30, 25, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, or 5 amino acids) and comprises the structure (Gly.sub.4Ser).sub.3. In a particular embodiment the linker is 15 amino acids in length. Linker length is an important determinant of a CAR. Without being bound by theory, shorter linkers may enhance affinity but can also lead to intracellular multimer formation thus impairing expression of the CAR whereas longer linkers tend to decrease antigen affinity by moving the VL and VH CDRs further apart in space.

    III. Spacers between Extracellular Antigen Binding Domain and Intracellular Signaling Domain

    [0058] The extracellular antigen binding domain (e.g. KappaMab scFv) is linked to the intracellular signaling domain by the use of a “spacer”. The spacer is designed to be flexible enough to allow for orientation of the antigen binding domain in such a way as facilitates antigen recognition and binding. The spacer may derive from immunoglobulins themselves and can include the IgG1 hinge region or the CH2 and/or CH3 region of an IgG. Alternatively, the hinge may comprise all or part of a CD8α chain. The length and flexibility of the spacer(s) is dependent on both the antigen recognition domain as well as the intracellular binding regions and what may be functional and/or optimal for one CAR construct may not be for another CAR. In certain instances the spacer may be designated herein as “opti” (See FIGS. 6A-6C) to signify that optimal spacer identity and length varies depending on the extracellular binding portion used and the intracellular signaling domains selected. In certain embodiment, an IgG hinge alone is used. In other embodiments, the IgG hinge is used together with all or part of IgG CH2 domain. In other embodiments, the IgG hinge is used together with all or part of an IgG CH3 domain. In other embodiments the IgG hinge is used together with all or part of both an IgG CH2 and CH3 domain. In other embodiments, all or part of an IgG CH2 domain is used. In other embodiments, all or part of an IgG CH3 domain is used. In still other embodiments all or part of both an IgG CH2 and CH3 domain is used. In one embodiment, the hinge, CH2 and CH3 domains used in any of the constructs provided herein comprises a C to P mutation in the hinge region at amino acid position 103 of Uniprot P01857). In one embodiment, the hinge, CH2 and CH3 domains used in any of the constructs provided herein is SEQ ID NO: 24. In another embodiment, the hinge is used together with all or part of both an IgG CH2 and CH3 domain, wherein mutations are introduced at amino acids important for CH2 interaction with Fc-receptors. These mutations may mediate improved survival post infusion by decreasing Fc interaction with CAR T-cells provided herein. An example of these mutations can be seen in the KM.CAR_hCH2CH3mut_28TM_41BBz construct shown in Example 3 as provided herein. In a further embodiment still, a CD8α polypeptide is used. In a further embodiment, the spacer (e.g., derived from immunoglobulin domains as described herein) can be attached to the scFV via a flexible linker. Specifically, the flexible linker is a glycine/serine linker of about 10-30 amino acids (for example 30, 25, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, or 5 amino acids) and comprises the structure (Gly.sub.4Ser).sub.x where Xis 1-5. In other embodiments, the glycine/serine linker comprises (Gly.sub.4Ser).sub.3.

    IV. Intracellular Signaling Domain

    [0059] The intracellular signaling domain comprises all or part of the CD3ζ chain. CD3ζ, also known as CD247, together with either the CD4 or CD8 T cell co-receptor is responsible for coupling extracellular antigen recognition to intracellular signaling cascades. In one embodiment, the CD3ζ used in any of the constructs provided herein is SEQ ID NO: 26.

    [0060] In addition to the including of the CD3ζ signaling domain, the inclusion of co-stimulatory molecules has been shown to enhance CAR T-cell activity in murine models and clinical trials. Several have been investigated including CD28, 4-1BB, ICOS, CD27, CD270, CD30 and OX-40. The CAR of the current invention, in addition to including the KappaMab scFv, flexible linker, optimal hinge and CD3ζ chain also include one or more additional costimulatory domains from CD28, 4-1BB, ICOS, CD27, CD270, CD30 and/or OX-40, for example. These co-stimulatory domains are selected based on the desired functionality of the resulting CAR T-cell. Exemplary combinations are shown, for example, in FIGS. 6A-6C. In addition to altering the length of the extracellular hinge, the inclusion of particular combinations of costimulatory domains (e.g. CD28, OX-40, 4-1BB) also enhances the proliferation and survival of CAR T-cells in vivo. In one embodiment, the CD28 domain used in any of the constructs provided herein is SEQ ID NO: 25.

    Co-Expression of Biologically Active Molecules

    [0061] The CAR T-cells of the current invention have the added benefit, when compared to the use of the KappaMAb alone to be further modifiable to contain additional biologically active molecules to enhance the anti-tumor function and/or safety of the compositions. In one embodiment, the CAR T-cells may be further genetically modified to produce antitumor cytokines which allow for focused delivery to the tumor microenvironment/cancer cells, while avoiding systemic toxicity. Examples of additional biologically active molecules which may enhance the anti-tumor response of the CAR T-cells of the current invention include, without limitation, IL-12, the carbohydrate binding protein Galectin-3 (GAL3) or it's truncated form, GAL3C, and the cytokine receptor super antagonist SANT7. In another embodiment, CAR T-cells of the current invention may also be co-transduced with a plasmid that expresses a hepatocyte growth factor (HGF) binding protein. In one embodiment, the hepatocyte growth factor protein is an antibody or fragment thereof that is able to bind to and inhibit the function of HGF.

    [0062] IL-12 is a potent tumor suppressor cytokine, decreasing tumor growth and angiogenesis and enhancing the tumor specific immune response. Multiple myeloma cells retain expression of the IL-12 receptor and administration of IL-12 to myeloma bearing mice decreases tumor progression as a single agent and acts synergistically with the proteasome inhibitor bortezomib (Airoldi, et al. (2008) Blood, 112(3):750-759; Wang, et al. (2014) Anticancer Drugs, 25(3): 282-288). Expression of IL-12 by CAR T-cells dramatically enhances their ability to eradicate solid tumors but this approach has not yet been investigated in multiple myeloma (Pegram, (2012) Blood, 119(180:4133-4141 and Zhang, et al. (2011) Mol. Ther. 19(4):751-759).

    [0063] SANT7 is a cytokine receptor super-antagonist. It is an analogue of IL-6 that has been genetically modified to enhance its binding to the IL-6 receptor a-subunit 70-fold, with virtually no interaction with the gp130 signaling subunit. SANT7 induces apoptosis in IL-6 dependent myeloma cell lines in-vitro, overcomes stroma mediated resistance to dexamethasone in in-vitro and murine model and combined with NFκB inhibitors, completely overcomes resistance to apoptosis. IL-6 is a cytokine which plays a role in the growth and survival of a variety of tumors including multiple myeloma, lung cancer, colorectal cancer, breast cancer and others. Binding of IL-6 to its receptor activates the JAK-STAT pathway, with subsequent phosphorylation of STAT3 which modulates expression of apoptosis related genes such as BCL-XL and p53, causing resistance to apoptosis. IL-6 also promotes down-regulation of the IL-12 receptor on myeloma cells, decreasing IL-12's tumor suppressive properties. (Airoldi, et al. (2008) Blood, 112(3):750-759). The IL-6 receptor is upregulated in myeloma and elevated systemic levels of IL-6 correlate with a poor prognosis. (Rawstron, et al. (2000) Blood 96(12) 3880-3886; Ludwig, et al. (1991) Blood, 77(12):2794-2795). Monoclonal antibodies to IL-6 have been developed for clinical use, however, although early clinical trials in myeloma showed measurable biological effects, the antibodies appeared to form complexes with circulating IL-6, leading to reduced clearance and potentially limiting their efficacy. (Bataille, et al. (1995) Blood, 86(2): 685-691). Recently, the chimeric IL-6 specific monoclonal antibody Siltuximab has been assessed in phase I and II clinical trials in relapsed and refractory multiple myeloma. There were no responses to Siltuximab alone, but hematological toxicity was common with more than half experiencing therapy related infections.

    [0064] Galectin-3 is a carbohydrate binding protein which may play a role in tumour adhesion and invasion. A truncated form of Galectin-3, Gal3C, acts as a dominant negative form and can inhibit myeloma cell growth and invasion. A Ga13C construct for activation inducible secretion was designed based on John et al (2003) Clin Cancer Res., 9(6):2374-83 and Mirandola et al. (2011) PLoS One, 6(7):e21811. This consists of the 143 amino acid carboxy terminal which retains its carbohydrate binding properties, but lacks the N-terminal amino acids required for ligand crosslinking. The construct also contains the CD8-alpha leader peptide to direct secretion and a 6×His tag for detection.

    [0065] In certain embodiments, in addition to expression vectors containing the CAR construct described above, T cells are further modified with one or more expression vectors comprising IL-12, SANT7 and/or GAL3C. Specifically, expression constructs expressing a single chain IL-12 comprising the IL-12 p35 subunit linked to the IL-12 p40 subunit are particularly useful in that the resulting protein is a fully bioactive IL-12 p70 heterodimer, however, expressed as a single polypeptide. In one embodiment, the single chain IL-12 construct, termed Flexi-12, is described, for example in Anderson, et al. (1997) Hum. Gene Ther. 8(9):1125-35 is used. The IL-12 single chain construct may be expressed in the same expression vector as the CAR construct or it may expressed in a separate expression vector and co-transduced into the T cell. Similarly, T cells transduced with the CAR construct described above, may be co-transduced with an additional expression vector comprising SANT7 and/or GAL3C, alternatively, one expression vector may be used to transduce T cells with both of SANT7 and GAL3C either alone or in combination and the CAR construct described above. In another embodiment three expression vectors may be used, one expressing the CAR construct, one expressing the single chain IL-12 construct and one expressing the SANT7 construct. A similar strategy may be used to co-express GAL3C with IL-12 and/or SANT7. Alternatively, the IL-12, GAL3C and/or SANT7 construct may be expressed via a single expression vector while the CAR construct is expressed by its own expression vector. One of skill in the art will appreciate the different combinations and possibilities for expressing these molecules in the same T cell.

    HGF Binding Protein

    [0066] Hepatocyte growth factor (HGF) and its receptor, MET have been implicated in cancer development and progression, in particular in tumor invasion and progression to metastatic disease. Multiple myeloma cells express both HGF and MET, thus creating both an autocrine and paracrine loop whereas normal plasma cells do not express HGF (Zhan et al. (2002); Borset, et al. (1996). Furthermore, HGF concentrations are significantly increased in the blood and bone marrow of plasma patients with multiple myeloma and high serum HGF levels correlate with advanced stage disease and extensive bone lesions (Seidel et al. (1998); Wader, et al. (2008); Alexandrakis, et al. (2003). Furthermore, serum biomarker analysis of patients in a phase I trial with KappaMab shows statistically significant dose related decrease in serum HGF after treatment with KappaMab compared to control. In order to enhance this reduction in serum HGF, in certain embodiments an HGF binding protein will be expressed in the CAR T-cells of the current invention. In a particular embodiment, the HGF binding protein expressed is an antibody or fragment thereof. In a particular embodiment, the anti-HGF binding protein is an antibody, a diabody, a scFv or an Fab. In one embodiment, the HGF binding protein is expressed in the same expression vector as the CAR construct. In a further embodiment, the HGF binding protein is expressed in a separate expression vector but is co-transduced with the CAR construct. In still a further embodiment, the CAR-T cell expresses the CAR, an HGF binding protein and IL-12. In still a further embodiment, the CAR-T cell expresses the CAR, an HGF binding protein and SANT7. In still a further embodiment, the CAR-T cell expresses the CAR, an HGF binding protein and GAL3C. In still a further embodiment, the CAR-T cell expresses the CAR, an HGF binding protein and IL-12 and GAL3C. In still a further embodiment, the CAR-T cell expresses the CAR, an HGF binding protein and SANT7 and GAL3C. In still another embodiment, the CAR-T cell expresses the CAR, an anti-HGF binding protein, IL-12 and SANT7. In still a further embodiment, the CAR-T cell expresses the CAR, an HGF binding protein, IL-12, SANT7 and GAL3C.

    Methods of Producing the CAR T-Cells of the Present Invention

    [0067] In one aspect, methods are provided for generating CAR T-cells expressing the CAR(s) described herein and optionally one or more anti-tumoral cytokine (e.g. IL-12 and/or SANT7) and/or one or more HGF binding protein. One of skill in the art will readily understand that while preferred methods of constructing expression vectors containing the CARS and anti-tumoral cytokines/antibodies of the present invention are described herein, that any methods which are able to transduce T cells to express these constituents may be used.

    [0068] In one embodiment, T cells are obtained from the blood of a subject by venous puncture, aspiration of bone marrow, steady state leukapheresis or cytokine primed leukapheresis and subsequent isolation of peripheral blood mononuclear cells including T cells using density gradient separation. In certain embodiments, after lysing red blood cells, T cells are sorted by flow cytometry or purified using antibodies to antigens expressed on T cells and magnetic beads to obtain a population of pure T cells. In a particular embodiment, T cells are sorted based on their expression of CD3 to obtain a whole T cell fraction. In another embodiment T cells are sorted based on their expression of CD4 or CD8 to obtain a population of either CD4.sup.+ T cells or CD8.sup.+ T cells. In a particular embodiment, T cells are obtained from the subject in need of CAR T-cell therapy. In another embodiment, T cells are obtained from a donor subject who is not the intended recipient of CAR T-cell therapy.

    [0069] In one embodiment, separated T cells are cultured in vivo under conditions suitable for their survival and are transduced with expression vectors containing the sequences necessary for expression of the CARs described herein and/or IL-12, SANT7, GAL3C and/or an HGF binding protein. In one embodiment, the expression vector is a transposable vector expression system. In a particular embodiment, the expression vector is a PiggyBac transposon expression plasmid or a viral vector (e.g. retroviral vector or lentiviral vector). In one embodiment, the PiggyBac transposon expression plasmid is inducible such as, for example, the PiggyBac transposon plasmid described in the Examples provided herein. In one embodiment, the PiggyBac transposon expression plasmid comprises a constitutively active promoter and/or an activation inducible promoter. The constitutively active promoter can be an elongation factor 1 alpha (EF1alpha) promoter. The activation inducible promoter can be a (NFAT pro) promoter. In one aspect, a PiggyBac expression plasmid is used and produces permanent integration of the CAR by cutting and pasting the CAR, IL-12, SANT-7, GAL3C and/or HGF binding protein coding sequences into the T cell's genome. In a particular embodiment, the expression vectors of the current invention further comprise a detectable marker which allows for identification of T cells that have been successfully transduced with the one or more expression vectors. In one embodiment, the detectable marker is chosen from the group consisting of a cell surface marker such as CD34 or CD20 or another surface protein, a fluorophore such as fluorescein isothiocyanate or any other fluorescent dye that emits light when excited to a higher energy state including by a laser, and an antibiotic resistance cassette such as kanamycin resistance, ampicillin resistance or any other cassette that confers resistance to an antibiotic substance contained in medium in which transduced T cells are to be cultured. In one embodiment, the detectable marker is a green fluorescence protein (GFP). The GFP can be an enhanced GFP, such as, for example, the constructs shown in the Examples provided herein. In a particular embodiment, each expression vector used (e.g. one expression vector comprising a CAR, and one comprising an IL-12, GAL3C and/or SANT-7 and one comprising an HGF binding protein) comprises a unique detectable marker. In one embodiment, the expression vectors are transduced into the T cell by a method suitable for the expression vector(s) selected. In one embodiment, the PiggyBac expression vector is transduced into T cells by electroporation.

    [0070] After introduction of the appropriate expression vectors, T cells may be cultured and expanded in vitro by co-culture with autologous peripheral blood mononuclear cells (PBMCs) and the appropriate growth factors and further screened for the presence of the one or more detectable markers. T cells expressing the appropriate detectable markers for the expression vectors chosen may then be sorted and purified for use in the methods of the current invention.

    Methods of Treating KMA-Expressing Malignancies

    [0071] In one aspect, methods are provided for treating subjects in need thereof with the CAR T-cells provided herein. In a particular aspect, the subject in need thereof is a human subject who has been diagnosed with or is suspected of having a malignancy that expresses KMA, for example a B cell malignancy expressing KMA. In certain embodiments, a patient has or is suspected of having multiple myeloma (MM), Waldenstroms macroglobulinemia, diffuse large B cell lymphoma (DLBCL), or amyloidosis. Methods for diagnosing B cell malignancies expressing KMA, for example, multiple myeloma (MM) Waldenstroms macroglobulinemia, diffuse large B cell lymphoma (DLBCL), and amyloidosis are known in the art, and as such are not described in detail herein. The CAR T-cells may be used alone or in combination with other therapeutically effective agents for the treatment of multiple myeloma (MM) Waldenstroms macroglobulinemia, diffuse large B cell lymphoma (DLBCL), amyloidosis or another B cell malignancy expressing KMA. In certain aspects, the CAR T-cells of the current invention are administered in a pharmaceutical formulation suitable for intravenous delivery.

    [0072] In certain aspects, the CAR T-cells of the current invention are administered before, during or after one or more immunomodulatory drugs. In a particular aspect, the one or more immunomodulatory drugs is thalidomide or a thalidomide analog such as, for example, lenolidomide or pomalidomide.

    [0073] In certain aspects of the invention, the CAR T-cells of the current invention act synergistically when administered with one or more immunomodulatory drugs.

    [0074] In a further embodiment, the CAR T-cells of the current invention are administered before, during or after treatment with one or more histone deacetylase inhibitors such as panobinostat, vorinostat, trichostatin A, depsipeptides, phenylbutyrate, valproic acid, belinostat, LAQ824, entinostat, CI944 or mocetinostat.

    [0075] In certain aspects of the invention, the CAR T-cells of the current invention act synergistically when administered in combination with one or more histone deacetylase inhibitors.

    [0076] In certain aspects of the invention, the CAR T-cells of the current invention act synergistically when administered in combination with intermediate or high dose chemotherapy and following administration of autologous or allogenic human blood stem cells.

    [0077] In one embodiment, the CAR T-cells of the current invention are administered before, during or after an allogenic stem cell transplant. In still another embodiment, the CAR T-cells of the current invention are administered before during or after an allogenic stem cell transplant. Without being bound by theory, the CAR T-cells of the present invention, when administered in combination with an autologous or allogeneic stem cell transplant prevent the appearance of minimal residual disease that may occur by incomplete ablation of the bone marrow prior to stem cell transplant or by reemergence of malignant B cell clones expressing KMA.

    [0078] All patents, patent applications, and publications cited herein are expressly incorporated by reference in their entirety for all purposes.

    EXAMPLES

    [0079] The invention is further described in detail by reference to the following experimental examples. These examples are provided for the purposes of illustration only and are not intended to be limiting unless otherwise specified. Thus, the invention should in no way be construed as being limited to the following examples, but rather, should be construed to encompass any and all variations which become evident as a result of the teaching provided herein.

    [0080] Without further description, it is believed that one of ordinary skill in the art can using the preceding description and following examples, make and utilize the compounds of the present invention and practice the claimed methods. The following working examples, therefore, specifically point out the preferred embodiments of the present invention and are not to be construed as limiting in any way the remainder of the disclosure.

    Example 1: Generation of KMA.CAR-28z

    [0081] Based on the nucleotide sequence coding for the variable regions of KappaMab (SEQ ID NOS: 9 and 10), a scFv was designed and cloned into a CAR construct containing an immunoglobulin heavy chain hinge, a CD28 co-stimulatory domain and the CD3-zeta endodomain (FIG. 6A). The construct was designed in Clone Manage 9 (Sci-Ed Software) using the genetic sequence of the antibody variable regions provided by Haemalogix Pty Ltd. The amino acid sequence from 5′ to 3′ of portions of this construct(i.e., KM.CAR-hCH2CH3-28z; FIG. 6A) are as follows:

    [0082] The Ig heavy chain leader peptide (Uniprot P01764) is

    TABLE-US-00001 (SEQ ID NO: 20) MEFGLSWLFLVAILKGVQCSR.

    [0083] The KappaMab antibody light chain variable region is

    TABLE-US-00002 (SEQ ID NO: 21) DIVMTQSQKFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQSPKALIYS TSYRYSGVPDRFTGSGSGTDFTLTISNVQSEDLAEYFCQQYNSYPYTFGG GTKLEIK.

    [0084] The heavy chain variable region is

    TABLE-US-00003 (SEQ ID NO: 22) EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGR IDPANGNTKYDPKFQGKATIIADTSSNTAYLQLSSLTSEDTAVYYCARGV YHDYDGDYWGQGTTLTVSSYVTVSS.

    [0085] The (G4S).sub.3 flexible linker is

    TABLE-US-00004 (SEQ ID NO: 23) GGGGSGGGGSGGGGS.

    [0086] The hinge, CH2 and CH3 domains of IgG1 constant region with a C>P mutation in the hinge region at amino acid position 103 (Uniprot P01857) is

    TABLE-US-00005 (SEQ ID NO: 24) YVTVSSQDPAEPKSPDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKKDPK.

    [0087] The transmembrane and intracellular domains of CD28 (Uniprot P10747) is

    TABLE-US-00006 (SEQ ID NO: 25) FWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPT RKHYQPYAPPRDFAAYRS.

    [0088] The intracellular domain of human CD3 zeta (Uniprot P20963) is

    TABLE-US-00007 (SEQ ID NO: 26) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR.

    [0089] The full length amino acid sequence as follows is

    TABLE-US-00008 (SEQ ID NO: 27) MEFGLSWLFLVAILKGVQCSRDIVMTQSQKFMSTSVGDRVSVTCKASQNV GTNVAWYQQKPGQSPKALIYSTSYRYSGVPDRFTGSGSGTDFTLTISNVQ SEDLAEYFCQQYNSYPYTFGGGTKLEIKGGGGSGGGGSGGGGSEVQLQQS GAELVKPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGRIDPANGN TKYDPKFQGKATIIADTSSNTAYLQLSSLTSEDTAVYYCARGVYHDYDGD YWGQGTTLTVSSYVTVSSQDPAEPKSPDKTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRE EQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP REPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL SPGKKDPKFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNM TPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNEL NLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEI GMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR.

    [0090] This amino acid sequence (SEQ ID NO: 27) is encoded by the following DNA sequence:

    TABLE-US-00009 (SEQ ID NO: 28) ATGGAGTTTGGGCTGAGCTGGCTTTTTCTTGTGGCTATTTTAAAAGGTGT CCAGTGCTCTAGAGACATCGTCATGACCCAGTCTCAAAAATTCATGTCCA CATCAGTAGGAGACAGGGTCAGCGTCACCTGCAAGGCCAGTCAGAATGTG GGTACTAATGTAGCCTGGTATCAACAGAAACCAGGGCAATCTCCTAAAGC ACTGATTTACTCGACATCCTACCGGTACAGTGGAGTCCCTGATCGCTTCA CAGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAATGTGCAG TCTGAAGACTTGGCAGAGTATTTCTGTCAGCAATATAACAGCTATCCGTA CACGTTCGGAGGGGGGACCAAGCTGGAAATAAAGGGTGGCGGTGGCTCGG GCGGTGGTGGGTCGGGTGGCGGCGGATCTGAGGTGCAGCTGCAGCAGTCA GGGGCGGAGCTTGTGAAGCCAGGGGCCTCAGTCAAGTTGTCCTGTACAGC TTCTGGCTTCAACATTAAAGACACCTATATGCACTGGGTGAAGCAGAGGC CTGAACAGGGCCTGGAGTGGATTGGAAGGATTGATCCTGCGAATGGTAAC ACTAAATATGACCCGAAGTTCCAGGGCAAGGCCACTATAATAGCAGACAC ATCCTCCAACACAGCCTACCTGCAGCTCAGCAGCCTGACATCTGAGGACA CTGCCGTCTATTACTGTGCTAGGGGGGTCTACCATGATTACGACGGGGAC TACTGGGGCCAAGGGACCACGCTCACCGTCTCCTCCTACGTCACCGTCTC TTCACAGGATCCCGCCGAGCCCAAATCTCCTGACAAAACTCACACATGCC CACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTTC CCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCAC ATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACT GGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAG GAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCA CCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAG CCCTCCCAGCCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCC CGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAA GAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACA TCGCCGTGGAGTGGGAGAGCAATGGGCAACCGGAGAACAACTACAAGACC ACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCT CACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCG TGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTG TCTCCGGGTAAAAAAGATCCCAAATTTTGGGTGCTGGTGGTGGTTGGTGG AGTCCTGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCT GGGTGAGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATG ACTCCCCGCCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCC ACCACGCGACTTCGCAGCCTATCGCTCCAGAGTGAAGTTCAGCAGGAGCG CAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTC AATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCG GGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGCC TGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATT GGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCA GGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGG CCCTGCCCCCTCGC.

    [0091] In terms of constructing this construct, a gene sequence consisting of a 5′ EcoRI restriction enzyme site, a 5′ Kozak sequence, Leader Peptide, single chain variable fragment and a portion of the IgG1 constant region incorporating an Alel restriction enzyme site, was synthesised by GeneArt (ThermoFisher Scientific), sequence verified and then cloned into the pIRII-CAR.CD19-28z PiggyBac transposon expression plasmid. This was then introduced into donor T-cells from 2 normal donors by co-electroporation with the PiggyBac Transposase plasmid to mediate stable integration. The PiggyBac transposon/transposase system produces permanent integration of the CAR by cutting and pasting the gene of interest into the target cell genome. The PiggyBac expression system was chosen because it is capable of producing high levels of permanent genetic modification at a fraction of the cost of retroviral vectors. However, one of skill in the art will understand that other expression systems, including retroviral vectors could also be used in accordance with the current invention.

    [0092] The KM.CAR-hCH2CH3-28z expressing T-cells were expanded according to our optimised protocols by co-culturing with autologous peripheral blood mononuclear (PBMC) feeder cells supplemented with interleukin-15 (IL-15) 10 ng/ml. After culturing for 3 weeks with replacement of PBMCs on a weekly basis and replenishment of IL-15 two to three times per week, T-cells were harvested and assessed for phenotype and CAR expression by flow cytometry, KMA-specific function by interferon gamma intracellular cytokine flow cytometry on stimulation with KMA+ and KMA− cell lines (FIG. 4A) and cytotoxicity of the same cell lines in a chromium release assay.

    [0093] At the end of 3 weeks, the cultures were predominantly CAR expressing CD3.sup.+ T-cells (55% and 70% of live cells), expressed interferon-gamma in response to KMA.sup.+ myeloma and B-cell lines (FIG. 4B) and demonstrated KMA-specific cytotoxicity (FIG. 4C).

    Example 2: Establishing a Human Myeloma Xenograft Murine Model

    [0094] A human myeloma to mouse xenotransplant model of multiple myeloma was established. RPMI8226 or alternative myeloma cell lines were inoculated i.v. into Rag2−/−γc−/− (BALB/c) mice to form the Rag MM model (FIG. 5A-5D). The Rag2−/−γc−/− (BALB/c) mice lack mouse lymphocytes (T, B and NK cells) and are receptive hosts for human xenograft studies. This model has been used successfully to test novel therapeutics such as bortezomib in combination with a novel antibody (FIG. 5E). We will use this MM model to test and further optimize the KMA.CAR T cells.

    Example 3: Optimized KMA.CAR Constructs

    [0095] Based on the construct described in Example 1, 6 CAR constructs containing the KM scFv described in Example 1 with variable length spacer regions and co-stimulatory endodomains (e.g., CD28 or 4-1BB (CD137-Uniport Q07011)) with the CD3 zeta endodomain were constructed (FIG. 2 & FIGS. 6B-6D). Varying the spacer length altered the distance between the T-cell and the target cell with a shorter spacer potentially enhancing target cell lysis. In all constructs, the CD28 transmembrane domain was used to ensure stable T-cell surface expression of the KMA.CARs. In all cases where components of the IgG1 heavy chain constant region was used as a spacer, a second (G4S).sub.3 flexible linker was placed between the scFv and the spacer region. These CARs were synthesised commercially by genscript and cloned into a pVAX1PB PiggyBac transposon plasmid for further testing.

    [0096] 3 of the 6 KM.CAR constructs contained aCD28 Costimulatory Endodomain and were as follows:

    [0097] The first construct of this group was the KM.CAR_hCH3_28z construct, which contains only the hinge and CH3 domains of IgG1 heavy chain constant region as the spacer and whose nucleic acid sequence is as follows:

    TABLE-US-00010 (SEQ ID NO: 29) ATGGAGTTTGGGCTGAGCTGGCTTTTTCTTGTGGCTATTTTAAAAGGTGT CCAGTGCTCTAGAGACATCGTCATGACCCAGTCTCAAAAATTCATGTCCA CATCAGTAGGAGACAGGGTCAGCGTCACCTGCAAGGCCAGTCAGAATGTG GGTACTAATGTAGCCTGGTATCAACAGAAACCAGGGCAATCTCCTAAAGC ACTGATTTACTCGACATCCTACCGGTACAGTGGAGTCCCTGATCGCTTCA CAGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAATGTGCAG TCTGAAGACTTGGCAGAGTATTTCTGTCAGCAATATAACAGCTATCCGTA CACGTTCGGAGGGGGGACCAAGCTGGAAATAAAGGGTGGCGGTGGCTCGG GCGGTGGTGGGTCGGGTGGCGGCGGATCTGAGGTGCAGCTGCAGCAGTCA GGGGCGGAGCTTGTGAAGCCAGGGGCCTCAGTCAAGTTGTCCTGTACAGC TTCTGGCTTCAACATTAAAGACACCTATATGCACTGGGTGAAGCAGAGGC CTGAACAGGGCCTGGAGTGGATTGGAAGGATTGATCCTGCGAATGGTAAC ACTAAATATGACCCGAAGTTCCAGGGCAAGGCCACTATAATAGCAGACAC ATCCTCCAACACAGCCTACCTGCAGCTCAGCAGCCTGACATCTGAGGACA CTGCCGTCTATTACTGTGCTAGGGGGGTCTACCATGATTACGACGGGGAC TACTGGGGCCAAGGGACCACGCTCACCGTCTCCTCCGGTGGAGGCGGGTC TGGGGGCGGAGGTTCAGGCGGGGGTGGTTCCGAGCCCAAATCTCCTGACA AAACTCACACATGCCCAGGGCAGCCCCGAGAACCACAGGTGTACACCCTG CCCCCATCCCGGGATGAGCTGACCAAGAACCAGGTCAGCCTGACCTGCCT GGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATG GGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGAC GGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCA GCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACC ACTACACACAGAAGAGCCTCTCCCTGTCTCCGGGTAAA custom-charactercustom-character custom-charactercustom-character custom-charactercustom-character custom-charactercustom-character custom-character custom-character custom-character custom-character custom-characterAGAGTGAAGTTCAGCAGGAGCGCAG ACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAAT CTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGA CCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGCCTGT ACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGG ATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGG TCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCC TGCCCCCTCGC.

    [0098] From 5′ to 3′, this construct (SEQ ID NO: 29) has a leader peptide, a KappaMab light chain variable region, a (G4S).sub.3 linker, a KappaMab heavy chain variable region, a second (G4S).sub.3 linker, an IgG1 hinge & CH3 constant region domains, a CD28 transmembrane and intracellular domains, and a CD3 zeta intracellular domain. A diagram of this construct is shown in FIG. 6B.

    [0099] The second construct of this group is the KM.CAR_h_28z construct, which contains only the hinge domain of IgG1 heavy chain constant region as the spacer, and whose nucleic acid sequence is as follows:

    TABLE-US-00011 (SEQ ID NO: 30) ATGGAGTTTGGGCTGAGCTGGCTTTTTCTTGTGGCTATTTTAAAAGGTGT CCAGTGCTCTAGAGACATCGTCATGACCCAGTCTCAAAAATTCATGTCCA CATCAGTAGGAGACAGGGTCAGCGTCACCTGCAAGGCCAGTCAGAATGTG GGTACTAATGTAGCCTGGTATCAACAGAAACCAGGGCAATCTCCTAAAGC ACTGATTTACTCGACATCCTACCGGTACAGTGGAGTCCCTGATCGCTTCA CAGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAATGTGCAG TCTGAAGACTTGGCAGAGTATTTCTGTCAGCAATATAACAGCTATCCGTA CACGTTCGGAGGGGGGACCAAGCTGGAAATAAAGGGTGGCGGTGGCTCGG GCGGTGGTGGGTCGGGTGGCGGCGGATCTGAGGTGCAGCTGCAGCAGTCA GGGGCGGAGCTTGTGAAGCCAGGGGCCTCAGTCAAGTTGTCCTGTACAGC TTCTGGCTTCAACATTAAAGACACCTATATGCACTGGGTGAAGCAGAGGC CTGAACAGGGCCTGGAGTGGATTGGAAGGATTGATCCTGCGAATGGTAAC ACTAAATATGACCCGAAGTTCCAGGGCAAGGCCACTATAATAGCAGACAC ATCCTCCAACACAGCCTACCTGCAGCTCAGCAGCCTGACATCTGAGGACA CTGCCGTCTATTACTGTGCTAGGGGGGTCTACCATGATTACGACGGGGAC TACTGGGGCCAAGGGACCACGCTCACCGTCTCCTCCGGTGGAGGCGGGTC TGGGGGCGGAGGTTCAGGCGGGGGTGGTTCCGAGCCCAAATCTCCTGACA AAACTCACACATGCcustom-character custom-character custom-character custom-character custom-character custom-character custom-character custom-character custom-character custom-character custom-character custom-character AGAGTGAAGTTCAG CAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATA ACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGA CGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCA GGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACA GTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGC CTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCA CATGCAGGCCCTGCCCCCTCGC.

    [0100] From 5′ to 3′, this construct (SEQ ID NO: 30) has a leader peptide, a KappaMab light chain variable region, a (G45).sub.3 linker, a KappaMab heavy chain variable region, a second (G4S).sub.3 linker, an IgG1 hinge constant region domain, a CD28 transmembrane and intracellular domains, and a CD3 zeta intracellular domain. A diagram of this construct is shown in FIG. 6B.

    [0101] The third construct of this group was the KM. CAR_CD8a_28z construct, which contains a CD8 alpha stalk (Uniprot P01732, amino acids 138-182) as the spacer, and whose nucleic sequence is as follows:

    TABLE-US-00012 (SEQ ID NO: 31) ATGGAGTTTGGGCTGAGCTGGCTTTTTCTTGTGGCTATTTTAAAAGGTGT CCAGTGCTCTAGAGACATCGTCATGACCCAGTCTCAAAAATTCATGTCCA CATCAGTAGGAGACAGGGTCAGCGTCACCTGCAAGGCCAGTCAGAATGTG GGTACTAATGTAGCCTGGTATCAACAGAAACCAGGGCAATCTCCTAAAGC ACTGATTTACTCGACATCCTACCGGTACAGTGGAGTCCCTGATCGCTTCA CAGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAATGTGCAG TCTGAAGACTTGGCAGAGTATTTCTGTCAGCAATATAACAGCTATCCGTA CACGTTCGGAGGGGGGACCAAGCTGGAAATAAAGGGTGGCGGTGGCTCGG GCGGTGGTGGGTCGGGTGGCGGCGGATCTGAGGTGCAGCTGCAGCAGTCA GGGGCGGAGCTTGTGAAGCCAGGGGCCTCAGTCAAGTTGTCCTGTACAGC TTCTGGCTTCAACATTAAAGACACCTATATGCACTGGGTGAAGCAGAGGC CTGAACAGGGCCTGGAGTGGATTGGAAGGATTGATCCTGCGAATGGTAAC ACTAAATATGACCCGAAGTTCCAGGGCAAGGCCACTATAATAGCAGACAC ATCCTCCAACACAGCCTACCTGCAGCTCAGCAGCCTGACATCTGAGGACA CTGCCGTCTATTACTGTGCTAGGGGGGTCTACCATGATTACGACGGGGAC TACTGGGGCCAAGGGACCACGCTCACCGTCTCCTCCACCACGACGCCAGC GCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCC TGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGG GGGCTGGACTTCGCCTGTGcustom-character custom-character custom-charactercustom-character custom-charactercustom-character custom-charactercustom-character custom-charactercustom-character custom-characterAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGC GTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAA GAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATG GGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACT GCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCG AGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACA GCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCG C.

    [0102] From 5′ to 3′, this construct (SEQ ID NO: 31) has a leader peptide, a KappaMab light chain variable region, a (G4S).sub.3 linker, a KappaMab heavy chain variable region, a CD8 alpha stalk, a CD28 transmembrane and intracellular domains, and a CD3 zeta intracellular domain.

    [0103] The remaining 3 constructs of the 6 KM.CAR constructs described in this example contained a 4-1BB (CD137) Costimulatory Endodomain and were as follows:

    [0104] The first construct of this group is KM.CAR_h_28TM_41BBz, which contains only the hinge domain of IgG1 heavy chain constant region as the spacer and replaces the intracellular domain of CD28 with the intracellular domain of the 4-1BB co-stimulatory molecule, and whose nucleic acid sequence is as follows:

    TABLE-US-00013 (SEQ ID NO: 32) ATGGAGTTTGGGCTGAGCTGGCTTTTTCTTGTGGCTATTTTAAAAGGTGT CCAGTGCTCTAGAGACATCGTCATGACCCAGTCTCAAAAATTCATGTCCA CATCAGTAGGAGACAGGGTCAGCGTCACCTGCAAGGCCAGTCAGAATGTG GGTACTAATGTAGCCTGGTATCAACAGAAACCAGGGCAATCTCCTAAAGC ACTGATTTACTCGACATCCTACCGGTACAGTGGAGTCCCTGATCGCTTCA CAGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAATGTGCAG TCTGAAGACTTGGCAGAGTATTTCTGTCAGCAATATAACAGCTATCCGTA CACGTTCGGAGGGGGGACCAAGCTGGAAATAAAGGGTGGCGGTGGCTCGG GCGGTGGTGGGTCGGGTGGCGGCGGATCTGAGGTGCAGCTGCAGCAGTCA GGGGCGGAGCTTGTGAAGCCAGGGGCCTCAGTCAAGTTGTCCTGTACAGC TTCTGGCTTCAACATTAAAGACACCTATATGCACTGGGTGAAGCAGAGGC CTGAACAGGGCCTGGAGTGGATTGGAAGGATTGATCCTGCGAATGGTAAC ACTAAATATGACCCGAAGTTCCAGGGCAAGGCCACTATAATAGCAGACAC ATCCTCCAACACAGCCTACCTGCAGCTCAGCAGCCTGACATCTGAGGACA CTGCCGTCTATTACTGTGCTAGGGGGGTCTACCATGATTACGACGGGGAC TACTGGGGCCAAGGGACCACGCTCACCGTCTCCTCCGGTGGAGGCGGGTC TGGGGGCGGAGGTTCAGGCGGGGGTGGTTCCGAGCCCAAATCTCCTGACA AAACTCACACATGCCCAcustom-character custom-character custom-character custom-character custom-character custom-charactercustom-character custom-charactercustom-character custom-charactercustom-character custom-characterAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACC AGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAG GAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGG AAAGCCGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGA AAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGC CGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCAC CAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGC.

    [0105] From 5′ to 3′, this construct (SEQ ID NO: 32) has a leader peptide, a KappaMab light chain variable region, a (G4S).sub.3 linker, a KappaMab heavy chain variable region, a second (G4S).sub.3 linker, an IgG hinge constant region domain, a CD28 transmembrane domain, a 4-JBB intracellular domain, and a CD3 zeta intracellular domain.

    [0106] The second construct of this group was KM.CAR_8a_28TM_41BBz, which contains the CD8 alpha stalk (Uniprot P01732, amino acids 138-182) as the spacer and replaces the intracellular domain of CD28 with the intracellular domain of the 4-1BB co-stimulatory molecule, and whose nucleic sequence is as follows:

    TABLE-US-00014 (SEQ ID NO: 33) ATGGAGTTTGGGCTGAGCTGGCTTTTTCTTGTGGCTATTTTAAAAGGTGT CCAGTGCTCTAGAGACATCGTCATGACCCAGTCTCAAAAATTCATGTCCA CATCAGTAGGAGACAGGGTCAGCGTCACCTGCAAGGCCAGTCAGAATGTG GGTACTAATGTAGCCTGGTATCAACAGAAACCAGGGCAATCTCCTAAAGC ACTGATTTACTCGACATCCTACCGGTACAGTGGAGTCCCTGATCGCTTCA CAGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAATGTGCAG TCTGAAGACTTGGCAGAGTATTTCTGTCAGCAATATAACAGCTATCCGTA CACGTTCGGAGGGGGGACCAAGCTGGAAATAAAGGGTGGCGGTGGCTCGG GCGGTGGTGGGTCGGGTGGCGGCGGATCTGAGGTGCAGCTGCAGCAGTCA GGGGCGGAGCTTGTGAAGCCAGGGGCCTCAGTCAAGTTGTCCTGTACAGC TTCTGGCTTCAACATTAAAGACACCTATATGCACTGGGTGAAGCAGAGGC CTGAACAGGGCCTGGAGTGGATTGGAAGGATTGATCCTGCGAATGGTAAC ACTAAATATGACCCGAAGTTCCAGGGCAAGGCCACTATAATAGCAGACAC ATCCTCCAACACAGCCTACCTGCAGCTCAGCAGCCTGACATCTGAGGACA CTGCCGTCTATTACTGTGCTAGGGGGGTCTACCATGATTACGACGGGGAC TACTGGGGCCAAGGGACCACGCTCACCGTCTCCTCCACCACGACGCCAGC GCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCC TGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGG GGGCTGGACTTCGCCTGTGATcustom-character custom-character custom-charactercustom-character custom-charactercustom-character custom-charactercustom-character custom-charactercustom-charactercustom-characterGAAGTTCAGCAGGAGCGCAGACGCCCCC GCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACG AAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGA TGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAA CTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGG CGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTA CAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCT CGC.

    [0107] From 5′ to 3′, this construct (SEQ ID NO: 33) has a leader peptide, a KappaMab light chain variable region, a (G4S).sub.3 linker, a KappaMab heavy chain variable region, a CD8 alpha stalk, a CD28 transmembrane domain, a 4-1BB intracellular domain, and a CD3 zeta intracellular domain.

    [0108] The third construct of this group is KM.CAR_hCH2CH3mut_28TM_41BBz, which contains the hinge, CH2 and CH3 domains of IgG1 heavy chain constant region as the spacer, with mutations introduced at amino acids important for CH2 interaction with Fc-receptors (3-6) which may mediate reduced CAR T-cell survival in-vivo (3, 6, 7) by clearance of CAR T-cells in the reticuloendothelial system. The nucleic acid sequence is as follows:

    TABLE-US-00015 (SEQ ID NO: 34) ATGGAGTTTGGGCTGAGCTGGCTTTTTCTTGTGGCTATTTTAAAAGG TGTCCAGTGCTCTAGAGACATCGTCATGACCCAGTCTCAAAAATTCATGTCCA CATCAGTAGGAGACAGGGTCAGCGTCACCTGCAAGGCCAGTCAGAATGTGG GTACTAATGTAGCCTGGTATCAACAGAAACCAGGGCAATCTCCTAAAGCACT GATTTACTCGACATCCTACCGGTACAGTGGAGTCCCTGATCGCTTCACAGGC AGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAATGTGCAGTCTGAAG ACTTGGCAGAGTATTTCTGTCAGCAATATAACAGCTATCCGTACACGTTCGG AGGGGGGACCAAGCTGGAAATAAAGGGTGGCGGTGGCTCGGGCGGTGGTGGG TCGGGTGGCGGCGGATCTGAGGTGCAGCTGCAGCAGTCAGGGGCGGAGCTTGTGAA GCCAGGGGCCTCAGTCAAGTTGTCCTGTACAGCTTCTGGCTTCAACATTAAAGACACC TATATGCACTGGGTGAAGCAGAGGCCTGAACAGGGCCTGGAGTGGATTGGAAGGATT GATCCTGCGAATGGTAACACTAAATATGACCCGAAGTTCCAGGGCAAGGCCACTATAA TAGCAGACACATCCTCCAACACAGCCTACC TGCAGCTCAGCAGCCTGACATCTGAGGA CACTGCCGTCTATTACTGTGCTAGGGGGGTCTACCATGATTACGACGGGGACTACTGG GGCCAAGGGACCACGCTCACCGTCTCCTCCGGTGGAGGCGGGTCTGGGGGCGGAG GTTCAGGCGGGGGTGGTTCCGAGCCCAAATCTCCTGACAAAACTCACACATGC [00001]embedded image [00002]embedded image [00003]embedded image TGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAG [00004]embedded image TGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCA GCCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCA CAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCAGGTC AGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAG TGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTG CTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGA GCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTC [00005]embedded image [00006]embedded image [00007]embedded image [00008]embedded image [00009]embedded image CAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAG GACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGG GGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAG ATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGC AAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGAC GCCCTTCACATGCAGGCCCTGCCCCCTCGC.

    [0109] From 5′ to 3′, this construct (SEQ ID NO: 34) has a leader peptide, a KappaMab light chain variable region, a (G4S).sub.3 linker, a KappaMab heavy chain variable region, a second (G4S).sub.3 linker, a mutated IgG1 hinge, CH2 and CH3 constant region domains, a CD28 transmembrane domain, a 4-1BB intracellular domain, and a CD3 zeta intracellular domain. The mutated IgG1 hinge domain has, from 5′ to 3′, E233P, L234V, L235A, G236-, S254A, D265N, and N297A mutations highlighted within the shaded boxes of this construct (SEQ ID NO: 34). Mutations at these sites (E233P, L234V, L235A, G236-, S254A, D265N, N297A) may decrease Fc interaction with CAR T-cells, allowing improved survival post-infusion.

    [0110] Addition of 2A ribosomal skip element and eGFP to KM.CARs

    [0111] For ease of detection of T-cells expressing each of the CARs described above, an eGFP with a 5′ T2A ribosomal skip element with overlapping sequences was synthesized with the CAR-CD3 zeta endodomain and the plasmid backbone. This was then cloned by restriction enzyme digestion and ligation into the CAR containing pVAX1 PB transposon plasmids to create the following—

    [0112] 28z Endodomain_2A_GFP Containing Constructs:

    [0113] 1. pVAX1PB KM.CAR_hCH2CH3_28z_2A_GFP

    [0114] 2. pVAX1PB KM.CAR_hCH3_28z_2A_GFP

    [0115] 3. pVAX1PB KM.CAR_h_28z_2A_GFP

    [0116] 4. pVAX1PB KM. CAR_8a_28z_2A_GFP

    [0117] 41BBz Endodomain_2A_GFP Containing Constructs:

    [0118] 1. pVAX1PB KM.CAR_h_28TM_41BBz_2A_GFP

    [0119] 2. pVAX1PB KM. CAR_8a_28TM_41BBz_2A_GFP

    [0120] 3. pVAX1PB KM.CAR_hCH2CH3mut_28TM_41BBz_2A_GFP

    [0121] Generation of KM.CAR T-Cells with 4-1BB Costimulatory Domain.

    [0122] Comparison was made between the preliminary KM.CAR_hCH2CH3_28z and the 4-1BB containing CARs. KM.CAR T-cells were generated by electroporation using the PiggyBac system as previously described herein and in the art (2). Four million peripheral blood mononuclear cells (PBMCs) from healthy donors were electroporated with the Neon electroporation system at 2400V for 20 ms, single pulse, in the presence of 5 ug each of PiggyBac transposase and PiggyBac Transposon plasmids. KMA.CAR constructs tested included KM.CAR_hCH2CH3_28z_2A_GFP; KM.CAR_h_28TM_41BBz 2A_GFP; KM.CAR_8a_28TM_41BBz 2A GFP; or KM.CAR hCH2CH3mut 28TM 41BBz 2A GFP.

    [0123] Electroporated PBMCs (CAR-PBMCs) were rested overnight in AIMV with 10% Fetal calf serum (AIM-V CM), harvested, washed and resuspended in AIM-V CM at 1×10.sup.6/ml. CAR-PBMCs were cocultured with autologous irradiated PBMC feeder cells with or without irradiated KMA expressing JJN3 cells at a CAR-PBMC:JJN3 ratio of 5:1. Interleukin-15 (IL-15) was added at 10 ng/ml every 3 days. Cells were enumerated by trypan blue exclusion and fresh irradiated stimulator/feeder cells were added every 7 days.

    [0124] Assessment of KM.CAR Expression

    [0125] KM.CAR expression was assessed by flow cytometry at initiation of culture (Day 1), Day 15 and Day 21 (FIGS. 8A-8B). KM.CAR T-cell cultures were surface stained with anti-human-CD3 antibody and CAR expression assessed by GFP expression.

    [0126] KM.CAR T-Cells Require Kappa Myeloma Antigen to Persist In-Vitro

    [0127] Cultures containing the KMA expressing JJN3 cell line showed either greater total expansion, increased KM.CAR expression or both, compared to cultures with PBMC alone (FIGS. 8A-8B). Consistent with known interaction of the IgG constant region-CH2 domain with Fc-receptors, the KM.CAR_hCH2CH3_28z expressing T-cells were enriched in the presence of PBMC alone (28% of CD3.sup.+ T-cells), but showed greater expansion and enrichment with addition of JJN3 cells (15-fold expansion with 38% CAR expression compared to 6-fold expansion with 29% CAR expression).

    [0128] KM.CAR_hCH2CH3mut_28TM_41BBz expressing T-cells showed only low level CAR expression (6%) and expansion (6-fold) with PBMC alone compared to co-culture with JJN3 (26% CAR expression and 17-fold expansion). The KM.CAR T-cells containing the IgG1 hinge only spacer had similar expansion (5-fold with JJN3, 6 fold without JJN3) but increased CAR expression (17% with JJN3, 9% without). Only the KM.CAR T-cells containing the CD8alpha chain spacer did not show any enhanced expansion or enrichment in the presence of JJN3 cells (8-fold expansion and 5% CAR expression in the presence of JJN3, compared to 5-fold expansion and 5% CAR expression without JJN3).

    [0129] Functional Assessment of KM.CAR T-Cells

    [0130] KMA-specific interferon-gamma production and cytotoxicity of KM.CAR T-cells were assessed by intracellular cytokine flow cytometry and standard chromium release assay with KMA+ and KMA− cell lines using protocols previously described (2). KMA positive cell lines used included JJN3, Pfeiffer, NCI-H929. KMA negative cell lines included Nalm-6 and Molt (FIG. 12A-12B).

    [0131] For cytokine flow cytometry, 2×10.sup.5 KM.CAR T-cells were stimulated with target cells at a ratio of 1:1 for 5 hours. Monensin (2 μM) (BD Biosciences) and Brefeldin A (1 μg/mL) (BD Biosciences) were added after 1 hour. CAR T-cells activated non-specifically with 50 ng/ml phorbol myristate acetate (PMA: Sigma-Aldrich) and lug/ml ionomycin (Sigma-Aldrich) and unstimulated cells were used as positive and negative controls. CAR T-cells were then harvested, washed, surface stained for CD3, CD4 and CD8. CAR T-cells were fixed and permeabilised with cytofix and perm/wash buffer (BD Biosciences) and stained with anti-interferon gamma antibody (BD Biosciences) followed by further washing with perm/wash buffer. Stained cells were analysed using a FACSCanto™ II flow cytometer with acquisition of at least 30,000 events.

    [0132] KMA-specific cytotoxicity was assessed using a standard chromium (.sup.51Cr) release assay. Target cells were labelled with Sodium chromate (Na.sub.2.sup.51CrO.sub.4) (Perkin-Elmer, Waltham, Mass., USA). KM.CAR T-cells were preincubated with the K562 cell line at a 1:1 ratio to absorb NK cell activity. Chromium labelled target cells were added to the KM.CAR T-cells in triplicate at effector:target ratios ranging from 40:1 to 1.25:1 and incubated at 37° C., 5% CO.sub.2 for 4 hours. Triplicate targets were lysed with 10% sodium dodecyl sulphate to determine maximal release and triplicate targets with no effectors were used to assess spontaneous release. Supernatants were aspirated and read using a MicroBeta2 Plate Counter (PerkinElmer). Percentage specific lysis was calculated using the standard formula—%


    Specific lysis=(test release−spontaneous release)/(maximal release−spontaneous release)×100]

    Example 4: Generation of PiggyBac Transposon Plasmid with the Activation Inducible Promoter

    [0133] A single transposon cassette containing a constitutively active promoter (EF 1 alpha) and an activation inducible promoter (NFATpro) was designed and cloned. The activation inducible gene expression cassette was produced by designing the NFATpro using Clone Manage 9 (Sci-Ed Software), based on Fiering et al(8). This includes 6 copies of the 30 base pair DNA sequence (response element-RE) bound by the Nuclear Factor of Activated T-cells (NFAT-RE)-GGAGGAAAAACTGTTTCATACAGAAGGCGT (SEQ ID NO: 35) followed by the minimal IL-2 promoter-ACATTTTGACACCCCCATAATATTTTTCCAGAATTAACAGTATAAATTGCATCTCT TGTTCAAGAGTTCCCTATCACTCTCTTTAATCACTACTCACAGTAACCTCAACTCC TG (SEQ ID NO: 36) found on chromosome 4 (NCBI Reference Sequence: NG_016779.1).

    [0134] To enable detection of activation induced gene expression, the enhanced green fluorescent protein (eGFP) DNA sequence followed by the bovine growth hormone (BGH) polyadenylation signal (9-11) was placed 3′ of the NFATpro. The DNA sequence of this gene cassette is as follows—

    TABLE-US-00016 (SEQ ID NO: 37) GGAGGAAAAACTGTTTCATACAGAAGGCGTCAATTAGGAGGAAAAACTGT TTCATACAGAAGGCGTCAATTAGGAGGAAAAACTGTTTCATACAGAAGGC GTCAATTGTCCCATCGAATTAGGAGGAAAAACTGTTTCATACAGAAGGCG TCAATTAGGAGGAAAAACTGTTTCATACAGAAGGCGTCAATTAGGAGGAA AAACTGTTTCATACAGAAGGCGTCAATTGTCCCGGGACATTTTGACACCC CCATAATATTTTTCCAGAATTAACAGTATAAATTGCATCTCTTGTTCAAG AGTTCCCTATCACTCTCTTTAATCACTACTCACAGTAACCTCAACTCCTG AACTCCATGGATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGC CCATCCTGGTCGAGCTGGACGGCGACGTAAACGGCCACAAGTTCAGCGTG TCCGGCGAGGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTT CATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCA CCCTGACCTACGGCGTGCAGTGCTTCAGCCGCTACCCCGACCACATGAAG CAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCG CACCATCTTCTTCAAGGACGACGGCAACTACAAGACCCGCGCCGAGGTGA AGTTCGAGGGCGACACCCTGGTGAACCGCATCGAGCTGAAGGGCATCGAC TTCAAGGAGGACGGCAACATCCTGGGGCACAAGCTGGAGTACAACTACAA CAGCCACAACGTCTATATCATGGCCGACAAGCAGAAGAACGGCATCAAGG TGAACTTCAAGATCCGCCACAACATCGAGGACGGCAGCGTGCAGCTCGCC GACCACTACCAGCAGAACACCCCCATCGGATCCGGAGCCACGAACTTCTC TCTGTTAAAGCAAGCAGGAGACGTTGAAGAAAACCCCGGTCCTATTTAAA TCCTCGACTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCC CGTGCCTTCCTTGACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAAT AAAATGAGGAAATTGCATCGCATTGTCTGAGTAGGTGTCATTCTATTCTG GGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAAGACAATAG CAGGCATGCTGGGGATGCGGTGGGCTCTATGGC.

    [0135] From 5′ to 3′, this constructs contains the NFAT-RE, the IL-2 Minimal Promoter, the eGFP, and the BGH polvadenylation signal.

    [0136] This cassette was synthesised commercially by Genscript and cloned into the pVAX1PB transposon plasmid between the 5′ cHS4 Insulator (GenBank: U78775.2)(12) and the human elongation factor 1 promoter. To identify transduced T-cells in initial experiments, the chimeric RQR8 marker consisting of the epitope of CD34 recognised by the QBEnd10 monoclonal antibody and mimotopes of the CD20-specific monoclonal antibody Rituximab(13) was cloned into the transposon multicloning site to produce the transposon gene insert shown in FIG. 9 (pVAX1PB NFATGFP-RQR8 plasmid). Co-electroporation of the activation inducible gene cassette containing pVAX1PB NFATGFP-RQR8 transposon plasmid and the pVAX1 PBase transposase plasmid leads to permanent integration of the NFATGFP-RQR8 gene insert seen in FIG. 9.

    Demonstration of Function of the Activation Inducible Gene Containing Transposon

    [0137] To demonstrate the function of the pVAX1PB NFATGFP-RQR8 transposon from Example 4 (see FIG. 9), 4×10.sup.6 PBMCs were electroporated in the presence of 5 ug each of the transposon and transposase plasmids. Electroporated cells were rested for 24 hours and then stimulated non-specifically over-night with 50 ng/ml phorbol myristate acetate (PMA: Sigma-Aldrich) and 1 ug/ml ionomycin (Sigma-Aldrich) and compared to unstimulated controls. Transduced cells were identified by QBEnd10 staining for RQR8 marker expression and activation induced gene expression (eGFP) was assessed at 19 hours. At that time point, 50% of transduced cells were seen to express eGFP (FIG. 10).

    Example 5: Design of KM.CAR Controlled Biological Therapies

    [0138] Expression plasmids containing IL-12 and/or the interleukin-6 receptor antagonist SANT7and also containing the optimized chimeric antigen receptor with the expression of IL-12 and/or SANT7 under control of an activation inducible promoter (Hooijberg et al. 2000) were also constructed. The SANT-7 sequence was provided by Prof Rocco Savino and was based on mutating the wildtype IL-6 gene sequence (NCBI Reference Sequence: NM_000600.4) provided as per Savino et al 1994 and Sporeno et al 1996(14-17). The sequence was imported into Clone Manage 9 (Sci-Ed Software) and a 6×His tag added for detection in supernatants by ELISA.

    [0139] The nucleotide sequence of SANT-7 is provided with amino acid substitutions highlighted, undlerlined and listed below:

    TABLE-US-00017 MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTS [00010]embedded image [00011]embedded image [00012]embedded image
    (SEQ ID NO: 38). The nucleotide substitutions correspond to Y31D, G35F, L57D, E59F, N6OW, Q75Y, S76K, S118R, V121D. The sequence provided also contained a Q211A substitution not listed in the published sequence.

    [0140] The DNA sequence corresponding to this amino acid sequence (i.e., SEQ ID NO: 38) is as follows:

    TABLE-US-00018 (SEQ ID NO: 39) ATGAACTCCTTCTCCACAAGCGCCTTCGGTCCAGTTGCCTTCTCCCTGGG GCTGCTCCTGGTGTTGCCTGCTGCCTTCCCTGCCCCAGTACCCCCAGGAG AAGATTCCAAAGATGTAGCCGCCCCACACAGACAGCCACTCACGAGCTCA GAACGAATTGACAAACAAATTCGGGACATCCTCGACTTTATCTCAGCCTT AAGAAAGGAGACATGTAACAAGAGTAACATGTGTGAGAGCTCCAAAGAGG CAGACGCATTCTGGAACCTGAACCTTCCAAAGATGGCTGAAAAAGATGGA TGCTTCTACAAAGGATTCAATGAGGAGACTTGCCTGGTGAAAATCATCAC TGGTCTTCTCGAGTTTGAGGTATACCTAGAGTACCTCCAGAACAGATTTG AGAGTAGTGAGGAACAAGCCAGAGCTGTGCAGATGCGCACAAAAGACCTG ATCCAGTTCCTGCAGAAAAAGGCAAAGAATCTAGATGCAATAACCACCCC TGACCCAACCACAAATGCCAGCCTGCTGACGAAGCTGCAGGCACAGAACC AGTGGCTGCAGGACATGACAACTCATCTCATTCTGAGATCTTTTAAGGAG TTCCTGATCCGTAGCCTGAGGGCTCTTCGGGCTATGCATCATCACCATCA CCACT.

    [0141] A single chain interleukin-12 (Flexi-IL-12) construct was designed by joining the IL-12 p40 and p35 subunits (Uniprot P29459 and P29460) with a flexible (G.sub.4S).sub.3 linker similar to Zhang et al and Chinnasamy et al (18, 19), which allows both subunits to be expressed as a single peptide chain that readily forms the bioactive p70 heterodimer was used. The Flexi-IL-12 construct was synthesized and constructs containing IL-12 and SANT7 were cloned into the activation inducible transposon cassette described herein and shown in FIG. 11.

    [0142] Additionally, the Flexi-IL-12 construct could be synthesized and constructs containing IL-12 and SANT7 separated by 2A ribosomal skip elements could be cloned into the PiggyBac plasmid described herein and shown in FIG. 7.

    [0143] The amino acid sequence of Flexi-IL-12 is as follows:

    TABLE-US-00019 (SEQ ID NO: 40) MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTC DTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHS LLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTIST DLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACP AAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSR QVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVIC RKNASISVRAQDRYYSSSWSEWASVPCSGGGGSGGGGSGGGGS custom-charactercustom-charactercustom-character custom-charactercustom-character custom-charactercustom-character custom-charactercustom-charactercustom-character custom-character .

    [0144] From 5′ to 3′, the Flexi-IL-12 construct contains a leader peptide, the IL-12 p40 subunit, the (G4S).sub.3 Linker, and the IL-12 p35 subunit.

    [0145] The DNA sequence corresponding to the amino acid sequence above (i.e., SEQ ID NO: 40) is as follows:

    TABLE-US-00020 (SEQ ID NO: 41) ATGTGTCACCAGCAGTTGGTCATCTCTTGGTTTTCCCTGGTTTTTCTGGC ATCTCCCCTCGTGGCCATATGGGAACTGAAGAAAGATGTTTATGTCGTAG AATTGGATTGGTATCCGGATGCCCCTGGAGAAATGGTGGTCCTCACCTGT GACACCCCTGAAGAAGATGGTATCACCTGGACCTTGGACCAGAGCAGTGA GGTCTTAGGCTCTGGCAAAACCCTGACCATCCAAGTCAAAGAGTTTGGAG ATGCTGGCCAGTACACCTGTCACAAAGGAGGCGAGGTTCTAAGCCATTCG CTCCTGCTGCTTCACAAAAAGGAAGATGGAATTTGGTCCACTGATATTTT AAAGGACCAGAAAGAACCCAAAAATAAGACCTTTCTAAGATGCGAGGCCA AGAATTATTCTGGACGTTTCACCTGCTGGTGGCTGACGACAATCAGTACT GATTTGACATTCAGTGTCAAAAGCAGCAGAGGCTCTTCTGACCCCCAAGG GGTGACGTGCGGAGCTGCTACACTCTCTGCAGAGAGAGTCAGAGGGGACA ACAAGGAGTATGAGTACTCAGTGGAGTGCCAGGAGGACAGTGCCTGCCCA GCTGCTGAGGAGAGTCTGCCCATTGAGGTCATGGTGGATGCCGTTCACAA GCTCAAGTATGAAAACTACACCAGCAGCTTCTTCATCAGGGACATCATCA AACCTGACCCACCCAAGAACTTGCAGCTGAAGCCATTAAAGAATTCTCGG CAGGTGGAGGTCAGCTGGGAGTACCCTGACACCTGGAGTACTCCACATTC CTACTTCTCCCTGACATTCTGCGTTCAGGTCCAGGGCAAGAGCAAGAGAG AAAAGAAAGATAGAGTCTTCACGGACAAGACCTCAGCCACGGTCATCTGC CGCAAAAATGCCAGCATTAGCGTGCGGGCCCAGGACCGCTACTATAGCTC ATCTTGGAGCGAATGGGCATCTGTGCCCTGCAGTGGTGGCGGTGGAAGCG GCGGTGGCGGAAGCGGCGGTGGCGGCAGCAGAAACCTCCCCGTGGCCACT CCAGACCCAGGAATGTTCCCATGCCTTCACCACTCCCAAAACCTGCTGAG GGCCGTCAGCAACATGCTCCAGAAGGCCAGACAAACTCTAGAATTTTACC CTTGCACTTCTGAAGAGATTGATCATGAAGATATCACAAAAGATAAAACC AGCACAGTGGAGGCCTGTTTACCATTGGAATTAACCAAGAATGAGAGTTG CCTAAATTCCAGAGAGACCTCTTTCATAACTAATGGGAGTTGCCTGGCCT CCAGAAAGACCTCTTTTATGATGGCCCTGTGCCTTAGTAGTATTTATGAA GACTTGAAGATGTACCAGGTGGAGTTCAAGACCATGAATGCAAAGCTTCT GATGGATCCTAAGAGGCAGATCTTTCTAGATCAAAACATGCTGGCAGTTA TTGATGAGCTGATGCAGGCCCTGAATTTCAACAGTGAGACTGTGCCACAA AAATCCTCCCTTGAAGAACCGGATTTTTATAAAACTAAAATCAAGCTCTG CATACTTCTTCATGCTTTCAGAATTCGGGCAGTGACTATTGATAGAGTGA TGAGCTATCTGAATGCTTCC.

    [0146] Additionally, expression plasmids containing the truncated dominant negative form of Galectin-3, GAL3C is also constructed. The construct contains a CD8-alpha leader peptide to direct secretion as well as a 6×His tag for detection. The amino acid sequence of GAL3C is listed here:

    TABLE-US-00021 (SEQ ID NO: 42) MEFGLSWLFLVAILKGVQCSRHHHHHHGAPAGPLIVPYNLPLPGGVVPRM LITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNN WGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNE ISKLGISGDIDLTSASYTMI

    [0147] The corresponding DNA sequence for the GAL 3C construct is provided here:

    TABLE-US-00022 (SEQ ID NO: 43) ATGGAGTTTGGGCTGAGCTGGCTTTTTCTTGTGGCTATTTTAAAAGGT GTCCAGTGCTCTAGACATCATCACCATCACCACGGCGCCCCTGCTGGG CCACTGATTGTGCCTTATAACCTGCCTTTGCCTGGGGGAGTGGTGCCT CGCATGCTGATAACAATTCTGGGCACGGTGAAGCCCAATGCAAACAGA ATTGCTTTAGATTTCCAAAGAGGGAATGATGTTGCCTTCCACTTTAAC CCACGCTTCAATGAGAACAACAGGAGAGTCATTGTTTGCAATACAAAG CTGGATAATAACTGGGGAAGGGAAGAAAGACAGTCGGTTTTCCCATTT GAAAGTGGGAAACCATTCAAAATACAAGTACTGGTTGAACCTGACCAC TTCAAGGTTGCAGTGAATGATGCTCACTTGTTGCAGTACAATCATCGG GTTAAAAAACTCAATGAAATCAGCAAACTGGGAATTTCTGGTGACATA GACCTCACCAGTGCTTCATATACCATGATA

    [0148] The CAR and ‘biologicals’ transposon plasmids will be nucleofected to generate CAR T-cells expressing either IL-12 alone, SANT7 alone, GAL3C alone or both IL-12 and SANT7 or both of IL12 and GAL3C or both of SANT7 and GAL3C or all three of IL-12. SANT7 and GAL3C. Cells successfully transduced with ‘biologicals’ constructs may be identified by selectable marker expression for example by flow cytometry. Levels of IL-12, SANT7. And or GAL3C will be measured intracellularly by cytokine flow cytometry and in supernatants of CAR T-cell cultures by ELISA using commercial kits and reagents and compared to control T-cells expressing CAR alone. CAR T-cells will be assessed for function by cytokine flow cytometry and cytotoxicity assays as above as well as co-culture assays with myeloma cell lines to assess inhibition of tumour growth. Experiments will be performed in triplicate and the 2 optimal CAR constructs identified will be chosen to be assessed in a murine model with and without IL-12, GAL3C and/or SANT7 expression.

    [0149] Based on the previously established RPMI-Rag human myeloma murine xenograft model, RPMI-Rag-Luc (KMA−) and JJN3-Rag-Luc (KMA+) models will be developed to assess the function of our CAR T-cells in-vivo. JJN3 and RPMI8226 cells will be transfected with Luc-1 and then inoculated i.v. into Rag2−/−γc−/− (BALB/c) mice to form the JJN3-Rag-Luc and RPMI-Rag-Luc MM models. Engraftment and disease levels will be monitored by optical imaging following IP injection with luciferin and correlated with levels of levels of serum human kappa (JJN3) and lambda (RPMI) light chain. Optimal time for inoculation with candidate CAR T-cells will be established using Optical Imaging prior to the development of hind limb paralysis, usually from weeks 5-8. Cohorts of 6 JJN3-Rag-Luc and RPMI-Rag-Luc mice will be inoculated IV with increasing doses of CAR T-Cells (with and without IL-12/SANT7 expression) to establish the therapeutic dose starting at 1×10.sup.6 total cells. Mice will be imaged on day 0, +1, +3, +8 and weekly thereafter until the development disease progression as determined by the development of hind limb paralysis, increasing serum free light chains (SFLC) or other institutional guidelines. Marrow and extramedullary tumors will be collected and examined histologically for distribution of MM cells and CAR T-cells. Efficacy will be determined by imaging response and survival compared with controls.

    REFERENCES

    [0150] 1. Rossig C, Pscherer S, Landmeier S, Altvater B, Jurgens H, Vormoor J. Adoptive cellular immunotherapy with CD19-specific T cells. Klin Padiatr. 2005; 217(6):351-6.

    [0151] 2. Ramanayake S, Bilmon I, Bishop D, Dubosq M C, Blyth E, Clancy L, et al. Low-cost generation of Good Manufacturing Practice-grade CD19-specific chimeric antigen receptor-expressing T cells using piggyBac gene transfer and patient-derived materials. Cytotherapy. 2015.

    [0152] 3. Hombach A, Hombach A A, Abken H. Adoptive immunotherapy with genetically engineered T cells: modification of the IgG1 Fc ‘spacer’ domain in the extracellular moiety of chimeric antigen receptors avoids ‘off-target’ activation and unintended initiation of an innate immune response. Gene Ther. 2010; 17(10):1206-13.

    [0153] 4. Shields R L, Namenuk A K, Hong K, Meng Y G, Rae J, Briggs J, et al. High resolution mapping of the binding site on human IgG1 for Fc gamma RI, Fc gamma RII, Fc gamma RIII, and FcRn and design of IgG1 variants with improved binding to the Fc gamma R. J Biol Chem. 2001; 276(9):6591-604.

    [0154] 5. Armour K L, van de Winkel J G, Williamson L M, Clark M R. Differential binding to human FcgammaRIIa and FcgammaRIIb receptors by human IgG wildtype and mutant antibodies. Mol Immunol. 2003; 40(9).585-93.

    [0155] 6. Hudecek M, Sommermeyer D, Kosasih P L, Silva-Benedict A, Liu L, Rader C, et al. The nonsignaling extracellular spacer domain of chimeric antigen receptors is decisive for in vivo antitumor activity. Cancer immunology research. 2015; 3(2):125-35.

    [0156] 7. Clemenceau B, Valsesia-Wittmann S, Jallas A C, Vivien R, Rousseau R, Marabelle A, et al. In Vitro and In Vivo Comparison of Lymphocytes Transduced with a Human CD16 or with a Chimeric Antigen Receptor Reveals Potential Off-Target Interactions due to the IgG2 CH2-CH3 CAR-Spacer. J Immunol Res. 2015; 2015:482089.

    [0157] 8. Fiering S, Northrop J P, Nolan G P, Mattila P S, Crabtree G R, Herzenberg L A. Single cell assay of a transcription factor reveals a threshold in transcription activated by signals emanating from the T-cell antigen receptor. Genes Dev. 1990; 4(10):1823-34.

    [0158] 9. Miller W L, Martial J A, Baxter J D. Molecular cloning of DNA complementary to bovine growth hormone mRNA. J Biol Chem. 1980; 255(16):7521-4.

    [0159] 10. Miller W L, Thirion J P, Martial J A. Cloning of DNA complementary to bovine prolactin mRNA. Endocrinology. 1980; 107(3):851-3.

    [0160] 11. Goodwin E C, Rottman F M. The 3′-flanking sequence of the bovine growth hormone gene contains novel elements required for efficient and accurate polyadenylation. J Biol Chem. 1992; 267(23):16330-4.

    [0161] 12. Chung J H, Bell A C, Felsenfeld G. Characterization of the chicken beta-globin insulator. Proc Natl Acad Sci USA. 1997; 94(2):575-80.

    [0162] 13. Philip B, Thomas S, Marin V, Jathoul A, Kopec A, Linch D C, et al. A Highly Compact Epitope-Based Marker-Suicide Gene for More Convenient and Safer T-Cell Adoptive Immunotherapy. ASH Annual Meeting Abstracts. 2010; 116(21):1473-.

    [0163] 14. Demartis A, Bernassola F, Savino R, Melino G, Ciliberto G. Interleukin 6 receptor superantagonists are potent inducers of human multiple myeloma cell death. Cancer Res. 1996; 56(18):4213-8.

    [0164] 15. Savino R, Ciapponi L, Lahm A, Demartis A, Cabibbo A, Toniatti C, et al. Rational design of a receptor super-antagonist of human interleukin-6. EMBO J. 1994; 13(24):5863-70.

    [0165] 16. Savino R, Lahm A, Salvati A L, Ciapponi L, Sporeno E, Altamura S, et al. Generation of interleukin-6 receptor antagonists by molecular-modeling guided mutagenesis of residues important for gp130 activation. EMBO J. 1994; 13(6):1357-67.

    [0166] 17. Sporeno E, Savino R, Ciapponi L, Paonessa G, Cabibbo A, Lahm A, et al. Human interleukin-6 receptor super-antagonists with high potency and wide spectrum on multiple myeloma cells. Blood. 1996; 87(11):4510-9.

    [0167] 18. Zhang L, Kerkar S P, Yu Z, Zheng Z, Yang S, Restifo N P, et al. Improving adoptive T cell therapy by targeting and controlling IL-12 expression to the tumor environment. Mol Ther. 2011; 19(4):751-9.

    [0168] 19. Chinnasamy D, Yu Z, Kerkar S P, Zhang L, Morgan R A, Restifo N P, et al. Local delivery of interleukin-12 using T cells targeting VEGF receptor-2 eradicates multiple vascularized tumors in mice. Clin Cancer Res. 2012;18(6):1672-83.