HIV-1 NEUTRALIZING ANTIBODIES AND USES THEREOF
20220096632 · 2022-03-31
Inventors
- Barton F. Haynes (Durham, NC)
- Hua-Xin Liao (Durham, NC)
- M. Anthony Moody (Durham, NC)
- LaTonya Williams (Durham, NC)
- Kevin J. Wiehe (Durham, NC)
- Gilad Adi Ofek (College Park, MD)
Cpc classification
C07K16/1063
CHEMISTRY; METALLURGY
C07K2299/00
CHEMISTRY; METALLURGY
A61K2039/507
HUMAN NECESSITIES
C07K2317/24
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/34
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
International classification
Abstract
The invention is directed to HIV-1 neutralizing antibodies and methods for their uses.
Claims
1.-19. (canceled)
20. A recombinant antibody or fragment thereof comprising: a heavy chain variable region comprising a heavy chain complementarity determining region (HCDR)1, a HCDR2, and a HCDR3 comprising amino acids at positions 26-33, 51-60 and 99-121 of SEQ ID NO: 230, SEQ ID NO: 240 or SEQ ID NO: 241, respectively and wherein the amino acid sequence of the heavy chain variable region outside of HCDR1, HCDR2, and HCDR3 has an overall sequence identity of at least 90% to SEQ ID NO: 230, SEQ ID NO: 240, or SEQ ID NO: 241; and a light chain variable region comprising a light chain complementarity determining region (LCDR)1, a LCDR2, and a LCDR3, comprising amino acids at positions 27-32, 50-52 and 89-99 of SEQ ID NO: 253, SEQ ID NO: 255 or SEQ ID NO: 261 respectively, and wherein the amino acid sequence of the light chain variable region outside of LCDR1, LCDR2, and LCDR3 has an overall sequence identity of at least 90% to SEQ ID NO: 253, SEQ ID NO: 255, or SEQ ID NO: 261, and wherein the antibody or fragment thereof binds gp41 MPER of HIV-1 envelope.
21. A recombinant antibody or fragment thereof comprising: a heavy chain variable region comprising heavy chain complementarity determining regions (HCDRs) that have an overall HCDR sequence identity of at least 90% to HCDR amino acids at positions 26-33, 51-60 and 99-121 of SEQ ID NO: 230, SEQ ID NO:240, or SEQ ID NO:241 and wherein the amino acid sequence of the heavy chain variable region outside of HCDR1, HCDR2, and HCDR3 has an overall sequence identity of at least 90% to SEQ ID NO: 230, SEQ ID NO: 240, or SEQ ID NO: 241; and a light chain variable region comprising light chain complementarity determining regions (LCDRs) that have an overall LCDR sequence identity of at least 90% to LCDR amino acids at positions 27-32, 50-52 and 89-99 of SEQ ID NO: 253, SEQ ID NO: 255 or SEQ ID NO: 261 and wherein the amino acid sequence of the light chain variable region outside of LCDR1, LCDR2, and LCDR3 has an overall sequence identity of at least 90% to SEQ ID NO: 253, SEQ ID NO: 255, or SEQ ID NO: 261, and wherein the antibody or fragment thereof binds gp41 MPER of HIV-1 envelope.
22. A recombinant antibody or fragment thereof comprising: a heavy chain variable region comprising a heavy chain complementarity determining region (HCDR)1, a HCDR2, and a HCDR3 comprising amino acids at positions 26-33, 51-60 and 99-121 of SEQ ID NO: 230, SEQ ID NO: 240 or SEQ ID NO: 241, respectively and wherein the V gene usage of the heavy chain variable region is VH3; and a light chain variable region comprising a light chain complementarity determining region (LCDR)1, a LCDR2, and a LCDR3, comprising amino acids at positions 27-32, 50-52 and 89-99 of SEQ ID NO: 253, SEQ ID NO: 255 or SEQ ID NO: 261 respectively, and wherein the V gene usage of the light chain variable region is a kappa light chain, and wherein the antibody or fragment thereof binds gp41 MPER of HIV-1 envelope.
23. A recombinant antibody or fragment thereof comprising: a heavy chain variable region comprising heavy chain complementarity determining regions (HCDRs) that have an overall HCDR sequence identity of at least 90% to HCDR amino acids at positions 26-33, 51-60 and 99-121 of SEQ ID NO: 230, SEQ ID NO:240, or SEQ ID NO:241 and wherein the V gene usage of the heavy chain variable region is VH3; and a light chain variable region comprising light chain complementarity determining regions (LCDRs) that have an overall LCDR sequence identity of at least 90% to LCDR amino acids at positions 27-32, 50-52 and 89-99 of SEQ ID NO: 253, SEQ ID NO: 255 or SEQ ID NO: 261, and wherein the V gene usage of the light chain variable region is a kappa light chain, and wherein the antibody or fragment thereof binds gp41 MPER of HIV-1 envelope.
24. The recombinant antibody or fragment thereof of claim 22 or 23, wherein the V gene usage of the heavy chain variable region is VH3-15.
25. The recombinant antibody or fragment thereof of claim 22 or 23, wherein the V gene usage of the light chain variable region is kappa light chain 1-39.
26. The recombinant antibody or fragment thereof of claim 22 or 23, wherein the V gene usage of the heavy chain variable region is VH3-15 and the V gene usage of the light chain variable region is kappa light chain 1-39.
27. The recombinant antibody or fragment thereof of claim 24, wherein the J gene usage of the heavy chain variable region is JH6.
28. The recombinant antibody or fragment thereof of claim 24, wherein the J gene usage of the light chain variable region is JK2.
29. The recombinant antibody or fragment thereof of claim 20 or 22, comprising: a heavy chain variable region comprising a HCDR1, a HCDR2, and a HCDR3 comprising amino acids at positions 26-33, 51-60 and 99-121 of SEQ ID NO: 230 and a LCDR1, a LCDR2, and a LCDR3, comprising amino acids at positions 27-32, 50-52 and 89-99 of SEQ ID NO: 253.
30. The recombinant antibody or fragment thereof of claim 20 or 22, comprising: a heavy chain variable region comprising a HCDR1, a HCDR2, and a HCDR3 comprising amino acids at positions 26-33, 51-60 and 99-121 of SEQ ID NO: 230 and a LCDR1, a LCDR2, and a LCDR3, comprising amino acids at positions 27-32, 50-52 and 89-99 of SEQ ID NO: 255.
31. The recombinant antibody or fragment thereof of claim 20 or 22, comprising: a heavy chain variable region comprising a HCDR1, a HCDR2, and a HCDR3 comprising amino acids at positions 26-33, 51-60 and 99-121 of SEQ ID NO: 240 and a LCDR1, a LCDR2, and a LCDR3, comprising amino acids at positions 27-32, 50-52 and 89-99 of SEQ ID NO: 261.
32. The recombinant antibody or fragment thereof of claim 20 or 22, comprising: a heavy chain variable region comprising a HCDR1, a HCDR2, and a HCDR3 comprising amino acids at positions 26-33, 51-60 and 99-121 of SEQ ID NO: 241 and a LCDR1, a LCDR2, and a LCDR3, comprising amino acids at positions 27-32, 50-52 and 89-99 of SEQ ID NO: 261.
33. The recombinant antibody or fragment thereof of claim 21 or 23, comprising: a heavy chain variable region comprising heavy chain complementarity determining regions (HCDRs) that have an overall HCDR sequence identity of at least 90% to HCDR amino acids at positions 26-33, 51-60 and 99-121 of SEQ ID NO: 230; and a light chain variable region comprising light chain complementarity determining regions (LCDRs) that have an overall LCDR sequence identity of at least 90% to LCDR amino acids at positions 27-32, 50-52 and 89-99 of SEQ ID NO: 253.
34. The recombinant antibody or fragment thereof of claim 21 or 23, comprising: a heavy chain variable region comprising heavy chain complementarity determining regions (HCDRs) that have an overall HCDR sequence identity of at least 90% to HCDR amino acids at positions 26-33, 51-60 and 99-121 of SEQ ID NO: 230; and a light chain variable region comprising light chain complementarity determining regions (LCDRs) that have an overall LCDR sequence identity of at least 90% to LCDR amino acids at positions 27-32, 50-52 and 89-99 of SEQ ID NO: 255.
35. The recombinant antibody or fragment thereof of claim 21 or 23, comprising: a heavy chain variable region comprising heavy chain complementarity determining regions (HCDRs) that have an overall HCDR sequence identity of at least 90% to HCDR amino acids at positions 26-33, 51-60 and 99-121 of SEQ ID NO: 240; and a light chain variable region comprising light chain complementarity determining regions (LCDRs) that have an overall LCDR sequence identity of at least 90% to LCDR amino acids at positions 27-32, 50-52 and 89-99 of SEQ ID NO: 261.
36. The recombinant antibody or fragment thereof of claim 21 or 23, comprising: a heavy chain variable region comprising heavy chain complementarity determining regions (HCDRs) that have an overall HCDR sequence identity of at least 90% to HCDR amino acids at positions 26-33, 51-60 and 99-121 of SEQ ID NO: 241; and a light chain variable region comprising light chain complementarity determining regions (LCDRs) that have an overall LCDR sequence identity of at least 90% to LCDR amino acids at positions 27-32, 50-52 and 89-99 of SEQ ID NO: 261.
37. A bispecific antibody comprising the recombinant antibody or fragment thereof of any one of claims 20-23.
38. The recombinant antibody or fragment thereof of any one of claims 20-23 wherein the antibody or fragment thereof comprises an Fc portion that is modified compared to a naturally occurring Fc domain.
39. A pharmaceutical composition comprising any one of the antibodies or fragments thereof of any one of claims 20-23, or any combination thereof.
40. The pharmaceutical composition of claim 39, further comprising another HIV 1 neutralizing antibody.
41. A pharmaceutical composition comprising a vector, the vector comprising a nucleic acid encoding an antibody or fragment thereof comprising a heavy chain variable region comprising a heavy chain variable region comprising a heavy chain complementarity determining region (HCDR)1, a HCDR2, and a HCDR3 comprising amino acids at positions 26-33, 51-60 and 99-121 of SEQ ID NO: 230, SEQ ID NO: 240 or SEQ ID NO: 241, respectively; and a light chain variable region comprising a light chain complementarity determining region (LCDR)1, a LCDR2, and a LCDR3, comprising amino acids at positions 27-32, 50-52 and 89-99 of SEQ ID NO: 253, SEQ ID NO: 255 or SEQ ID NO: 261 respectively, wherein the antibody or fragment thereof binds gp41 MPER of HIV-1 envelope.
42. The pharmaceutical composition of claim 41, wherein the vector is suitable for gene delivery and expression.
43. A pharmaceutical composition comprising a vector, the vector comprising a nucleic acid encoding an antibody or fragment thereof of any one of claims 20-23.
44. The pharmaceutical composition of claim 43, wherein the vector is suitable for gene delivery and expression.
45. A method to inhibit HIV-1 infection in a subject comprising administering to the subject the pharmaceutical composition of claim 39 in an effective amount.
46. The method of claim 45, wherein the pharmaceutical composition is administered in an effective regimen.
47. The method of claim 45 further comprising administering an additional HIV 1 neutralizing antibody.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
[0091]
[0092]
[0093]
[0094]
[0095]
[0096]
[0097]
[0098]
[0099]
[0100]
[0101]
[0102]
[0103]
[0104]
[0105]
[0106]
[0107]
[0108]
[0109]
[0110]
[0111]
[0112]
[0113]
[0114]
[0115]
[0116]
[0117]
[0118]
[0119]
[0120]
[0121]
[0122]
[0123]
[0124]
[0125]
[0126]
[0127]
[0128]
DETAILED DESCRIPTION
[0129] Broadly neutralizing and potent HIV envelope antibodies are now being developed for both prevention of HIV (Rudicell R S et al. J. Virol 88: 12669-82, 2014) and for treatment of HIV infected individuals (Barouch D H, et al. Nature 503: 224-8, 2013; Shingai M et al. Nature 503: 277-80, 2013). Thus, human recombinant antibodies either alone or in combinations have great prophylactic and therapeutic potential for the prevention and treatment of HIV. Moreover, antibodies that bind with high affinity to Env may be useful in eliminating the latent pool of HIV-infected CD4 T cells and curing HIV, when either used to sensitize HIV expressing target cells with bispecific bnAbs for NK or CD8 T cell killing or when bnAbs are conjugated with toxins or radionucleotides.
[0130] In certain aspects the invention provides fully human antibodies and fragments that specifically bind to and potently neutralize various isolates of HIV-1. In some embodiments, the antibodies bind to HIV-1 gp41. In some embodiments, the antibodies of the invention specifically bind the membrane-proximal extracellular region (MPER) of gp41.
[0131] In certain aspects the invention provides pharmaceutical compositions including these human antibodies and a pharmaceutically acceptable carrier. In certain aspects the invention provides antibodies for passive immunization against HIV/AIDS. Nucleic acids encoding these antibodies, expression cassettes and vectors including these nucleic acids, and isolated cells that express the nucleic acids which encode the antibodies of the invention are also provided.
[0132] In some embodiments, the invention provides antibodies which are clonal variants (See e.g., Examples 11, and 12). In some embodiments, clonal variants are sequences that differ by one or more nucleotides or amino acids, and have a V region with shared mutations compared to the germline, identical VDJ or VJ gene usage, identical the same or similar HCDR3 length, and the same VL and JL usage. The germline sequence (unmutated common ancestor “UCA”) is intended to be the sequence coding for the antibody/immunoglobulin (or of any fragment thereof) deprived of mutations, for example somatic mutations. Antibodies in a clone that are designate as UCA and/or I (for “Intermediate”) are typically not isolated from a biological sample, but are derived computationally based on VH and/or VL sequences isolated from subjects infected with HIV-1.
[0133] Compositions including the human antibodies of the invention, including antibodies specific for gp41, can be used for any purpose including but not limited to research, diagnostic and therapeutic purposes. In non-limiting embodiments, the human monoclonal antibodies disclosed herein can be used to detect HIV-1 in a biological sample or interfere with the HIV-1 activity, for example to diagnose or treat a subject having an HIV-1 infection and/or AIDS. For example, the antibodies can be used to determine HIV-1 titer in a subject. The antibodies disclosed herein also can be used to study the biology of the human immunodeficiency virus. The antibodies of the invention can be used for therapeutic purposes for treatment or prevention of HIV-1 infection, alone or in combination with other therapeutic modalities, including ART and/or combination with other HIV-1 targeting antibodies, neutralizing antibodies and/or ADCC inducing antibodies.
[0134] In some embodiments, the disclosed MPER antibodies specifically bind to a polypeptide disclosed in for example but not limited to
[0135] In some embodiments, residues believed to make contacts with the antibodies of the invention include resides identified in the mapping studies described in for example but not limited to
[0136] In some embodiments, the disclosed antibodies are referred to as 10E8-like antibodies because their binding to the MPER maps to a region similar to the MPER region bound by the 10E8 antibody previously described (See US Pub 20140348785). The 10E8 antibody specifically binds the membrane proximal extracellular region (MPER) of gp41 at an epitope that is designated as the 10E8 epitope. The crystal structure of the 10E8 antibody was solved in complex with a gp41 peptide (See 20140348785 Example 1), which allowed for detailed analysis of the binding of the 10E8 antibody and gp41, and describe at the atomic level the binding of 10E8 antibody to the 10E8 epitope. This epitope, and thus the antibodies of this class (10E8-like antibodies), can be distinguished from other antibodies that bound gp41 at other epitopes. The 10E8 epitope, e.g., KWASLWNWFDITNWLWYIR (SEQ ID NO: 464), extends C-terminal to the 2F5 epitope (although there is some overlap) on the gp41 ectodomain and is distinguished from the 4E10 and Z13E1 epitope by expanding the binding to C-terminal residues previously thought to be inaccessible (e.g. these residues were believed to be buried in the lipid bilayer).
[0137] In some embodiments, an MPER antibody of the invention is not the 10E8, 4E10, 2F5 or any other MPER antibody as previously described. Some of the difference between certain antibodies of the invention and the 10E8, 4E10 and 2F5 antibodies are demonstrated in
[0138] In some embodiments, the antibodies of the invention are expected not to exhibit self-reactivity—they do not bind or bind very weakly to self-antigens, such as human protein. For use as preventive or therapeutic agents, what matters is whether the mature antibody will be polyreactive or not (
[0139] The neutralization breadth of the inventive antibodies is demonstrated by the diversity of viruses which are neutralized in the TZMbl Env pseudovirus inhibition assay. In certain embodiments, the neutralization breadth and/or binding of the antibodies of the invention can be maintained in the presence of tolerate changes to the epitope. Comparing the sequences of the neutralized viruses, versus viruses that are not neutralized, a skilled artisan can readily determine the % virus changes, including changes in the MPER region and the epitope, which can be tolerated while neutralization and/or binding is maintained.
[0140] Comparing the sequences of the antibodies (e.g.
[0141] Various algorithms for sequence alignment are known in the art. The similarity between amino acid sequences is expressed in terms of the similarity between the sequences, otherwise referred to as sequence identity. Sequence identity is frequently measured in terms of percentage identity (or similarity or homology); the higher the percentage, the more similar the two sequences are. Homologs or variants of a polypeptide will possess a relatively high degree of sequence identity when aligned using standard methods.
[0142] Methods of alignment of sequences for comparison are well known in the art. Various programs and alignment algorithms are described in: Smith and Waterman, Adv. Appl. Math. 2:482, 1981; Needleman and Wunsch, J. Mol. Biol. 48:443, 1970; Pearson and Lipman, Proc. Natl. Acad. Sci. U.S.A. 85:2444, 1988; Higgins and Sharp, Gene 73:237, 1988; Higgins and Sharp, CABIOS 5:151, 1989; Corpet et al., Nucleic Acids Research 16:10881, 1988; and Pearson and Lipman, Proc. Natl. Acad. Sci. U.S.A. 85:2444, 1988. Altschul et al., Nature Genet. 6:119, 1994, presents a detailed consideration of sequence alignment methods and homology calculations.
[0143] The NCBI Basic Local Alignment Search Tool (BLAST) (Altschul et al., J. Mol. Biol. 215:403, 1990) is available from several sources, including the National Center for Biotechnology Information (NCBI, Bethesda, Md.) and on the internet, for use in connection with the sequence analysis programs blastp, blastn, blastx, tblastn and tblastx. A description of how to determine sequence identity using this program is available on the NCBI website on the internet.
[0144] Homologs and variants of a VL or a VH of an antibody that specifically binds a polypeptide are typically characterized by possession of at least about 75%, for example at least about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity counted over the full length alignment with the amino acid sequence of interest. Proteins with even greater similarity to the reference sequences will show increasing percentage identities when assessed by this method, such as at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% sequence identity. When less than the entire sequence is being compared for sequence identity, homologs and variants will typically possess at least 80% sequence identity over short windows of 10-20 amino acids, and may possess sequence identities of at least 85% or at least 90% or 95% depending on their similarity to the reference sequence. Methods for determining sequence identity over such short windows are available at the NCBI website on the internet. One of skill in the art will appreciate that these sequence identity ranges are provided for guidance only; it is entirely possible that strongly significant homologs could be obtained that fall outside of the ranges provided.
[0145] In certain embodiments, the invention provides antibodies which are 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80% identical to the VH and VL amino acid sequences of the antibodies described herein and still maintain the neutralization breadth, biding and/or potency. In certain embodiments, the invention provides antibodies which are 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80% identical to the CDR1, 2, and/or 3 of VH and CDR1, 2, and/or 3 VL amino acid sequences of the antibodies described herein and still maintain the neutralization breadth, biding and/or potency.
[0146] In certain embodiments, the invention provides antibodies which can tolerate a larger percent variation in the sequences outside of the VH and/VL sequences of the antibodies. In certain embodiments, the invention provides antibodies which are 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80%, 79%, 78%, 77%, 76%, 75%, 74%, 73%, 72%, 71%, 70%, 69%, 68%, 67%, 66%, 65% identical, wherein the identity is outside of the VH or VL regions, or the CDRs of the VH or VL chains of the antibodies described herein.
[0147] Antibodies exist, for example as intact immunoglobulins and antigen binding variants or fragments e.g. as a number of well characterized produced by digestion with various peptidases. For instance, Fabs, Fvs, scFvs that specifically bind to gp41 or fragments of gp41 would be gp41-specific binding agents. Binding specificity can be determined by any suitable assay in the art, for example but not limited competition binding assays, epitope mapping, etc. A scFv protein is a fusion protein in which a light chain variable region of an immunoglobulin and a heavy chain variable region of an immunoglobulin are bound by a linker, while in dsFvs, the chains have been mutated to introduce a disulfide bond to stabilize the association of the chains. Provided are also genetically engineered forms such as chimeric antibodies and heteroconjugate antibodies such as bispecific antibodies. See also, Pierce Catalog and Handbook, 1994-1995 (Pierce Chemical Co., Rockford, Ill.); Kuby, Immunology, 3.sup.rd Ed., W.H. Freeman & Co., New York, 1997.
[0148] In certain embodiments the invention provides antibody fragments, which have the binding specificity and/or properties of the inventive antibodies. Non-limiting examples include: (1) Fab, the fragment which contains a monovalent antigen-binding fragment of an antibody molecule produced by digestion of whole antibody with the enzyme papain to yield an intact light chain and a portion of one heavy chain; (2) Fab′, the fragment of an antibody molecule obtained by treating whole antibody with pepsin, followed by reduction, to yield an intact light chain and a portion of the heavy chain; two Fab′ fragments are obtained per antibody molecule; (3) (Fab′).sub.2, the fragment of the antibody obtained by treating whole antibody with the enzyme pepsin without subsequent reduction; (4) F(ab′).sub.2, a dimer of two Fab′ fragments held together by two disulfide bonds; (5) Fv, a genetically engineered fragment containing the variable region of the light chain and the variable region of the heavy chain expressed as two chains; and (6) single chain antibody (“SCA”), a genetically engineered molecule containing the variable region of the light chain, the variable region of the heavy chain, linked by a suitable polypeptide linker as a genetically fused single chain molecule. In certain embodiments, the antibody fragments can be produces recombinantly.
[0149] In certain embodiments, VH refers to the variable region of an immunoglobulin heavy chain, including but not limited to that of an antibody fragment, such as Fv, scFv, dsFv or Fab. In certain embodiments, VL refers to the variable region of an immunoglobulin light chain, including but not limited to that of an Fv, scFv, dsFv or Fab.
[0150] Any of the nucleic acids encoding any of the antibodies, or fragment thereof can be expressed in a recombinantly engineered cell such as bacteria, plant, yeast, insect and mammalian cells. The nucleic acid sequences include any sequence necessary for expression, including but not limited to a promoter, a leader sequence. These antibodies can be expressed as individual VH and/or VL chain, or can be expressed as a fusion protein. In certain embodiments, the antibodies can be expressed by viral vector mediated delivery of genes encoding the antibodies of the invention (See e.g. Yang et al. Viruses 2014, 6, 428-447).
[0151] To create a single chain antibody, (scFv) the VH- and VL-encoding DNA fragments are operatively linked to another fragment encoding a flexible linker, e.g., encoding the amino acid sequence (Gly.sub.4-Ser).sub.3 (SEQ ID NO: 470), such that the VH and VL sequences can be expressed as a contiguous single-chain protein, with the VH and VL domains joined by the flexible linker (see, e.g., Bird et al., Science 242:423-426, 1988; Huston et al., Proc. Natl. Acad. Sci. USA 85:5879-5883, 1988; McCafferty et al., Nature 348:552-554, 1990). Optionally, a cleavage site can be included in a linker, such as a furin cleavage site.
[0152] In some embodiments, a single chain antibody may be monovalent, if only a single VH and VL are used, bivalent, if two VH and VL are used, or polyvalent, if more than two VH and VL are used. Bispecific or polyvalent antibodies may be generated that bind specifically to gp120 and to another molecule, such as gp41.
[0153] There are numerous expression systems available for expression of proteins including E. coli, other bacterial hosts, yeast, and various higher eukaryotic cells such as the COS, CHO, HeLa and myeloma cell lines.
[0154] In certain embodiments, the invention provides monoclonal antibodies. In certain embodiments the monoclonal antibodies are produced by a clone of B-lymphocytes. In certain embodiments the monoclonal antibody is a recombinant and is produced by a host cell into which the light and heavy chain genes of a single antibody have been transfected. Any suitable cell could be used for transfection and expression of the antibodies of the invention. Suitable cell lines include without limitation 293T cells or CHO cells.
[0155] Monoclonal antibodies are produced by any suitable method known to those of skill in the art. In some embodiments, monoclonal antibodies are produced by immortalizing B-cell expressing an antibody. Methods for immortalizing B-cells are known in the art, for example but not limited to using EBV transformation, treatment with various stimulants, and/or apoptotic inhibitors (Bonsignori et al. J. Virol. 85: 9998-10009, 2011). In some embodiments, monoclonal antibodies are produced by making hybrid antibody-forming cells from a fusion of myeloma cells with immune spleen cells to make hybridomas. In some embodiments monoclonal antibodies are isolated from a subject, for example but not limited as described in Example 1 (Liao H X et al. J Virol Methods. 2009 June; 158(1-2):171-9). The amino acid and nucleic acid sequences of such monoclonal antibodies can be determined.
[0156] The antibodies described herein, or fragments thereof, may be recombinantly produced in prokaryotic or eukaryotic expression systems. These systems are well described in the art. In general, protein therapeutics are produced from mammalian cells. The most widely used host mammalian cells are Chinese hamster ovary (CHO) cells and mouse myeloma cells, including NS0 and Sp2/0 cells. Two derivatives of the CHO cell line, CHO-K1 and CHO pro-3, gave rise to the two most commonly used cell lines in large scale production, DUKX-X11 and DG44. (See, e.g., Kim, J., et al., “CHO cells in biotechnology for production of recombinant proteins: current state and further potential,” Appl. Microbiol. Biotechnol., 2012, 93:917-30, which is hereby incorporated-by-reference.) Other mammalian cell lines for recombinant antibody expression include, but are not limited to, COS, HeLa, HEK293T, U2O5, A549, HT1080, CAD, P19, NIH 3T3, L929, N2a, HEK 293, MCF-7, Y79, SO-Rb50, HepG2, J558L, and BHK. If the aim is large-scale production, the most currently used cells for this application are CHO cells. Guidelines to cell engineering for mAbs production were also reported. (Costa et al., “Guidelines to cell engineering for monoclonal antibody production,” Eur J Pharm Biopharm, 2010, 74:127-38, which is hereby incorporated-by-reference.) Using heterologous promoters, enhancers and amplifiable genetic markers, the yields of antibody and antibody fragments can be increased. Thus, in certain embodiments, the invention provides an antibody, or antibody fragment, that is recombinantly produced from a mammalian cell-line, including a CHO cell-line. In certain embodiments, the invention provides a composition comprising an antibody, or antibody fragment, wherein the antibody or antibody fragment was recombinantly produced in a mammalian cell-line, and wherein the antibody or antibody fragment is present in the composition at a concentration of at least 1, 10, 100, 1000 micrograms/mL, or at a concentration of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50, or 100 milligrams/mL.
[0157] Furthermore, large-scale production of therapeutic-grade antibodies are much different than those for laboratory scale. There are extreme purity requirements for therapeutic-grade. Large-scale production of therapeutic-grade antibodies requires multiples steps, including product recovery for cell-culture harvest (removal of cells and cell debris), one or more chromatography steps for antibody purification, and formulation (often by tangential filtration). Because mammalian cell culture and purification steps can introduce antibody variants that are unique to the recombinant production process (i.e., antibody aggregates, N- and C-terminal variants, acidic variants, basic variants, different glycosylation profiles), there are recognized approaches in the art for analyzing and controlling these variants. (See, Fahrner, et al., Industrial purification of pharmaceutical antibodies: Development, operation, and validation of chromatography processes, Biotech. Gen. Eng. Rev., 2001, 18:301-327, which is hereby incorporated-by-reference.) In certain embodiments of the invention, the antibody composition comprises less than 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 50, or 100 nanograms of host cell protein (i.e., proteins from the cell-line used to recombinantly produce the antibody)). In other embodiments, the antibody composition comprises less than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 25 ng of protein A per milligram of antibody or antibody fragment (i.e., protein A is a standard approach for purifying antibodies from recombinant cell culture, but steps should be done to limit the amount of protein A in the composition, as it may be immunogenic). (See, e.g., U.S. Pat. No. 7,458,704, Reduced protein A leaching during protein A affinity chromatography; which is hereby incorporated-by-reference.)
[0158] The antibodies of the invention can be of any isotype. In certain embodiments, the antibodies of the invention can be used as IgG1, IgG2, IgG3, IgG4, whole IgG1 or IgG3s, whole monomeric IgAs, dimeric IgAs, secretory IgAs, IgMs as monomeric, pentameric or other polymer forms of IgM. The class of an antibody comprising the VH and VL chains described herein can be specifically switched to a different class of antibody by methods known in the art.
[0159] In some embodiments, the nucleic acid encoding the VH and VL can encode an Fc domain (immunoadhesin). The Fc domain can be an IgA, IgM or IgG Fc domain. The Fc domain can be an optimized Fc domain, as described in U.S. Published Patent Application No. 20100093979, incorporated herein by reference. In one example, the immunoadhesin is an IgG1 Fc. In one example, the immunoadhesin is an IgG3 Fc.
[0160] In certain embodiments the antibodies comprise amino acid alterations, or combinations thereof, for example in the Fc region outside of epitope binding, which alterations can improve their properties. Various Fc modifications are known in the art. Amino acid numbering is according to the EU Index in Kabat. In some embodiments, the invention contemplates antibodies comprising mutations that affect neonatal Fc receptor (FcRn) binding, antibody half-life, and localization and persistence of antibodies at mucosal sites. See e.g. Ko S Y et al., Nature 514: 642-45, 2014, at
[0161] In certain embodiments, antibodies of the invention including but not limited to antibodies comprising a CDR(s) of VH and/or VL chains, or antibody fragments of the inventive antibodies can be used as the HIV-1 binding arm(s) of a bispecific molecule, e.g. DARTS, diabodies, toxin labeled HIV-1 binding molecules.
[0162] In accordance with the methods of the present invention, either the intact antibody or a fragment thereof can be used. Either single chain Fv, bispecific antibody for T cell engagement, or chimeric antigen receptors can be used (Chow et al, Adv. Exp. Biol. Med. 746:121-41 (2012)). That is, in non-limiting embodiments, intact antibody, a Fab fragment, a diabody, or a bispecific whole antibody can be used to inhibit HIV-1 infection in a subject (e.g., a human). A bispecific F(ab)2 can also be used with one arm a targeting molecule like CD3 to deliver it to T cells and the other arm the arm of the native antibody (Chow et al, Adv. Exp. Biol. Med. 746:121-41 (2012)). Toxins that can be bound to the antibodies or antibody fragments described herein include unbound antibody, radioisotopes, biological toxins, boronated dendrimers, and immunoliposomes (Chow et al, Adv. Exp. Biol. Med. 746:121-41 (2012)). Toxins (e.g., radionucleotides or other radioactive species) can be conjugated to the antibody or antibody fragment using methods well known in the art (Chow et al, Adv. Exp. Biol. Med. 746:121-41 (2012)). The invention also includes variants of the antibodies (and fragments) disclosed herein, including variants that retain the ability to bind to recombinant Env protein, the ability to bind to the surface of virus-infected cells and/or ADCC-mediating properties of the antibodies specifically disclosed, and methods of using same to, for example, reduce HIV-1 infection risk. Combinations of the antibodies, or fragments thereof, disclosed herein can also be used in the methods of the invention.
[0163] Antibodies of the invention and fragments thereof can be produced recombinantly using nucleic acids comprising nucleotide sequences encoding VH and VL sequences selected from those shown in the figures and examples.
[0164] In certain embodiments the invention provides intact/whole antibodies. In certain embodiments the invention provides antigen binding fragments thereof. Typically, fragments compete with the intact antibody from which they were derived for specific binding to the target including separate heavy chains, light chains Fab, Fab′, F(ab′).sub.2, F(ab)c, diabodies, Dabs, nobodies, and Fv. Fragments can be produced by recombinant DNA techniques, or by enzymatic or chemical separation of intact immunoglobulins.
[0165] In certain embodiments the invention provides a bispecific antibody. A bispecific or bifunctional/dual targeting antibody is an artificial hybrid antibody having two different heavy/light chain pairs and two different binding sites (see, e.g., Romain Rouet & Daniel Christ “Bispecific antibodies with native chain structure” Nature Biotechnology 32, 136-137 (2014); Garber “Bispecific antibodies rise again” Nature Reviews Drug Discovery 13, 799-801 (2014),
[0166] In certain embodiments, the bispecific antibodies could include Fc region. Fc bearing diabodies, for example but not limited to Fc bearing DARTs are heavier, and could bind neonatal Fc receptor, increasing their circulating half-life. See Garber “Bispecific antibodies rise again” Nature Reviews Drug Discovery 13, 799-801 (2014),
[0167] The present invention also encompasses molecules comprising a hinge domain. The hinge domain be derived from any immunoglobulin isotype or allotype including IgA, IgD, IgG, IgE and IgM. In preferred embodiments, the hinge domain is derived from IgG, wherein the IgG isotype is IgG1, IgG2, IgG3 or IgG4, or an allotype thereof. The hinge domain may be engineered into a polypeptide chain comprising the diabody molecule together with an Fc domain such that the diabody molecule comprises a hinge-Fc domain. In certain embodiments, the hinge and Fc domain are independently selected from any immunoglobulin isotype known in the art or exemplified herein. In other embodiments the hinge and Fc domain are separated by at least one other domain of the polypeptide chain, e.g., the VL domain. The hinge domain, or optionally the hinge-Fc domain, may be engineered in to a polypeptide of the invention in any position relative to other domains or portions of the polypeptide chain. In certain embodiments, a polypeptide chain of the invention comprises a hinge domain, which hinge domain is at the C-terminus of the polypeptide chain, wherein the polypeptide chain does not comprise an Fc domain. In yet other embodiments, a polypeptide chain of the invention comprises a hinge-Fc domain, which hinge-Fc domain is at the C-terminus of the polypeptide chain. In further embodiments, a polypeptide chain of the invention comprises a hinge-Fc domain, which hinge-Fc domain is at the N-terminus of the polypeptide chain.
[0168] In some embodiments, the invention encompasses multimers of polypeptide chains, each of which polypeptide chains comprise a VH and VL domain, comprising CDRs as described herein. In certain embodiments, the VL and VH domains comprising each polypeptide chain have the same specificity, and the multimer molecule is bivalent and monospecific. In other embodiments, the VL and VH domains comprising each polypeptide chain have differing specificity and the multimer is bivalent and bispecific. In some embodiments, the polypeptide chains in multimers further comprise an Fc domain. Dimerization of the Fc domains leads to formation of a diabody molecule that exhibits immunoglobulin-like functionality, i.e., Fc mediated function (e.g., Fc-Fc.gamma.R interaction, complement binding, etc.).
[0169] In yet other embodiments, diabody molecules of the invention encompass tetramers of polypeptide chains, each of which polypeptide chain comprises a VH and VL domain. In certain embodiments, two polypeptide chains of the tetramer further comprise an Fc domain. The tetramer is therefore comprised of two ‘heavier’ polypeptide chains, each comprising a VL, VH and Fc domain, and two ‘lighter’ polypeptide chains, comprising a VL and VH domain. Interaction of a heavier and lighter chain into a bivalent monomer coupled with dimerization of the monomers via the Fc domains of the heavier chains will lead to formation of a tetravalent immunoglobulin-like molecule. In certain aspects the monomers are the same, and the tetravalent diabody molecule is monospecific or bispecific. In other aspects the monomers are different, and the tetra valent molecule is bispecific or tetraspecific.
[0170] Formation of a tetraspecific diabody molecule as described supra requires the interaction of four differing polypeptide chains. Such interactions are difficult to achieve with efficiency within a single cell recombinant production system, due to the many variants of potential chain mispairings. One solution to increase the probability of mispairings, is to engineer “knobs-into-holes” type mutations into the desired polypeptide chain pairs. Such mutations favor heterodimerization over homodimerization. For example, with respect to Fc-Fc-interactions, an amino acid substitution (preferably a substitution with an amino acid comprising a bulky side group forming a ‘knob’, e.g., tryptophan) can be introduced into the CH2 or CH3 domain such that steric interference will prevent interaction with a similarly mutated domain and will obligate the mutated domain to pair with a domain into which a complementary, or accommodating mutation has been engineered, i.e., ‘the hole’ (e.g., a substitution with glycine). Such sets of mutations can be engineered into any pair of polypeptides comprising the diabody molecule, and further, engineered into any portion of the polypeptides chains of the pair. Methods of protein engineering to favor heterodimerization over homodimerization are well known in the art, in particular with respect to the engineering of immunoglobulin-like molecules, and are encompassed herein (see e.g., Ridgway et al. (1996) “‘Knobs-Into-Holes’ Engineering Of Antibody CH3 Domains For Heavy Chain Heterodimerization,” Protein Engr. 9:617-621, Atwell et al. (1997) “Stable Heterodimers From Remodeling The Domain Interface Of A Homodimer Using A Phage Display Library,” J. Mol. Biol. 270: 26-35, and Xie et al. (2005) “A New Format Of Bispecific Antibody: Highly Efficient Heterodimerization, Expression And Tumor Cell Lysis,” J. Immunol. Methods 296:95-101; each of which is hereby incorporated herein by reference in its entirety).
[0171] The invention also encompasses diabody molecules comprising variant Fc or variant hinge-Fc domains (or portion thereof), which variant Fc domain comprises at least one amino acid modification (e.g. substitution, insertion deletion) relative to a comparable wild-type Fc domain or hinge-Fc domain (or portion thereof). Molecules comprising variant Fc domains or hinge-Fc domains (or portion thereof) (e.g., antibodies) normally have altered phenotypes relative to molecules comprising wild-type Fc domains or hinge-Fc domains or portions thereof. The variant phenotype may be expressed as altered serum half-life, altered stability, altered susceptibility to cellular enzymes or altered effector function as assayed in an NK dependent or macrophage dependent assay. Fc domain variants identified as altering effector function are known in the art. For example International Application WO04/063351, U.S. Patent Application Publications 2005/0037000 and 2005/0064514.
[0172] The bispecific diabodies of the invention can simultaneously bind two separate and distinct epitopes. In certain embodiments the epitopes are from the same antigen. In other embodiments, the epitopes are from different antigens. In preferred embodiments, at least one epitope binding site is specific for a determinant expressed on an immune effector cell (e.g. CD3, CD16, CD32, CD64, etc.) which are expressed on T lymphocytes, natural killer (NK) cells or other mononuclear cells. In one embodiment, the diabody molecule binds to the effector cell determinant and also activates the effector cell. In this regard, diabody molecules of the invention may exhibit Ig-like functionality independent of whether they further comprise an Fc domain (e.g., as assayed in any effector function assay known in the art or exemplified herein (e.g., ADCC assay).
[0173] Non-limiting examples of bispecific antibodies can also be (1) a dual-variable-domain antibody (DVD-Ig), where each light chain and heavy chain contains two variable domains in tandem through a short peptide linkage (Wu et al., Generation and Characterization of a Dual Variable Domain Immunoglobulin (DVD-Ig™) Molecule, In: Antibody Engineering, Springer Berlin Heidelberg (2010)); (2) a Tandab, which is a fusion of two single chain diabodies resulting in a tetravalent bispecific antibody that has two binding sites for each of the target antigens; (3) a flexibody, which is a combination of scFvs with a diabody resulting in a multivalent molecule; (4) a so called “dock and lock” molecule, based on the “dimerization and docking domain” in Protein Kinase A, which, when applied to Fabs, can yield a trivalent bispecific binding protein consisting of two identical Fab fragments linked to a different Fab fragment; (5) a so-called Scorpion molecule, comprising, e.g., two scFvs fused to both termini of a human Fc-region. Examples of platforms useful for preparing bispecific antibodies include but are not limited to BiTE (Micromet), DART (MacroGenics) (e.g. U.S. Pat. No. 8,795,667; U.S. Publication Nos. 2014-0099318; 2013-0295121; 2010-0174053 and 2009-0060910; European Patent Publication No. EP 2714079; EP 2601216; EP 2376109; EP 2158221 and PCT Publications No. WO 2015/026894; WO 2015/026892; WO 2015/021089; WO 2014/159940; WO 2012/162068; WO 2012/018687; WO 2010/080538), the content of each of these publications in herein incorporated by reference in its entirety), Fcab and Mab2 (F-star), Fc-engineered IgG1 (Xencor) or DuoBody (based on Fab arm exchange, Genmab).
[0174] In certain embodiments, the bispecific antibody comprises an HIV envelope binding fragment, for example but not limited to an HIV envelope binding fragment from any of the antibodies described herein. In other embodiments, the bispecific antibody further comprises a second antigen-interaction-site/fragment. In other embodiments, the bispecific antibody further comprises at least one effector domain.
[0175] In certain embodiments the bispecific antibodies engage cells for Antibody-Dependent Cell-mediated Cytotoxicity (ADCC). In certain embodiments the bispecific antibodies engage natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages. In certain embodiments the bispecific antibodies are T-cell engagers. In certain embodiments, the bispecific antibody comprises an HIV envelope binding fragment and CD3 binding fragment. Various CD3 antibodies are known in the art. See for example U.S. Pat. No. 8,784,821. In certain embodiments, the bispecific antibody comprises an HIV envelope binding fragment and CD16 binding fragment.
[0176] In certain embodiments the invention provides antibodies with dual targeting specificity. In certain aspects the invention provides bi-specific molecules that are capable of localizing an immune effector cell to an HIV-1 envelope expressing cell, so as facilitate the killing of the HIV-1 envelope expressing cell. In this regard, bispecific antibodies bind with one “arm” to a surface antigen on target cells, and with the second “arm” to an activating, invariant component of the T cell receptor (TCR) complex. The simultaneous binding of such an antibody to both of its targets will force a temporary interaction between target cell and T cell, causing activation of any cytotoxic T cell and subsequent lysis of the target cell. Hence, the immune response is re-directed to the target cells and is independent of peptide antigen presentation by the target cell or the specificity of the T cell as would be relevant for normal MHC-restricted activation of CTLs. In this context it is crucial that CTLs are only activated when a target cell is presenting the bispecific antibody to them, i.e. the immunological synapse is mimicked. Particularly desirable are bispecific antibodies that do not require lymphocyte preconditioning or co-stimulation in order to elicit efficient lysis of target cells.
[0177] Several bispecific antibody formats have been developed and their suitability for T cell mediated immunotherapy investigated. Out of these, the so-called BiTE (bispecific T cell engager) molecules have been very well characterized and already shown some promise in the clinic (reviewed in Nagorsen and Bauerle, Exp Cell Res 317, 1255-1260 (2011)). BiTEs are tandem scFv molecules wherein two scFv molecules are fused by a flexible linker. Further bispecific formats being evaluated for T cell engagement include diabodies (Holliger et al., Prot Eng 9, 299-305 (1996)) and derivatives thereof, such as tandem diabodies (Kipriyanov et al., J Mol Biol 293, 41-66 (1999)). DART (dual affinity retargeting) molecules are based on the diabody format but feature a C-terminal disulfide bridge for additional stabilization (Moore et al., Blood 117, 4542-51 (2011)). The so-called triomabs, which are whole hybrid mouse/rat IgG molecules and also currently being evaluated in clinical trials, represent a larger sized format (reviewed in Seimetz et al., Cancer Treat Rev 36, 458-467 (2010)).
[0178] The invention also contemplates bispecific molecules with enhanced pharmacokinetic properties. In some embodiments, such molecules are expected to have increased serum half-life. In some embodiments, these are Fc-bearing DARTs (see supra).
[0179] In certain embodiments, such bispecific molecules comprise one portion which targets HIV-1 envelope and a second portion which binds a second target. In certain embodiments, the first portion comprises VH and VL sequences, or CDRs from the antibodies described herein. In certain embodiments, the second target could be, for example but not limited to an effector cell. In certain embodiments the second portion is a T-cell engager. In certain embodiments, the second portion comprises a sequence/paratope which targets CD3. In certain embodiments, the second portion is an antigen-binding region derived from a CD3 antibody, optionally a known CD3 antibody. In certain embodiments, the anti-CD antibody induce T cell-mediated killing. In certain embodiments, the bispecific antibodies are whole antibodies. In other embodiments, the dual targeting antibodies consist essentially of Fab fragments. In other embodiments, the dual targeting antibodies comprise a heavy chain constant region (CH1. In certain embodiments, the bispecific antibody does not comprise Fc region. In certain embodiments, the bispecific antibodies have improved effector function. In certain embodiments, the bispecific antibodies have improved cell killing activity. Various methods and platforms for design of bispecific antibodies are known in the art. See for example US Pub. 20140206846, US Pub. 20140170149, US Pub. 20090060910, US Pub 20130295121, US Pub. 20140099318, US Pub. 20140088295 which contents are herein incorporated by reference in their entirety.
[0180] In certain embodiments the invention provides human, humanized and/or chimeric antibodies.
[0181] Pharmaceutical Compositions
[0182] In certain aspects the invention provides a pharmaceutical composition comprising an antibody of the invention wherein the composition is used for therapeutic purposes such as but not limited to prophylaxis, treatments, prevention, and/or cure. In certain aspects the invention provides a pharmaceutical composition comprising an antibody of the invention in combination with any other suitable antibody. In certain embodiments, the pharmaceutical compositions comprise nucleic acids which encode the antibodies of the invention. In certain embodiments, these nucleic acids can be expressed by any suitable vector for expression of antibodies. Non-limiting examples include attenuated viral hosts or vectors or bacterial vectors, recombinant vaccinia virus, adenovirus, adeno-associated virus (AAV), herpes virus, retrovirus, cytomegalovirus or other viral vectors can be used to express the antibody.
[0183] Various methods to make pharmaceutical compositions are known in the art and are contemplated by the invention. In some embodiments, the compositions include excipient suitable for a biologic molecule such as the antibodies of the invention. In some embodiments, the antibodies could be produced in specific cell lines and conditions so as to control glycosylation of the antibody. In some embodiments, the antibody framework for example, could comprise specific modification so as to increase stability of the antibody.
[0184] In certain aspects, the invention provides that the antibodies, and fragments thereof, described herein can be formulated as a composition (e.g., a pharmaceutical composition). Suitable compositions can comprise an inventive antibody (or antibody fragment) dissolved or dispersed in a pharmaceutically acceptable carrier (e.g., an aqueous medium). The compositions can be sterile and can be in an injectable form (e.g. but not limited to a form suitable for intravenous injection, intramascular injection). The antibodies (and fragments thereof) can also be formulated as a composition appropriate for topical administration to the skin or mucosa. Such compositions can take the form of liquids, ointments, creams, gels and pastes. The antibodies (and fragments thereof) can also be formulated as a composition appropriate for intranasal administration. The antibodies (and fragments thereof) can be formulated so as to be administered as a post-coital douche or with a condom. Standard formulation techniques can be used in preparing suitable compositions.
[0185] The antibody (and fragments thereof), described herein have utility, for example, in settings including but not limited to the following:
[0186] i) in the setting of anticipated known exposure to HIV-1 infection, the antibodies described herein (or fragments thereof) and be administered prophylactically (e.g., IV, topically or intranasally) as a microbiocide,
[0187] ii) in the setting of known or suspected exposure, such as occurs in the setting of rape victims, or commercial sex workers, or in any homosexual or heterosexual transmission without condom protection, the antibodies described herein (or fragments thereof) can be administered as post-exposure prophylaxis, e.g., IV or topically, and
[0188] iii) in the setting of Acute HIV infection (AHI), the antibodies described herein (or fragments thereof) can be administered as a treatment for AHI to control the initial viral load or for the elimination of virus-infected CD4 T cells.
[0189] In accordance with the invention, the antibodies (or antibody fragments) described herein can be administered prior to contact of the subject or the subject's immune system/cells with HIV-1 or within about 48 hours of such contact. Administration within this time frame can maximize inhibition of infection of vulnerable cells of the subject with HIV-1.
[0190] In addition, various forms of the antibodies described herein can be administered to chronically or acutely infected HIV patients and used to kill remaining virus infected cells by virtue of these antibodies binding to the surface of virus infected cells and being able to deliver a toxin to these reservoir cells.
[0191] Suitable dose ranges can depend on the antibody (or fragment) and on the nature of the formulation and route of administration. Optimum doses can be determined by one skilled in the art without undue experimentation. For example, doses of antibodies in the range of 1-50 mg/kg of unlabeled or labeled antibody (with toxins or radioactive moieties) can be used. If antibody fragments, with or without toxins are used or antibodies are used that can be targeted to specific CD4 infected T cells, then less antibody can be used (e.g., from 5 mg/kg to 0.01 mg/kg).
[0192] In certain aspects the invention provides use of the antibodies of the invention, including bispecific antibodies, in methods of treating and preventing HIV-1 infection in an individual, comprising administering to said individual a therapeutically effective amount of a composition comprising the antibodies of the invention in a pharmaceutically acceptable form. In certain embodiment, the methods include a composition which includes more than one HIV-1 targeting antibody. In certain embodiments, the HIV-1 targeting antibodies in such combination bind different epitopes on the HIV-1 envelope. In certain embodiments, such combinations of bispecific antibodies targeting more than one HIV-1 epitope provide increased killing of HIV-1 infected cells. In other embodiments, such combinations of bispecific antibodies targeting more than one HIV-1 epitope provide increased breadth in recognition of different HIV-1 subtypes.
[0193] In certain embodiments, the composition comprising the antibodies of the invention alone or in any combination can be administered via IM, subcutaneous, or IV delivery, or could be deposited at mucosal sites, such as the oral cavity to prevent maternal to child transmission, the rectal space or the vagina as a microbicide. In certain embodiments, the antibodies can be administered locally in the rectum, vagina, or in the oral cavity, and can be formulated as a microbiocide (Hladik F et al ELIFE Elife. 2015 Feb. 3; 4. doi: 10.7554/eLife.04525; Multipurpose prevention technologies for reproductive and sexual health. Stone A. Reprod Health Matters. 2014 November; 22(44):213-7. doi: 10.1016/S0968-8080(14)44801-8). In other embodiments, antibodies can be formulated such that the therapeutic antibody or combination thereof is impregnated on a vaginal ring (Chen Y et al. Drug Des. Devel. Ther 8: 1801-15, 2014; Malcolm R K et al BJOG 121 Suppl 5: 62-9, 2014). Antibodies can be administered alone or with anti-retroviral drugs for a combination microbiocide (Hladik F et al ELIFE Elife. 2015 Feb. 3; 4. doi: 10.7554/eLife.04525)
[0194] Alternatively they can be administered in complex with a form of HIV Env, optimally gp120, but also an Env trimer, to enhance Env immunogenicity. In certain embodiments, the antibodies can be delivered by viral vector mediated delivery of genes encoding the antibodies of the invention (See e.g. Yang et al. Viruses 2014, 6, 428-447). In certain embodiments, the antibodies can be administered in viral vector, for example but not limited to adenoassociated viral vector, for expression in muscle and plasma.
[0195] In certain embodiments, antibodies with different binding specificities are combined for use in pharmaceutical compositions and therapeutic methods. For example: CD4 binding site antibodies are combined with V3 antibodies, MPER antibodies and so forth.
[0196] In some embodiments, the disclosed antibodies or antigen binding fragments thereof are used to determine whether HIV-1 envelope(s) is a suitable antigen for inclusion in a vaccine composition. For example the antibodies can be used to determine whether an antigen in a vaccine composition including a gp41 immunogen assumes a conformation including an epitope bound by the inventive antibodies or fragments thereof. This can be readily determined by a method which includes contacting a sample containing the vaccine, such as a gp120 antigen, with a disclosed antibody or antigen binding fragment under conditions sufficient for formation of an immune complex, and detecting the immune complex, to detect an HIV-1 antigen including an epitope of an inventive antibody in the sample. In one example, the detection of the immune complex in the sample indicates that vaccine component, such as a HIV-1 Env antigen assumes a conformation capable of binding the antibody or antigen binding fragment.
[0197] Antibodies Names Correlation
[0198] Various antibodies names are used throughout the application. Antibodies names correlation is as follows:
[0199] Memory B cell antibodies: DH511=DH511.1; DH512=DH511.2; DH513=DH511.3; DH514=DH511.4; DH515=DH511.5; DH516=DH511.6;
[0200] Plasma antibodies: DH511_1a=DH511.7P; DH511_2a=DH511.8P; DH511_3a=DH511.9P; DH511_4a=DH511.10P; DH511_5a=DH511.11P; DH511_5a=DH511.12P.
[0201] Chimeric antibodies which combine a heavy and light chain from different antibodies are typically indicated by the designation of the heavy and light chain of each parent antibody.
[0202] Mutations in the VH chain are referenced with respect to Kabat numbering of the indicated VH chain.
[0203] The following examples are provided to illustrate particular features of certain embodiments, but the scope of the claims should not be limited to those features exemplified.
EXAMPLES
Example 1: MPER Antibodies
[0204]
[0205] Methods to identify and isolate MPER reactive antibodies were carried out as described in Liao H X et al. J. Virol. Methods 158: 171-9, 2009. MPER specific hooks were designed to identify to antibodies which bind to HIV-1 gp41 MPER region. Using one such hook, the MPR.03-biotin hook tetramerized (
[0206] Pairs of VH and VL genes as selected above can also be used to produce plasmids for stable expression of recombinant antibodies.
[0207] In certain embodiments, the plasmids or linear constructs for recombinant antibody expression also comprise AAAA substitution in and around the Fc region of the antibody that has been reported to enhance ADCC via NK cells (AAA mutations) containing the Fc region aa of S298A as well as E333A and K334A (Shields R I et al JBC, 276: 6591-6604, 2001) and the 4.sup.th A (N434A) is to enhance FcR neonatal mediated transport of the IgG to mucosal sites (Shields R I et al. ibid).
[0208] The antibodies of the invention were selected based on a combination of criteria including sequence analyses, and functional analyses including but not limited as neutralization breadth, and potency.
[0209] In certain embodiments, the antibodies of the invention comprise naturally rearranged VH and VL fragment pairs, wherein the rest of the Ig gene is not naturally occurring with the isolated rearranged VH and VL fragments. In certain embodiments, the antibodies of the invention are recombinantly produced by synth
[0210]
Example 2: TZMbl Neutralization Assay
[0211] TZMbl neutralization assay is a standard way to evaluate antibody breadth and potency. See Montefiori, D. Methods Mol Biol. 2009; 485:395-405; HIV-1 Env-pseudoviruses infection of TZM-bl cells. Exemplary pseudovirus neutralization assays and panels of HIV-1 pseudovirus are described for example, in Li et al., J Virol 79, 10108-10125, 2005, Seaman et al, J. Virol., 84:1439-1452, 2010; Sarzotti-Kelsoe et al., J. Immunol. Methods, 409:131-46, 2014; and WO2011/038290, each of which is incorporated by reference herein. Various HIV-1 isolates, both Tier 1 and Tier 2 viruses can be included in this assay.
[0212] The TZMbl assay was conducted to determine neutralization potency and breadth of the various antibodies of the invention on different HIV-1 pseudoviruses.
[0213]
Example 3: Epitope Mapping of MPER Antibodies
[0214] Binding of antibodies to various MPER peptides in an ELISA assay was used to map the epitopes of the MPER antibodies.
[0215]
[0216]
[0217]
[0218]
[0219] All the antibodies used in the above Examples had the AAAA substitution in and around the Fc region of the antibody that has been reported to enhance ADCC via NK cells (AAA mutations) containing the Fc region aa of S298A as well as E333A and K334A (Shields R I et al JBC, 276: 6591-6604, 2001) and the 4.sup.th A (N434A) is to enhance FcR neonatal mediated transport of the IgG to mucosal sites (Shields R I et al. ibid).
[0220] Epitope mapping studies are also described in Example 12.
Example 4: Binding Assays and Kd Determination
[0221] Kd measurements of antibody binding to HIV-1 envelope, e.g. gp41 or any other suitable peptide for the MPER antibodies, will be determined by Surface Plasmon Resonance measurements, for example using Biacore, or any other suitable technology which permits detection of interaction between two molecules in a quantitative way.
Example 5: Various Assays
[0222] Various assays for self-reactivity of human antibodies are known in the art. AtheNA Multi-Lyte ANA Plus Test System is one such assay. ELISA cardiolipin assay is another assay to measure autoreactivity.
[0223] The stability and properties of the antibodies, for example as formulated in a composition for treatment will be tested.
[0224] Animal studies (PK and PD studies) could be conducted to determine the distribution and half-life of the antibodies.
[0225] Various assays and experiments can be designed to analyze prevention, treatment and/or cure.
Example 6: Antibodies from CH235 Lineage
[0226] CH557 is one example of a CD4bs broad neutralizing HIV-1 antibody, from a series of clonal antibodies (
Example 7: V3 Glycan Antibodies from DH270 Lineage
[0227] Antibodies from DH270 lineage are shown in
[0228] The VH and VL sequences of DH471, DH429, DH473, DH391 and DH270 are derived essentially as described in Example 1, except that cell were sorted with a different hook.
[0229] Neutralization data for antibodies I1 (DH270IA1) and DH429 is summarized in
[0230] DH542, DH542-QSA, DH542_K3 are non-limiting examples of V3 antibodies, which can be used in combination with the antibodies of the invention. The nucleotide and amino acid sequences of the VH and VL of DH542 QSA are shown below. DH542 QSA antibody has the VH of DH542 and the VL called DH542-QSA
TABLE-US-00001 >DH542_HC_nt (SEQ ID NO: 465) CAGGTGCAGCTGGTGCAGTCTGGGGCTCAAATGAA GAACCCTGGGGCCTCAGTGAAGGTCTCCTGCGCGC CTTCTGGATATACCTTCACCGACTTTTACATACAT TGGTTGCGCCAGGCCCCTGGCCAGGGGCTTCAGTG GATGGGATGGATGAACCCTCAGACTGGTCGCACAA ACACTGCACGAAACTTTCAGGGGAGGGTCACCATG ACCAGGGACACGTCCATCGGCACAGCCTACATGGA GTTGAGAAGCCTGACATCTGACGACACGGCCATAT ATTACTGTACGACAGGGGGATGGATCAGTCTTTAC TATGATAGTAGTTATTACCCCAACTTTGACCACTG GGGTCAGGGAACCCTGCTCACCGTCTCCTCAG >DH542_HC_aa (SEQ ID NO: 466) QVQLVQSGAQMKNPGASVKVSCAPSGYTFTDFYIH WLRQAPGQGLQWMGWMNPQTGRTNTARNFQGRVTM TRDTSIGTAYMELRSLTSDDTAIYYCTTGGWISLY YDSSYYPNFDHWGQGTLLTVSS >DH542_LC_nt_corrected (DH542_QSA) (SEQ ID NO: 467) CAGTCTGCCCTGACTCAGCCTGCCTCCGTGTCTGG GTCTCCTGGACAGTCGATCACCATCTCCTGCACTG GAACCAAGTATGATGTTGGGAGTCATGACCTTGTC TCCTGGTACCAACAGTACCCAGGCAAAGTCCCCAA ATACATGATTTATGAAGTCAATAAACGGCCCTCAG GAGTTTCTAATCGCTTCTCTGGCTCCAAATCTGGC AACACGGCCTCCCTGACAATCTCTGGGCTCCGGGC TGAGGACGAGGCTGACTATTATTGCTGTTCATTTG GAGGGAGTGCCACCGTGGTCTGCGGCGGCGGGACC AAGGTGACCGTCCTAg >DH542_LC_aa_corrected (DH542_QSA) (SEQ ID NO: 468) QSALTQPASVSGSPGQSITISCTGTKYDVGSHDLV SWYQQYPGKVPKYMIYEVNKRPSGVSNRFSGSKSG NTASLTISGLRAEDEADYYCCSFGGSATWCGGGTK VTVL
[0231] DH542-L4 is an antibody that has a VH of DH542 and VL of DH429 (
Example 8: DH540 Antibody is Described Elsewhere
[0232] DH540 antibody is described in detail in U.S. Ser. No. 62/170,558, filed Jun. 3, 2015.
Example 9: TZMbl Neutralization Assay
[0233] TZMbl neutralization assay was conducted to determine neutralization potency and breadth of different HIV-1 viral species by DH512 and mAb 10E8.
Example 10: Isolation of Additional Antibodies from the DH511 Lineage
[0234] High Throughput Native VH:VL Sequencing from Single B Cells
[0235] Additional antibodies were isolated from the individual CH0210 by high-throughput sequencing of the paired human immunoglobulin heavy and light chain repertoire. See
[0236] F(ab)2 fragments were prepared from total serum IgG and subjected to antigen-affinity chromatography using the MPER peptide. Proteins in the elution and flow-through were denatured and reduced, alkylated, trypsin-digested and analyzed by high resolution LC-MS/MS. Spectra were interpreted with the heavy chain database obtained from next-generation sequencing, and peptides uniquely associated with a single CDR (“informative peptides”) were used to identify full-length VH sequences. Clonotypes are defined as VH sequences having the same germline V and J and at least 85% aa identity in the CDRH3. To identify the MPER-binding antibodies, the focus was on the clonotypes that contain the identified CDR3 peptides and were highly enriched in the elution. This identified three clonotypes: 137, 335 and 195. All three clonotypes use the same VDJ combination (VH3-15, DH3-3, and JH6), which was also utilized by the DH511 series MPER lineages.
[0237] Based on VH sequences it was apparent that the antibodies pulled out by the paired VH:VL sequencing technology were members of the DH511 clonal lineage. Therefore, all of the antibodies are named starting with DH511. The numbers after the underscore correspond to the cluster names that were designated by the VH:VL sequencing. Antibodies were clustered by 96% nucleotide identity in the CDR3.
[0238] The above analysis identified additional MPER antibodies listed below:
TABLE-US-00002 PTID Ab ID H ID K/L ID 704-01-021-0 DH511_1a_4A DH511_1AVH_4A DH511_1AVK 704-01-021-0 DH511_1b_4A DH511_1BVH_4A DH511_1AVK 704-01-021-0 DH511_2a_4A DH511_2AVH_4A DH511_2AVK 704-01-021-0 DH511_2b_4A DH511_2BVH 4A DH511_2AVK 704-01-021-0 DH511_2c_4A DH511_2CVH_4A DH511_2AVK 704-01-021-0 DH511_3a 4A DH511_3AVH_4A DH511_3AVK 704-01-021-0 DH511_3b_4A DH511_3AVH_4A DH511_3BVK 704-01-021-0 DH511_3c_4A DH511_3AVH_4A DH511_3CVK 704-01-021-0 DH511_4a_4A DH511_4AVH_4A DH511_4A4CVK 704-01-021-0 DH511_4a_4bK_4A DH511_4AVH_4A DH511_4BVK 704-01-021-0 DH511_4b_4aK_4A DH511_4BVH_4A DH511_4A4CVK 704-01-021-0 DH511_4b_4A DH511_4BVH 4A DH511_4BVK 704-01-021-0 DH511_4c_4A DH511_4CVH_4A DH511_4A4CVK 704-01-021-0 DH511_4c_4bK_4A DH511_4CVH_4A DH511_4BVK 704-01-021-0 DH511_5a_4A DH511_5AVH_4A DH511_5AVK 704-01-021-0 DH511_5b_4A DH511_5BVH_4A DH511_5AVK
[0239] VH and VL genes were selected and made in linear cassettes (essentially as described in Liao H X et al. J. Virol. Methods 158: 171-9, 2009, see for example
Example 11: Heavy and Light Chain Chimeric Antibodies; Antibodies with Changes in the Amino Acids of the VH Chain
[0240] This example describes chimeric antibodies comprising non-natural VH and VL chain pairs. Naturally occurring VH or VL chain are combined in non-natural pairs as described in
[0241] Chimeras 1-91 were recombinantly expressed and their neutralization profile was determined in the TZMB1 assay (
[0242] The invention contemplates antibodies which comprise amino acid changes, or combination of such changes, in the VH chains of antibodies form the DH511 lineage. Non-limiting examples of antibodies with mutations are provided in
[0243] In some embodiment, such double mutants: T100aW-L100dF; T100aW-L100dW; T100aF-L100dF; T100aL-L100dF; T100aL-L100dW.
[0244] Neutralization data for a subset of these antibodies is provided in
[0245] In some embodiments, L100d could be changed to Trp.
[0246] Data in
[0247] Contemplated are also combination mutations, for example but not limited combination T100aW with L100dF, combination L100dW with T100aW.
[0248] Mutated VH chain as contemplated above could be combined with VH chain from DH512, or with VH chain from DH512_K3 (DH511_2AVK).
Example 12: Shared Memory and Plasma Repertoires of HIV-1 Neutralizing Antibodies
[0249] Shared Memory and Plasma Repertoires of HIV-1 Neutralizing Antibodies
[0250] Understanding the relationship of the memory B cell and plasma immunoglobulin repertoires of HIV-1-infected individuals who develop broadly neutralizing antibodies (bnAbs) is important, since plasma antibody responses are required to achieve maximum protection from infectious agents. Using HIV-1 envelope gp41 membrane-proximal external region (MPER)-specific memory B cell sorting and next-generation sequencing, coupled with mass spectrometry analysis of plasma antibodies, we probed the memory B cell and plasma antibody repertoires of an HIV-1-infected donor with a plasma bnAb signature that mapped to Env gp41 distal MPER. We found potent IgG bnAbs from the same B cell clonal lineage in memory B cells and plasma that neutralized 99% of HIV-1 isolates. Structural analysis demonstrated clonal lineage antibodies from memory B cells and plasma both recognized the envelope gp41 epitope identically in an alpha helical conformation. Thus, a major source of potentially protective plasma HIV-1 bnAbs is the memory B cell pool.
[0251] Introduction
[0252] Inducing broadly reactive neutralizing antibodies (bnAbs) is critical for developing a protective HIV-1 vaccine. Some of the broadest bnAbs isolated are to the envelope gp41 membrane proximal external region (MPER), with two of these, 10E8 and 4E10, the most broad (1, 2). Monoclonal antibody (mAb) 4E10, while extremely broad in neutralization breadth, is not potent, and is highly polyreactive with many non-HIV-1 proteins and autoreactive with the human protein splicing factor 3b subunit 3 (SF3B3) (3) as well as with lipids (4). In contrast, mAb 10E8 is not as polyreactive as 4E10, and is both more broad and potent (1), although it does have a degree of lipid reactivity (5) and is autoreactive with the host protein family of sequence similarity 84 member A (FAM84A) (6).
[0253] To date, all HIV-1 broadly neutralizing antibodies have been isolated from memory B cells, either with clonal memory B cell cultures or using fluorophore-labeled Env and flow cytometry cell sorting. However, most correlates of protection for infectious agents with successful vaccines are the levels of plasma neutralizing antibodies. Moreover, the correlate of decreased transmission risk in the only HIV-1 vaccine trial to demonstrate a degree of efficacy was plasma antibodies to the second variable loop (V2) region (7).
[0254] In HIV-1 infection, 60% of HIV-1-specific antibodies derive from abnormal B cell subsets, that are either activated or exhausted and express Fc receptor-like-4 (FcRL4) (8, 9). However, many of the antibodies reflected in HIV-1 memory B cells are not expressed in plasma (8). Similarly, many of the memory B cell specificities of antibodies in other settings are also not represented in plasma (10-12). Thus, it is not known if envelope-reactive memory B cells with bnAb B cell receptors are a major source of plasma broad neutralizing activity.
[0255] Here we have isolated memory B cell and plasma broad and potent envelope gp41 bnAbs from an African donor and demonstrated broad and potent plasma gp41 bnAbs to be in the same B cell clonal lineage as those isolated from memory B cells. Chimeric antibodies consisting of memory bnAb V.sub.H and plasma bnAb V.sub.L as well as engineering memory bnAb heavy chain complementary determining regions yield antibodies with greater potency than naturally paired antibodies. Thus, the class-switched memory B cell pool contributes to plasma bnAbs.
[0256] Results
[0257] Isolation of Memory B Cell gp41 Neutralizing Antibodies
[0258] Neutralization-based epitope prediction analysis revealed that plasma from HIV-1 clade C-infected individual CH0210 contained C-terminal MPER bnAb activity (13) (
[0259] DH511.1-DH511.6 and DH517 mAbs were assessed for neutralization breadth and potency against a panel of 30 cross-clade HIV-1 isolates. All six DH511 clonal members neutralized 30 of 30 isolates tested with median 50% inhibitory concentrations (IC50) ranging from 0.7 to 4.2 μg/ml (Supplementary Table 2a). DH517 had less breadth than DH511 clone antibodies, neutralizing 15 of 30 isolates with a median IC.sub.50 of 5.7 μg/ml (Supplementary Table 2a). The most potent DH511 clone bnAb (DH511.2) in a large cross-clade panel of 199 geographically and genetically diverse HIV-1 Env pseudoviruses, neutralized 197/199 (99%) viruses but was less potent than 10E8 (195/200, 98%) (median IC50, DH511.2=1.1 μg/ml and 10E8=0.4 μg/ml) (
[0260] Isolation of Plasma Gp41 Neutralizing Antibodies
[0261] We next analyzed the MPER-specific plasma antibody repertoire from donor CH0210 using an independent proteomics-based approach for the identification and semi-quantitative determination of antigen-specific antibodies in human serum (15, 16). MPER-specific antibodies were isolated from a 2 ml plasma sample by affinity chromatography, processed for proteomics (10) and subjected to liquid chromatography high-resolution tandem mass spectrometry (LC-MS/MS) analysis. For peptide identification, a donor-specific VH database comprising 98,413 unique high quality sequences was derived from a natively paired VH:VL repertoire from 845,000 peripheral single B cells from total PBMCs (isolated using MACS negative selection: CD2.sup.−CD14.sup.−CD16.sup.−CD43.sup.−CD235a.sup.−) (17-19). These V.sub.H sequences were then clustered into 4,428 clonotypes, using a cut-off of ≥85% amino acid identity in the HCDR3 region.
[0262] Using stringent data filtering protocols (10), high confidence peptide-spectrum matches (PSMs) from HCDR3 peptides were identified and their respective LC peak intensities were used for relative quantification. As we have shown previously, an estimated >80% of all HCDR3 peptides within a sample are typically identified in this manner (detection limit approximately 0.4 ng/ml), and peak intensities correlate well with absolute peptide concentrations (10, 15). Plasma Ig clonotypes were defined as VH sequences having the same germline V and J and 85% aa identity in the HCDR3.
[0263] We found that the MPER-specific plasma antibody repertoire consisted of 10 clonotypes, three of which used the same VDJ combination (VH3-15, DH3-3, JH6) as the DH511 clonal lineage (
[0264] Using the proteomically identified HCDR3 sequences, we searched the native VH:VL sequence database comprising 200,000 heavy-light chain pairs from single B cells to determine the respective full-length light-chain sequence belonging to each clonotype (Supplementary Table 6). For clonotypes in which multiple VH:VL somatic variants were detected, only the two most frequent variants, as quantified by the number of sequencing reads, were selected for expression and characterization (Supplementary Table 6). The light-chains belonging to these three clonotypes all shared the same V- and J-gene identity (IGKV1-39, IGKJ2) as the light-chains of the DH511 clonal lineage isolated by memory B cell single-cell sorting. Six plasma mAbs belonging to the DH511 clonal lineage (designated DH511.7P-DH511.12P), showed potent tier 2 neutralizing activity against a panel of four HIV-1 isolates (Supplementary Table 7), with mAbs DH511.11P and DH511.12P demonstrating the most potent neutralizing activity. DH511.11P and DH511.12P were selected for further characterization of their neutralization breadth and potency against a panel of 203 cross-clade isolates and had slightly more breadth (99.5% of isolates tested) and greater potency than memory B cell-derived DH511.2 but were less potent than 10E8 (median IC.sub.50: 0.7 μg/ml for DH511.11P and DH511.12P versus 0.4 μg/ml for 10E8) (Supplementary Table 8).
[0265] Structural Analysis of DH511 Lineage Antibodies
[0266] We used a panel of alanine substituted MPER peptides that span gp41 residues 671-683 (Supplementary Table 9) to define the epitopes of DH511.1-DH511.12P by enzyme linked immunosorbent assay (ELISA). Similar to the epitopes of 4E10 and 10E8 (1), DH511.1-DH511.12P binding was sensitive to alanine mutations at Asn671.sub.gp41 and Trp672.sub.gp41, but unlike 4E10 and 10E8, was also sensitive to Asp674Ala.sub.gp41, and to a lesser extent Leu679Ala.sub.gp41 mutations (
[0267] Crystal structures of the antigen-binding fragments (Fab) of the DH511.1 antibody in complex with a peptide spanning the full gp41 MPER (residues 656-683) and of the DH511.2 antibody in complex with gp41 peptides spanning residues 662-683 and 670-683 were determined to 2.7 Å, 2.6 Å and 2.2 Å resolution, respectively (
[0268] To compare atomic-level recognition of gp41 MPER by plasma-derived versus memory B-cell-derived antibodies, structural studies of the plasma-derived DH511-lineage antibodies DH511.11P and DH511.12P were undertaken in complex with gp41 MPER peptides. Crystal structures of DH511.11P and DH511.12P Fabs were determined in complex with a peptide spanning gp41 MPER residues 662-683, to 2.47 and 1.88 Å, respectively (
[0269] We next compared the structures of DH511 lineage antibodies to those of other antibodies that target the distal gp41 MPER (
[0270] To determine if a common structural basis for VH3-15 precursor usage could nonetheless be discerned between the two lineages, we compared VH3-15-encoded gp41-contacting residues in DH511.1, DH511.2 and 10E8. Of the total number of residue interactions that exist between the VH3-15 regions of three respective antibodies and gp41 (8 for DH511.1, 10 for DH511.2, and 10 for 10E8), five common residue positions were involved interactions with gp41 in all three antibodies: 28, 31, and 33 within the HCDR1 and 52c and 53 within the HCDR2 (
[0271] Origin and Development of the DH511 Clonal Lineage
[0272] A maximum likelihood phylogenetic tree was constructed from the VDJ sequences recovered from memory B cell sorting and was used to infer the unmutated common ancestor (UCA) of clone DH511 and six maturational intermediate antibodies (
[0273] Polyreactivity/Autoreactivity of the DH511 Clonal Lineage
[0274] The DH511 inferred UCA and intermediates 11-13 and 16 reacted with several autoantigens as measured by ELISA (
[0275] To characterize the lipid reactivity of the DH511 clonal lineage, we first determined propensity for lipid membrane binding/insertion of DH511.1-DH511.6 based on HCDR3 hydrophobicity. Three or more Phe or Trp amino acid residues were contained within the HCDR3 sequences of each DH511 clonal lineage member, and several members were found to have at least one Pro, with the exception of DH511.3 and DH511.6. A membrane insertion score was calculated based on the Wimley-White hydrophobicity scale, which measures the propensity of amino acids to sit at the interface of the head and tail group in a lipid bilayer. Notably, membrane insertion scores were similar between the most potent neutralizer DH511.2 and 4E10/10E8 but differed from 2F5 (Supplementary Table 21).
[0276] To further delineate the interaction of DH511 clonal members with the lipid bilayer interface, we determined cardiolipin reactivity and kinetics of binding to MPER peptide versus MPER peptide-liposome conjugates. The UCA and members of the memory B cell clonal lineage did not bind cardiolipin in ELISA (Supplementary Table 22). The binding of gp41 bnAbs 2F5 and 4E10 to gp41-lipid complex has been proposed as a sequential two-step process, in which encountering the lipid membrane takes place first, presumably to aid in docking of the antibody with the transiently exposed gp41 intermediate neutralizing epitope during the virion-host cell fusion process (4, 22, 23). Surface plasmon resonance (SPR) analysis of DH511 lineage fragments of antigen binding (Fabs) demonstrated that DH511.1-DH511.6 and intermediates I1-I5 bound the MPER peptide (NEQELLELDKWASLWNWFDITNWLWYIR (SEQ ID NO: 2)) with nanomolar affinity (Kd range: 11.1-99.9 nm), while the inferred UCA and intermediate 6 (most closely related to the UCA) did not bind (
[0277] To determine the impact of timing of the gp41 intermediate epitope exposure on HIV-1 neutralization (24), we compared the window of time in which bnAbs DH511.2, 10E8, and 4E10 could neutralize the tier 2 HIV-1 strain B.BG1168 after virus addition to TZM-bl cells. The lifetime of neutralization for DH511.2 (t.sub.1/2: 26.8±2.3 min) was the same as that for bnAbs 10E8 (t.sub.1/2: 25.6±2.5 min) and 4E10 (t.sub.1/2: 28.2±3.5 min), similar to the published half-life of fusion inhibition by the gp41 intermediate mimic T20 (20.2±0.5 min) (24). These results suggest that DH511.2 recognizes a transiently exposed intermediate state of gp41 (25).
[0278] Engineering DH511 Clonal Lineage Members for Enhanced Potency
[0279] To identify more potent variants of the DH511 clonal lineage, we generated 91 chimeric mAbs by swapping the heavy and light-chains of DH511.2 with those of DH511 lineage members derived from the plasma. Of the 91 chimeric antibodies, one variant, DH511.2_K3 (comprised of the DH511.2 heavy-chain reconstituted with the plasma light-chain of DH511.8P), showed greater potency than 10E8 (Supplementary Table 24). DH511.2_K3 neutralization data are shown in
[0280] Sixteen HCDR3 mutations of DH511.2 were made (
[0281] Discussion
[0282] We have used a combination of memory B cell sorting (26, 27) and plasma antigen-specific antibody characterization by HCDR3 mass spectrometry sequencing to simultaneously characterize class-switched memory B cell antibodies and plasma antibodies (15, 28-30). The memory B cell repertoire contains multiple specificities of antibodies reflective of an individual's immune history (30) whereas primary contributors to plasma antibodies are both long lived plasma cells as well as shorter lived plasma cells derived from terminally differentiated memory B cells in response to current antigens (16). However, evidence exists that for non-HIV-1 antigens such as influenza (11) and West Nile virus (12), not all of the memory B cell repertoire is found in plasma. Here we demonstrate that class-switched memory B cells and plasma shared the same clonal lineage members of highly broad and potent HIV-1 gp41 neutralizing antibodies.
[0283] In the case of HIV-1 antibody responses, the relationship of the memory B cell and plasma antibody pools is complicated by the damage that HIV-1 inflicts on the B cell lineage with disruption of the germinal center in the earliest stages of infection (31), and the accumulation of FcRL4+ memory B cells in chronic infection (8). Interestingly, HIV-1-specific B cell responses are enriched in the FcRL4+ memory B cell compartment and exhibit many features of premature exhaustion (8). Regarding antibodies that target the Env bnAb epitope at the CD4 binding site, it has been shown that ˜60% of this response is contained within the exhausted FcRL4+ memory B cell compartment, thus preventing their progression to plasma cells and production of secreted antibody (8, 9). In contrast, Scheid and colleagues studied antigen-specific memory B cell repertoires in HIV-1 infected individuals and found broad diversity of neutralizing antibodies (32). Moreover, analysis has demonstrated bnAb activity in plasma can predict isolation of bnAb variable heavy (V.sub.H) and variable light (V.sub.L) from memory B cells from the same individual (13, 33-38). Moreover, only a limited number of bnAb specificities are generally present in HIV-1-infected plasma (38, 39), and when bnAbs are isolated from memory B cells in clonal memory B cell cultures, the bnAbs are the minority of the Env specifities isolated (26, 37, 40). Thus, in spite of early damage to B cell follicles and accumulation of memory B cells with an exhaustion phenotype, HIV-1 infected individuals can make productive, albeit subdominant, bnAb responses that progress to plasma cell differentiation and secretion into blood plasma.
[0284] A critical question is whether memory B cells in HIV-1 infected individuals are differentiating into the long-lived plasma cell pool that resides in bone marrow and is responsible for long-lived plasma antibody responses (41). We have previously studied the effect of anti-retroviral treatment in HIV-1 infection on the half-lives of Env gp120 and gp41 as well as Gag antibody responses, and demonstrated whereas Env antibody half-life was short for gp120 (81 weeks) and gp41 (33 weeks), antibody half-life was longer for Gag (648 weeks). In contrast, in the same individuals, the half-life of influenza antibodies did not decay over the time studied (42). These data demonstrate that in chronic HIV-1-infection, the cells making plasma gp41 antibodies are not long-lived plasma cells.
[0285] Thus, by directly measuring the gp41 broad neutralizing repertoire in memory B cells and plasma, we have directly demonstrated the survival from immune damage of memory B cells to produce plasma broadly neutralizing antibodies. Finally, we show that blood plasma is a rich source for isolation of potent bnAbs for recombinant antibody production and for constructing chimeric memory B cell/plasma antibodies for enhancing antibody potency and breadth.
REFERENCES
[0286] 1. Huang J, Ofek G, Laub L, Louder M K, Doria-Rose N A, Longo N S, Imamichi H, Bailer R T, Chakrabarti B, Sharma S K, Alam S M, Wang T, Yang Y, Zhang B, Migueles S A, Wyatt R, Haynes B F, Kwong P D, Mascola J R, Connors M. 2012. Broad and potent neutralization of HIV-1 by a gp41-specific human antibody. Nature 491:406-412. [0287] 2. Zwick M B, Labrijn A F, Wang M, Spenlehauer C, Saphire E O, Binley J M, Moore J P, Stiegler G, Katinger H, Burton D R, Parren P W. 2001. Broadly neutralizing antibodies targeted to the membrane-proximal external region of human immunodeficiency virus type 1 glycoprotein gp41. Journal of virology 75:10892-10905. [0288] 3. Yang G, Holl T M, Liu Y, Li Y, Lu X, Nicely N I, Kepler T B, Alam S M, Liao H X, Cain D W, Spicer L, VandeBerg J L, Haynes B F, Kelsoe G. 2013. Identification of autoantigens recognized by the 2F5 and 4E10 broadly neutralizing HIV-1 antibodies. The Journal of experimental medicine 210:241-256. [0289] 4. Alam S M, McAdams M, Boren D, Rak M, Scearce R M, Gao F, Camacho Z T, Gewirth D, Kelsoe G, Chen P, Haynes B F. 2007. The role of antibody polyspecificity and lipid reactivity in binding of broadly neutralizing anti-HIV-1 envelope human monoclonal antibodies 2F5 and 4E10 to glycoprotein 41 membrane proximal envelope epitopes. Journal of immunology 178:4424-4435. [0290] 5. Chen J, Frey G, Peng H, Rits-Volloch S, Garrity J, Seaman M S, Chen B. 2014. Mechanism of HIV-1 neutralization by antibodies targeting a membrane-proximal region of gp41. Journal of virology 88:1249-1258. [0291] 6. Liu M, Yang G, Wiehe K, Nicely N I, Vandergrift N A, Rountree W, Bonsignori M, Alam S M, Gao J, Haynes B F, Kelsoe G. 2015. Polyreactivity and autoreactivity among HIV-1 antibodies. Journal of virology 89:784-798. [0292] 7. Haynes B F, Gilbert P B, McElrath M J, Zolla-Pazner S, Tomaras G D, Alam S M, Evans D T, Montefiori D C, Karnasuta C, Sutthent R, Liao H X, DeVico A L, Lewis G K, Williams C, Pinter A, Fong Y, Janes H, DeCamp A, Huang Y, Rao M, Billings E, Karasavvas N, Robb M L, Ngauy V, de Souza M S, Paris R, Ferrari G, Bailer R T, Soderberg K A, Andrews C, Berman P W, Frahm N, De Rosa S C, Alpert M D, Yates N L, Shen X, Koup R A, Pitisuttithum P, Kaewkungwal J, Nitayaphan S, Rerks-Ngarm S, Michael N L, Kim J H. 2012. Immune-correlates analysis of an HIV-1 vaccine efficacy trial. The New England journal of medicine 366:1275-1286. [0293] 8. Moir S, Ho J, Malaspina A, Wang W, DiPoto A C, O'Shea M A, Roby G, Kottilil S, Arthos J, Proschan M A, Chun T W, Fauci A S. 2008. Evidence for HIV-associated B cell exhaustion in a dysfunctional memory B cell compartment in HIV-infected viremic individuals. The Journal of experimental medicine 205:1797-1805. [0294] 9. Kardava L, Moir S, Shah N, Wang W, Wilson R, Buckner C M, Santich B H, Kim L J, Spurlin E E, Nelson A K, Wheatley A K, Harvey C J, McDermott A B, Wucherpfennig K W, Chun T W, Tsang J S, Li Y, Fauci A S. 2014. Abnormal B cell memory subsets dominate HIV-specific responses in infected individuals. The Journal of clinical investigation 124:3252-3262. [0295] 10. Boutz D R, Horton A P, Wine Y, Lavinder J J, Georgiou G, Marcotte E M. 2014. Proteomic identification of monoclonal antibodies from serum. Analytical chemistry 86:4758-4766. [0296] 11. Wrammert J, Koutsonanos D, Li G M, Edupuganti S, Sui J, Morrissey M, McCausland M, Skountzou I, Hornig M, Lipkin W I, Mehta A, Razavi B, Del Rio C, Zheng N Y, Lee J H, Huang M, Ali Z, Kaur K, Andrews S, Amara RR, Wang Y, Das S R, O'Donnell C D, Yewdell J W, Subbarao K, Marasco W A, Mulligan M J, Compans R, Ahmed R, Wilson P C. 2011. Broadly cross-reactive antibodies dominate the human B cell response against 2009 pandemic H1N1 influenza virus infection. The Journal of experimental medicine 208:181-193. [0297] 12. Purtha W E, Tedder T F, Johnson S, Bhattacharya D, Diamond M S. 2011. Memory B cells, but not long-lived plasma cells, possess antigen specificities for viral escape mutants. The Journal of experimental medicine 208:2599-2606. [0298] 13. Georgiev I S, Doria-Rose N A, Zhou T, Kwon Y D, Staupe R P, Moquin S, Chuang G Y, Louder M K, Schmidt S D, Altae-Tran H R, Bailer R T, McKee K, Nason M, O'Dell S, Ofek G, Pancera M, Srivatsan S, Shapiro L, Connors M, Migueles S A, Morris L, Nishimura Y, Martin M A, Mascola J R, Kwong P D. 2013. Delineating antibody recognition in polyclonal sera from patterns of HIV-1 isolate neutralization. Science 340:751-756. [0299] 14. Morris L, Chen X, Alam M, Tomaras G, Zhang R, Marshall D J, Chen B, Parks R, Foulger A, Jaeger F, Donathan M, Bilska M, Gray E S, Abdool Karim S S, Kepler T B, Whitesides J, Montefiori D, Moody M A, Liao H X, Haynes B F. 2011. Isolation of a human anti-HIV gp41 membrane proximal region neutralizing antibody by antigen-specific single B cell sorting. PloS one 6:e23532. [0300] 15. Lavinder J J, Wine Y, Giesecke C, Ippolito G C, Horton A P, Lungu O I, Hoi K H, DeKosky B J, Murrin E M, Wirth M M, Ellington A D, Dorner T, Marcotte E M, Boutz D R, Georgiou G. 2014. Identification and characterization of the constituent human serum antibodies elicited by vaccination. Proceedings of the National Academy of Sciences of the United States of America 111:2259-2264. [0301] 16. Wine Y, Horton A P, Ippolito G C, Georgiou G. 2015. Serology in the 21st century: the molecular-level analysis of the serum antibody repertoire. Current opinion in immunology 35:89-97. [0302] 17. McDaniel J R, DeKosky B J, Tanno H, Ellington A D, Georgiou G. 2016. Ultra-high-throughput sequencing of the immune receptor repertoire from millions of lymphocytes. Nature protocols 11:429-442. [0303] 18. DeKosky B J, Ippolito G C, Deschner R P, Lavinder J J, Wine Y, Rawlings B M, Varadarajan N, Giesecke C, Dorner T, Andrews S F, Wilson P C, Hunicke-Smith S P, Willson C G, Ellington A D, Georgiou G. 2013. High-throughput sequencing of the paired human immunoglobulin heavy and light chain repertoire. Nature biotechnology 31:166-169. [0304] 19. DeKosky B J, Kojima T, Rodin A, Charab W, Ippolito G C, Ellington A D, Georgiou G. 2015. In-depth determination and analysis of the human paired heavy- and light-chain antibody repertoire. Nature medicine 21:86-91. [0305] 20. Gray E S, Madiga M C, Moore P L, Mlisana K, Abdool Karim S S, Binley J M, Shaw G M, Mascola J R, Morris L. 2009. Broad neutralization of human immunodeficiency virus type 1 mediated by plasma antibodies against the gp41 membrane proximal external region. Journal of virology 83:11265-11274. [0306] 21. Gray E S, Meyers T, Gray G, Montefiori D C, Morris L. 2006. Insensitivity of paediatric HIV-1 subtype C viruses to broadly neutralising monoclonal antibodies raised against subtype B. PLoS medicine 3:e255. [0307] 22. Alam S M, Morelli M, Dennison S M, Liao H X, Zhang R, Xia S M, Rits-Volloch S, Sun L, Harrison S C, Haynes B F, Chen B. 2009. Role of HIV membrane in neutralization by two broadly neutralizing antibodies. Proceedings of the National Academy of Sciences of the United States of America 106:20234-20239. [0308] 23. Alam S M, Liao H X, Dennison S M, Jaeger F, Parks R, Anasti K, Foulger A, Donathan M, Lucas J, Verkoczy L, Nicely N, Tomaras G D, Kelsoe G, Chen B, Kepler T B, Haynes B F. 2011. Differential reactivity of germ line allelic variants of a broadly neutralizing HIV-1 antibody to a gp41 fusion intermediate conformation. Journal of virology 85:11725-11731. [0309] 24. Shen X, Dennison S M, Liu P, Gao F, Jaeger F, Montefiori D C, Verkoczy L, Haynes B F, Alam S M, Tomaras G D. 2010. Prolonged exposure of the HIV-1 gp41 membrane proximal region with L669S substitution. Proceedings of the National Academy of Sciences of the United States of America 107:5972-5977. [0310] 25. Frey G, Chen J, Rits-Volloch S, Freeman M M, Zolla-Pazner S, Chen B. 2010. Distinct conformational states of HIV-1 gp41 are recognized by neutralizing and non-neutralizing antibodies. Nature structural & molecular biology 17:1486-1491. [0311] 26. Liao H X, Lynch R, Zhou T, Gao F, Alam S M, Boyd S D, Fire A Z, Roskin K M, Schramm C A, Zhang Z, Zhu J, Shapiro L, Program N C S, Mullikin J C, Gnanakaran S, Hraber P, Wiehe K, Kelsoe G, Yang G, Xia S M, Montefiori D C, Parks R, Lloyd K E, Scearce R M, Soderberg K A, Cohen M, Kamanga G, Louder M K, Tran L M, Chen Y, Cai F, Chen S, Moquin S, Du X, Joyce M G, Srivatsan S, Zhang B, Zheng A, Shaw G M, Hahn B H, Kepler T B, Korber B T, Kwong P D, Mascola J R, Haynes B F. 2013. Co-evolution of a broadly neutralizing HIV-1 antibody and founder virus. Nature 496:469-476. [0312] 27. Moody M A, Yates N L, Amos J D, Drinker M S, Eudailey J A, Gurley T C, Marshall D J, Whitesides J F, Chen X, Foulger A, Yu J S, Zhang R, Meyerhoff R R, Parks R, Scull J C, Wang L, Vandergrift N A, Pickeral J, Pollara J, Kelsoe G, Alam S M, Ferrari G, Montefiori D C, Voss G, Liao H X, Tomaras G D, Haynes B F. 2012. HIV-1 gp120 vaccine induces affinity maturation in both new and persistent antibody clonal lineages. Journal of virology 86:7496-7507. [0313] 28. Cheung W C, Beausoleil S A, Zhang X, Sato S, Schieferl S M, Wieler J S, Beaudet J G, Ramenani R K, Popova L, Comb M J, Rush J, Polakiewicz R D. 2012. A proteomics approach for the identification and cloning of monoclonal antibodies from serum. Nature biotechnology 30:447-452. [0314] 29. Wine Y, Boutz D R, Lavinder J J, Miklos A E, Hughes R A, Hoi K H, Jung S T, Horton A P, Murrin E M, Ellington A D, Marcotte E M, Georgiou G. 2013. Molecular deconvolution of the monoclonal antibodies that comprise the polyclonal serum response. Proceedings of the National Academy of Sciences of the United States of America 110:2993-2998. [0315] 30. Lavinder J J, Horton A P, Georgiou G, Ippolito G C. 2015. Next-generation sequencing and protein mass spectrometry for the comprehensive analysis of human cellular and serum antibody repertoires. Current opinion in chemical biology 24:112-120. [0316] 31. Levesque M C, Moody M A, Hwang K K, Marshall D J, Whitesides J F, Amos J D, Gurley T C, Allgood S, Haynes B B, Vandergrift N A, Plonk S, Parker D C, Cohen M S, Tomaras G D, Goepfert P A, Shaw G M, Schmitz J E, Eron J J, Shaheen N J, Hicks C B, Liao H X, Markowitz M, Kelsoe G, Margolis D M, Haynes B F. 2009. Polyclonal B cell differentiation and loss of gastrointestinal tract germinal centers in the earliest stages of HIV-1 infection. PLoS medicine 6:e1000107. [0317] 32. Scheid J F, Mouquet H, Feldhahn N, Seaman M S, Velinzon K, Pietzsch J, Ott R G, Anthony R M, Zebroski H, Hurley A, Phogat A, Chakrabarti B, Li Y, Connors M, Pereyra F, Walker B D, Wardemann H, Ho D, Wyatt R T, Mascola J R, Ravetch J V, Nussenzweig M C. 2009. Broad diversity of neutralizing antibodies isolated from memory B cells in HIV-infected individuals. Nature 458:636-640. [0318] 33. Tomaras G D, Binley J M, Gray E S, Crooks E T, Osawa K, Moore P L, Tumba N, Tong T, Shen X, Yates N L, Decker J, Wibmer C K, Gao F, Alam S M, Easterbrook P, Abdool Karim S, Kamanga G, Crump J A, Cohen M, Shaw G M, Mascola J R, Haynes B F, Montefiori D C, Morris L. 2011. Polyclonal B cell responses to conserved neutralization epitopes in a subset of HIV-1-infected individuals. Journal of virology 85:11502-11519. [0319] 34. Simek M D, Rida W, Priddy F H, Pung P, Carrow E, Laufer D S, Lehrman J K, Boaz M, Tarragona-Fiol T, Miiro G, Birungi J, Pozniak A, McPhee D A, Manigart O, Karita E, Inwoley A, Jaoko W, Dehovitz J, Bekker L G, Pitisuttithum P, Paris R, Walker L M, Poignard P, Wrin T, Fast P E, Burton D R, Koff W C. 2009. Human immunodeficiency virus type 1 elite neutralizers: individuals with broad and potent neutralizing activity identified by using a high-throughput neutralization assay together with an analytical selection algorithm. Journal of virology 83:7337-7348. [0320] 35. Walker L M, Phogat S K, Chan-Hui P Y, Wagner D, Phung P, Goss J L, Wrin T, Simek M D, Fling S, Mitcham J L, Lehrman J K, Priddy F H, Olsen O A, Frey S M, Hammond P W, Protocol GPI, Kaminsky S, Zamb T, Moyle M, Koff W C, Poignard P, Burton D R. 2009. Broad and potent neutralizing antibodies from an African donor reveal a new HIV-1 vaccine target. Science 326:285-289. [0321] 36. Walker L M, Huber M, Doores K J, Falkowska E, Pejchal R, Julien J P, Wang S K, Ramos A, Chan-Hui P Y, Moyle M, Mitcham J L, Hammond P W, Olsen O A, Phung P, Fling S, Wong C H, Phogat S, Wrin T, Simek M D, Protocol GPI, Koff W C, Wilson I A, Burton D R, Poignard P. 2011. Broad neutralization coverage of HIV by multiple highly potent antibodies. Nature 477:466-470. [0322] 37. Bonsignori M, Hwang K K, Chen X, Tsao C Y, Morris L, Gray E, Marshall D J, Crump J A, Kapiga S H, Sam N E, Sinangil F, Pancera M, Yongping Y, Zhang B, Zhu J, Kwong P D, O'Dell S, Mascola J R, Wu L, Nabel G J, Phogat S, Seaman M S, Whitesides J F, Moody M A, Kelsoe G, Yang X, Sodroski J, Shaw G M, Montefiori D C, Kepler T B, Tomaras G D, Alam S M, Liao H X, Haynes B F. 2011. Analysis of a clonal lineage of HIV-1 envelope V2/V3 conformational epitope-specific broadly neutralizing antibodies and their inferred unmutated common ancestors. Journal of virology 85:9998-10009. [0323] 38. Bonsignori M, Montefiori D C, Wu X, Chen X, Hwang K K, Tsao C Y, Kozink D M, Parks R J, Tomaras G D, Crump J A, Kapiga S H, Sam N E, Kwong P D, Kepler T B, Liao H X, Mascola J R, Haynes B F. 2012. Two distinct broadly neutralizing antibody specificities of different clonal lineages in a single HIV-1-infected donor: implications for vaccine design. Journal of virology 86:4688-4692. [0324] 39. Walker L M, Simek M D, Priddy F, Gach J S, Wagner D, Zwick M B, Phogat S K, Poignard P, Burton D R. 2010. A limited number of antibody specificities mediate broad and potent serum neutralization in selected HIV-1 infected individuals. PLoS pathogens 6:e1001028. [0325] 40. Gao F, Bonsignori M, Liao H X, Kumar A, Xia S M, Lu X, Cai F, Hwang K K, Song H, Zhou T, Lynch R M, Alam S M, Moody M A, Ferrari G, Berrong M, Kelsoe G, Shaw G M, Hahn B H, Montefiori D C, Kamanga G, Cohen M S, Hraber P, Kwong P D, Korber B T, Mascola J R, Kepler T B, Haynes B F. 2014. Cooperation of B cell lineages in induction of HIV-1-broadly neutralizing antibodies. Cell 158:481-491. [0326] 41. Amanna I J, Carlson N E, Slifka M K. 2007. Duration of humoral immunity to common viral and vaccine antigens. The New England journal of medicine 357:1903-1915. [0327] 42. Bonsignori M, Moody M A, Parks R J, Holl T M, Kelsoe G, Hicks C B, Vandergrift N, Tomaras G D, Haynes B F. 2009. HIV-1 envelope induces memory B cell responses that correlate with plasma antibody levels after envelope gp120 protein vaccination or HIV-1 infection. Journal of immunology 183:2708-2717.
[0328] Supplementary Materials and Methods
[0329] Donor Information
[0330] Plasma and peripheral blood mononuclear cells were collected from South African donor CH0210, chronically infected with a clade C virus for an unknown period at the time of enrollment in the Center for HIV/AIDS Vaccine Immunology (CHAVI) 001 chronic HIV-1 infection cohort (previously described in (33). Informed consent was obtained under clinical protocols approved by the Institutional Review Board of the Duke University Health System and clinical site in South Africa. The DH511 bnAb lineage was isolated from PBMC and plasma collected at 8 weeks post-study enrollment, where the viral load was 5,180 copies/ml and CD4 T cell count was unknown, at which time donor CH0210 had not initiated anti-retroviral therapy (ART).
[0331] Epitope Mapping and Neutralization-Based Epitope Prediction Analysis
[0332] Donor CH0210 plasma was screened for neutralization breadth utilizing standard experimental mapping and computational methods for epitope prediction (13, 43). Anti-MPER bnAb activity was detected using two different assays: plasma neutralization of the HIV-2/HIV-1 MPER chimeric pseudovirus C1C and plasma adsorption with MPER peptide coated magnetic beads, followed by testing of adsorbed plasmas for reduction of neutralization activity as described previously (44). An algorithm for Neutralization-based Epitope Prediction (NEP) (13, 43) was used to delineate the specificities mediating breadth against a panel of 21 diverse HIV-1 strains. The resulting linear coefficients on a scale of (0 to 1) from the computational procedure was used to predict the relative prevalence of each of the reference antibody specificities in donor CH0210 plasma.
[0333] Antigen-Specific Single Memory B Cell Sorting and Antibody Expression
[0334] As previously described (14), fluorescently-labeled MPER peptide tetramer probes were generated using biotinylated MPR. 03 peptide (KKKNEQELLELDKWASLWNWFDITNWLWYIRKKK-biotin (SEQ ID NO: 463)) (CPC Scientific Inc., San Jose, Calif.) conjugated to fluorophore-labeled streptavidins, yielding a tetramer with four MPER epitopes for surface Ig cross-linking. Eleven and a half million PBMC from donor CH0210 were stained with MPR.03-Alexa647 and MPR.03-Brilliant Violet 421 peptide tetramers and a cocktail of antibodies to identify MPER-specific memory B cells: surface IgM (FITC), surface IgD (phycoerythrin [PE]), CD3 (PE-Cy5), CD16 (Brilliant Violet 570), CD235a (PE-Cy5), and CD19 (allophycocyanin [APC]-Cy7) (BD Biosciences, San Jose, Calif.); CD14 (Brilliant Violet 605) (Invitrogen, Carlsbad, Calif.); CD27 (PE-Cy7), CD38 (APC-Alexa Fluor 700) (Beckman Coulter, Brea, Calif.), and CD10 (ECD) (Beckman Coulter, Brea, Calif.). Aqua blue vital dye (Invitrogen, Carlsbad, Calif.) was used to stain dead cells. Using a four laser FACS Aria cell sorter and FACSDiva software (BD Biosciences, San Jose, Calif.), MPR.03 double positive CD16-CD14-CD3-CD235-CD19+IgD-CD38hi memory B cells were single cell sorted into individual wells of a 96-well plate containing reverse transcription (RT) reaction buffer (5 μL of 5′ first-strand cDNA buffer, 0.5 μL of RNaseOUT [Invitrogen, Carlsbad, Calif.], 1.25 μL of dithiothreitol, 0.0625 μL Igepal CA-630 [Sigma, St. Louis, Mo.], 13.25 μL of distilled H2O [dH2O; Invitrogen, Carlsbad, Calif.]). Data were further analyzed using FlowJo software (TreeStar, Ashland, Oreg.). Plates were stored at −80° C. until PCR could be performed.
[0335] PCR Amplification and Expression of Ig Genes
[0336] Immunoglobulin genes were amplified from RNA of isolated cells by reverse transcription-polymerase chain reaction (RT-PCR). For RT, 10 mM dNTPs (New England Biolabs, Ipswich, Mass.), 3 μl random hexamers at 150 ng/ml (GeneLink, Hawthorne, N.Y.), and 1 μl SuperScript® III (Invitrogen, Carlsbad, Calif.) were added to each well and subjected to thermocycling under the following conditions: 42° C. for 10 minutes, 25° C. for 10 minutes, 50° C. for 60 minutes and 94° C. for 5 minutes. IgH, Igκ, and Igλ variable region genes were separately amplified from the cDNA by nested PCR, using AmpliTaq Gold® 360 Mastermix (Invitrogen, Carlsbad, Calif.), heavy-chain (45) and light-chain gene-specific primers as previously described (46). PCR amplicons were purified and sequenced, and V.sub.HDJ.sub.H and VOL genes, mutation frequencies, and CDR3 lengths were determined using the Clonanalyst software (47). Clonal relatedness and inference of the unmutated common ancestor (UCA) and intermediate antibodies were determined by computational methods as described in (26, 40, 48). Maximum likelihood phylogenetic trees were constructed from V(D)J sequences using the Phylogeny Inference Package (PHYLIP) (version 3.69; (49). Transient small-scale expression of antibodies was achieved by overlapping PCR assembly of variable heavy and light-chain gene pairs into IgH, Igκ, and Igλ linear expression cassettes for production of full length IgG1 mAbs by transfection into 293T cells as described previously (46). Supernatants were screened for HIV-1 Env binding by ELISA and neutralization activity in TZM-bl cells. For large scale antibody production, antibody variable heavy-chain and light-chain genes were de novo synthesized (GenScript, Township, N.J.), cloned into pcDNA3.1 expression vectors containing the constant regions of IgG1 (46), and co-transfected at equal ratios in Expi 293i cells using ExpiFectamine 293 transfection reagents (Thermo Fischer Scientific, Waltham, Mass.) according to the manufacturer's instructions. Culture supernatants were harvested and concentrated after 4-5 days incubation at 37° C. and 8% CO.sub.2, followed by affinity purification by protein A column (Pierce, Thermo Fisher Scientific, Waltham, Mass.). Antibody purity was evaluated by SDS-Page and Coomassie Blue staining for heavy and light-chains of the appropriate size.
[0337] ELISA Assays
[0338] Binding of transiently transfected supernatants and mAbs to HIV-1 Env proteins and peptides was detected by enzyme-linked immunosorbent assay (ELISA). High-binding 384-well plates (Corning, Oneonta, N.Y.) were coated overnight at 4° C. or for 2 hours at room temperature with 2 μg/ml HIV-1 protein or streptavidin (for detection of binding to biotinylated peptides) in 0.1 M sodium bicarbonate (Sigma Aldrich, St. Louis, Mo.). Plates were blocked for 1 hour at room temperature with assay diluent comprised of phosphate buffered saline (PBS), 4% (weight/volume) whey protein (BiPro USA, Prairie, Minn.), 15% normal goat serum (Invitrogen, Carlsbad, Calif.), 0.5% Tween 20, and 0.05% sodium azide (Sigma Aldrich, St. Louis, Mo.), followed by a 1 hour incubation with antibody at a starting concentration of 100 μg/ml, serially diluted 3-fold. Horseradish peroxidase-conjugated goat anti-human IgG Fc antibody (Jackson ImmunoResearch Laboratories, West Grove, Pa.) was added to each well and incubated for 1 hour, after which plates were washed with PBS/0.1% Tween 20 and developed with SureBlue Reserve TMB One Component Microwell Peroxidase Substrate for 15 minutes (KPL, Gaithersburg, Md.). Development was stopped with 0.1 M HCl, and plates were read at 450 nm. Experiments were performed in duplicate, and results were reported as logarithm area under the curve (Log AUC). For epitope mapping, purified mAbs were screened as listed above against a panel of MPR.03 alanine scanned peptides. Epitope positions were defined by MPR.03 alanine scan mutations that reduced the Log AUC by >50% compared to the wild-type peptide.
[0339] Neutralization Assays
[0340] Neutralization assays were performed using HIV-1 Env pseudoviruses to infect TZM-bl cells as previously described (50, 51). A five-parameter hill slope equation was used to fit neutralization curves by non-linear regression and for determination of maximum percent inhibition (MPI) values. Titers were calculated as 50% or 80% inhibitory concentrations (IC.sub.50 and IC.sub.80) and reported as the concentration of antibody causing a 50% or 80% reduction in relative luminescence units compared to virus control wells. Mapping of the MPER residues critical for neutralization was performed using a panel of alanine scanned COT6.15 Env pseudoviruses as described previously (20, 21).
[0341] Poly/Autoreactivity Analysis
[0342] Antibody binding to a panel of nine autoantigens, including Sjogren's syndrome antigen (SSA), SSB, Smith antigen (Sm), ribonucleoprotein (RNP), scleroderma 70 (Scl-70), Jo-1, double-stranded DNA (dsDNA), centromere B (Cent B), and histone, was quantified by ELISA. Anti-cardiolipin reactivity was measured using the QUANTA Lite ACA IgG III ELISA kit (Nova Diagnostics, San Diego, Calif.) per the manufacturer's instructions as previously described (52). Antibodies were assayed for reactivity to the human epithelial cell line (HEp-2) by indirect immunofluorescence staining using the IFA ANA/Hep-2 Test System (Zeus Scientific, Somerville, N.J.) per the manufacturer's protocol. Antibodies were diluted to 50 μg/ml and 25 μg/ml and scored negative or positive (1+ to 4+) at each dilution. Antibodies were also screened for binding to a panel of >9,400 human proteins using a Protoarray microarray (Invitrogen, Carlsbad, Calif.) according to the manufacturer's instructions and as described in (6). Briefly, the array was blocked and incubated on ice with 2 μg/ml HIV-1 antibody or the isotype control antibody, human myeloma protein, 151K (Southern Biotech, Birmingham, Ala.) for 90 minutes. Antibody binding was detected with 1 μg/ml anti-human IgG-Alexa-647 secondary antibody (Invitrogen). Arrays were scanned using a GenePix 4000B scanner (Molecular Devices, Sunnyvale, Calif.) at a wavelength of 635 nm, 10 μm resolution, using 100% power and 650 gain. The fluorescence intensity of antibody binding was measured with the GenePix Pro 5.0 program (Molecular Devices, Sunnyvale, Calif.).
[0343] Surface Plasmon Resonance Affinity and Kinetics Measurements
[0344] Surface plasmon resonance analysis was performed on a Biacore 3000 instrument (GE Healthcare, Little Chalfont, UK) at 25° C. and data analyzed using the BIAevaluation 4.1 software (BIAcore) as described previously (Alam et al. JI 2007). To determine the affinity, association and dissociation rate constants of the DH511 clonal lineage to MPER, biotinylated MPR.03 peptide was coated on streptavidin sensors at a density of 58 response units (RUs). DH511 lineage Fabs were injected over flow cells at increasing concentrations at a flow and minute dissociation steps. Curves were blank surface and CH58 Fab analyte subtracted. Peptide-liposome conjugates were generated with MPER656.1-GTH1 peptides using an extrusion method (4) and analyzed for binding in a two-step encounter docking model as described previously (4).
[0345] Time Course of DH511.2 Neutralization
[0346] The time course of DH511.2 neutralization was determined using a post-attachment HIV-1 pseudotyped virus neutralization assay described previously (53). Inhibitory concentrations of DH511.2, 10E8, and 4E10 mAb were added to TZM-bl cells incubated with B.BG1168 virus at different time intervals after infection. Infectivity was measured in relative light units (RLUs).
[0347] High-Throughput Paired VH:VL Sequencing of Immunoglobulin Transcripts
[0348] Material & reagents. Protein G Plus agarose, NeutrAvidin agarose, immobilized pepsin resin and Hypersep SpinTip C18 columns (C18-SpinTips) were acquired from Pierce (Thermo Fisher Scientific, Rockford, Ill.). TRIS hydrocholoride (Tris-HCl), ammonium bicarbonate (NH4HCO3), 2,2,2-trifluoroethanol (TFE), dithiothrietol (DTT), and iodoacetamide (IAM) were obtained from Sigma-Aldrich (St. Louis, Mo.). LC-MS grade water, acetonitrile (ACN), and formic acid were purchased from EMD (Billerica, Mass.).
[0349] Isolation of memory B cells. Frozen PBMCs (10 million cells in 1 mL) were thawed at 37° C., resuspended in 50 mL of RPMI 1640 (Lonza) supplemented with 10% Fetal Bovine Serum, lx non-essential amino acids, lx sodium pyruvate, lx glutamine, lx penicillin/streptomycin, and 20 U/mL DNAse I, and recovered via centrifugation (300 g for 10 min at 20° C.). The cells were then resuspended in 4 mL of RPMI and allowed to recover at 37° C. for 30 min. The cells were diluted with 10 mL of cold MACS buffer (PBS supplemented with 0.5% BSA and 2 mM EDTA), collected by centrifugation (300 g for 10 min at 4° C.), and depleted of non-B cells using the Human Memory B Cell Isolation Kit with an LD column (Miltenyi Biotec) as per the manufacturer's instructions. This yielded 400,000-500,000 B cells per vial.
[0350] Amplification of the paired VH:VL repertoire. The paired VH and VL sequences were then determined using a custom designed axisymmetric flow focusing device (19) that is comprised of three concentric tubes. Total B cells were suspended in 6 mL of cold PBS and passed through the innermost tube at a rate of 0.5 mL/min. Oligo d(T).sub.25 magnetic beads (1 μm diameter at a concentration of 45 μL beads/mL solution; NEB) were washed, subjected to focused ultrasonication (Covaris) to dissociate any aggregates, resuspended in 6 mL of lysis buffer (100 mM Tris-HCl pH 7.5, 500 mM LiCl, 10 mM EDTA, 1% Lithium dodecyl sulfate (LiDS), 5 mM DTT), and passed through the middle tube at a rate of 0.5 mL/min. The outer tubing contained an oil phase (mineral oil containing 4.5% Span-80, 0.4% Tween-80, and 0.05% Triton X-100; Sigma-Aldrich) flowing at 3 mL/min. The cells, beads, and lysis buffer were emulsified as they passed through a custom designed 120 μm diameter orifice, and were subsequently collected in 2 mL microcentrifuge tubes. Each tube was inverted several times, incubated at 20° C. for 3 minutes, and then placed on ice. Following the collection phase, emulsions were pooled into 50 mL conicals, and centrifuged (4,000 g for 5 min at 4° C.). The mineral oil (upper phase) was decanted, and the emulsions (bottom phase) were broken with water-saturated cold diethyl ether (Fischer). Magnetic beads were recovered following a second centrifugation step (4,000 g for 5 min at 4° C.) and resuspended in 1 mL of cold Buffer 1 (100 mM Tris pH 7.5, 500 mM LiCl, 10 mM EDTA, 1% LiDS, 5 mM DTT). The beads were then serially pelleted using a magnetic rack, and washed with the following buffers: 1 mL lysis buffer, 1 mL Buffer 1, and 0.5 mL Buffer 2 (20 mM Tris pH 7.5, 50 mM KCl, 3 mM MgCl). The beads were split into two aliquots, and each was then pelleted one final time and resuspended in an RT-PCR mixture (19) containing VH and VL Framework Region 1 (FR1) linkage primers or VH and VL leader peptide (LP) linkage primers (Supplementary Tables 28 and 29). The RT-PCR mixtures were then added dropwise to 9 mL of chilled oil phase in an IKA dispersing tube (DT-20, VWR) and emulsified using an emulsion dispersing apparatus (Ultra-Turrax® Tube Drive; IKA) for 5 min. The emulsions were aliquoted into 96-well PCR plates (100 uL/well), and subjected to RT-PCR under the following conditions: 30 min at 55° C. followed by 2 min at 94° C.; 4 cycles of 94° C. for 30 s, 50° C. for 30 s, 72° C. for 2 min; 4 cycles of 94° C. for 30 s, 55° C. for 30 s, 72° C. for 2 min; 32 cycles of 94° C. for 30 s, 60° C. for 30 s, 72° C. for 2 min; 72° C. for 7 min; held at 4° C.
[0351] Following RT-PCR, the emulsions were collected in 2 mL microcentrifuge tubes and centrifuged (16000 g for 10 min at 20° C.). The mineral oil (upper phase) was decanted, and water-saturated ether was used to break the emulsions. The aqueous phase (containing the DNA) was extracted three times by sequentially adding ether, centrifuging the samples (16000 g for 30 s at 20° C.), and removing the upper ether phase. Trace amounts of ether were removed using a SpeedVac for 30 min at 20° C. The DNA amplicons were purified using a silica spin column (Zymo-Spin™ I, Zymo Research) according to the manufacturer's instructions, and eluted in 40 μL H.sub.2O. The two samples were then amplified through a nested PCR (see Supplementary Table 30 for primers) using Platinum Taq (Life Technologies) under the following conditions: (FR1 primer derived sample) 2 min at 94° C., 32 cycles of 94° C. for 30 s, 62° C. for 30 s, 72° C. for 20 s; 72° C. for 7 min; held at 4° C.; (LP primer derived sample) 2 min at 94° C., 27 cycles of 94° C. for 30 s, 62° C. for 30 s, 72° C. for 20 s; 72° C. for 7 min; held at 4° C. The amplicons, approximately 850 bp in length, were gel purified from 1% agarose using a gel extraction kit (Zymo Research) according to the manufacturer's instructions, and eluted in 20 μL H.sub.2O.
[0352] To determine the full length VH and VL reads for antibody expression studies, the paired amplicon was subjected to an additional PCR using NEBNext high fidelity polymerase (NEB) to specifically amplify the full VH chain and the full VL chain separately in addition to the paired chains (Note: the paired reads sequence the entire J- and D-regions, and the fragment of the V regions spanning FR2 to CDR3). Each sample was split into 5 reactions and subjected to the following PCR conditions: 30 s at 98° C., X cycles of 98° C. for 10 s, 62° C. for 30 s, 72° C. for Y s; 72° C. for 7 min; held at 4° C. (See Supplementary Table 31 for the PCR conditions and Supplementary Table 32 for the primer sequences). Finally, these sequences were amplified one final time with TSBC compatible barcoding primers following the protocol shown in Supplementary Table 33, gel purified from 1% agarose using a gel purification kit according to manufacturer's instructions, and submitted for paired-end Illumina NGS.
[0353] Bioinformatic analysis of NGS data. Raw 2×300 MiSeq reads were quality filtered (minimum Phred score of 20 over half of the nucleotide sequence) and submitted to MiXCR (54) for CDR3 identification and gene annotation. Productive VH and VL reads were paired by Illumina MiSeq ID using a custom python script. Full length VH and VL reads were stitched together using FLAsH (55) and then quality filtered. Full length VH and VL constructs were designed by matching the paired CDRH3:CDRL3 nucleotide sequences to the respective CDR3 in the full length VH and VL libraries.
[0354] Sample preparation & LC-MS/MS analysis. Serum IgG from donor 0210 was purified by Protein G Plus agarose affinity chromatography, and F(ab′)2 fragments were generated by digestion with immobilized pepsin. Antigen-specific F(ab′)2 was isolated by affinity chromatography with the biotinylated MPER peptide coupled to NeutrAvidin agarose and eluted in 100 mM glycine pH 2.7. The collected fractions were neutralized and the protein containing fractions were pooled and prepared for LC-MS/MS as described previously (10). Briefly, protein samples were concentrated and resuspended in 50% (v/v) TFE, 50 mM NH4HCO3 and 2.5 mM DTT and incubated at 55° C. for 45 min. The reduced samples were then alkylated with IAM in the dark, at room temperature for 30 min. The reaction was quenched by addition of DTT and the samples were diluted to 5% TFE and digested with trypsin (trypsin/protein ration of 1:75 at 37° C. for 5 h). The digestion was stopped by addition of formic acid to 1% (v/v). The samples were then concentrated by SpeedVac, resuspended in 5% ACN, 0.1% formic acid and the peptides were washed on C18-SpinTips according to the manufacturer's protocol. Subsequently, the peptides were separated by reverse phase chromatography (Dionex UltiMate 3000 RSLCnano system with Dionex Acclaim PepMapRSLC C18 column, Thermo Scientific) and analyzed on-line by nano-ESI tandem MS on an Orbitrap Velos Pro (Thermo Scientific). MS1 scans were collected in the orbitrap at 60,000 resolution and ions with >+1 charge were fragmented by CID with up to 20 MS2 spectra collected per MS1.
[0355] Computational interpretation of peptide mass spectra. Full length VH and VL sequencing data (see above) was submitted to the IMGT/HighV-Quest Tool (56) for annotation and unique full length VH sequences were clustered into clonotypes according to their CDRH3 sequences with a cut-off of 85% identity as described previously (29). The sample-specific target protein sequence database was constructed from the full-length VH and VL sequences mentioned above (≥2 reads), Ensembl human protein-coding sequences and common contaminants (maxquant.org). The spectra were then searched against this database using the SEQUEST (Proteome Discoverer 1.4, Thermo Scientific) with previously described settings (15). The resulting PSMs were filtered with Percolator (Proteome Discoverer 1.4) to control false discovery rates (FDR) to <1% and the average mass deviation (AMD) was calculated for all high-confidence PSMs and peptides with an AMD of <1.5 ppm were kept for the final dataset. Informative peptides, as defined previously (15), were grouped by their CDRH1, 2 or 3 association and for each group the abundances of the corresponding clonotypes were determined by the sum of the extracted-ion chromatograms of the respective precursor ions.
[0356] Crystallization, Structure Determination, and Structural Analysis.
[0357] Purified DH511.1 and DH511.2 fragments of antigen binding (Fabs) were set up in crystallization trials in complex with a panel of gp41 MPER peptides. For each complex, 576 initial conditions from commercially available screens (Hampton Research, Rigaku) were set up as vapor diffusion sitting drops robotically (TTP Labtech). Crystals of DH511 Fab in complex with gp41 MPER peptide 656-683 were obtained in a condition composed of 30% PEG 1500, while those of DH511.2 Fab in complex with peptides MPR.03.DN4 and MPR.03.DN14, were obtained in 30% PEG 1500, 10% Isopropanol, 0.1 M CaCl.sub.2, 0.1 M Imidazole pH 6.5 and in 20% PEG 8000, 10% PEG 400, 0.5 M NaCl, 0.1 M C.sub.2H.sub.3NaO.sub.2 pH 5.5, respectively. Crystal hits were hand optimized and X-ray diffraction data extended to 2.8, 2.65, and 2.2 Å, respectively. Data was processed with HKL-2000 (57) and structures were solved by molecular replacement using the DH514 Fab unliganded structure as a search model in Phaser (58). The structures were refined to R.sub.crystal/R.sub.free of 21.28/25.57, 25.61/28.99, and 19.03/22.63%, respectively, using Phenix (59) combined with iterative model building in Coot (60). Interactive surfaces were determined using Pisa (61) and structural alignments using LSQKAB (62). All graphical images were prepared with Pymol (PyMOL Molecular Graphics System). X-ray diffraction data was collected at SER CAT ID-22 or BM-22 beamlines of the Advanced Photon Source (Argonne, Ill.), under General User Proposal 44127 (G.O.).
SUPPLEMENTAL REFERENCES
[0358] 1. Huang J, Ofek G, Laub L, Louder M K, Doria-Rose N A, Longo N S, Imamichi H, Bailer R T, Chakrabarti B, Sharma S K, Alam S M, Wang T, Yang Y, Zhang B, Migueles SA, Wyatt R, Haynes B F, Kwong P D, Mascola J R, Connors M. 2012. Broad and potent neutralization of HIV-1 by a gp41-specific human antibody. Nature 491:406-412. [0359] 2. Zwick M B, Labrijn A F, Wang M, Spenlehauer C, Saphire E O, Binley J M, Moore J P, Stiegler G, Katinger H, Burton D R, Parren P W. 2001. Broadly neutralizing antibodies targeted to the membrane-proximal external region of human immunodeficiency virus type 1 glycoprotein gp41. Journal of virology 75:10892-10905. [0360] 3. Yang G, Holl T M, Liu Y, Li Y, Lu X, Nicely N I, Kepler T B, Alam S M, Liao H X, Cain D W, Spicer L, VandeBerg J L, Haynes B F, Kelsoe G. 2013. Identification of autoantigens recognized by the 2F5 and 4E10 broadly neutralizing HIV-1 antibodies. The Journal of experimental medicine 210:241-256. [0361] 4. Alam S M, McAdams M, Boren D, Rak M, Scearce R M, Gao F, Camacho Z T, Gewirth D, Kelsoe G, Chen P, Haynes B F. 2007. The role of antibody polyspecificity and lipid reactivity in binding of broadly neutralizing anti-HIV-1 envelope human monoclonal antibodies 2F5 and 4E10 to glycoprotein 41 membrane proximal envelope epitopes. Journal of immunology 178:4424-4435. [0362] 5. Chen J, Frey G, Peng H, Rits-Volloch S, Garrity J, Seaman M S, Chen B. 2014. Mechanism of HIV-1 neutralization by antibodies targeting a membrane-proximal region of gp41. Journal of virology 88:1249-1258. [0363] 6. Liu M, Yang G, Wiehe K, Nicely N I, Vandergrift N A, Rountree W, Bonsignori M, Alam S M, Gao J, Haynes B F, Kelsoe G. 2015. Polyreactivity and autoreactivity among HIV-1 antibodies. Journal of virology 89:784-798. [0364] 7. Haynes B F, Gilbert P B, McElrath M J, Zolla-Pazner S, Tomaras G D, Alam S M, Evans D T, Montefiori D C, Karnasuta C, Sutthent R, Liao H X, DeVico A L, Lewis G K, Williams C, Pinter A, Fong Y, Janes H, DeCamp A, Huang Y, Rao M, Billings E, Karasavvas N, Robb M L, Ngauy V, de Souza M S, Paris R, Ferrari G, Bailer R T, Soderberg K A, Andrews C, Berman P W, Frahm N, De Rosa S C, Alpert M D, Yates N L, Shen X, Koup R A, Pitisuttithum P, Kaewkungwal J, Nitayaphan S, Rerks-Ngarm S, Michael N L, Kim J H. 2012. Immune-correlates analysis of an HIV-1 vaccine efficacy trial. The New England journal of medicine 366:1275-1286. [0365] 8. Moir S, Ho J, Malaspina A, Wang W, DiPoto A C, O'Shea M A, Roby G, Kottilil S, Arthos J, Proschan M A, Chun T W, Fauci A S. 2008. Evidence for HIV-associated B cell exhaustion in a dysfunctional memory B cell compartment in HIV-infected viremic individuals. The Journal of experimental medicine 205:1797-1805. [0366] 9. Kardava L, Moir S, Shah N, Wang W, Wilson R, Buckner C M, Santich B H, Kim L J, Spurlin E E, Nelson A K, Wheatley A K, Harvey C J, McDermott A B, Wucherpfennig K W, Chun T W, Tsang J S, Li Y, Fauci A S. 2014. Abnormal B cell memory subsets dominate HIV-specific responses in infected individuals. The Journal of clinical investigation 124:3252-3262. [0367] 10. Boutz D R, Horton A P, Wine Y, Lavinder J J, Georgiou G, Marcotte E M. 2014. Proteomic identification of monoclonal antibodies from serum. Analytical chemistry 86:4758-4766. [0368] 11. Wrammert J, Koutsonanos D, Li G M, Edupuganti S, Sui J, Morrissey M, McCausland M, Skountzou I, Hornig M, Lipkin W I, Mehta A, Razavi B, Del Rio C, Zheng N Y, Lee J H, Huang M, Ali Z, Kaur K, Andrews S, Amara RR, Wang Y, Das S R, O'Donnell C D, Yewdell J W, Subbarao K, Marasco W A, Mulligan M J, Compans R, Ahmed R, Wilson P C. 2011. Broadly cross-reactive antibodies dominate the human B cell response against 2009 pandemic H1N1 influenza virus infection. The Journal of experimental medicine 208:181-193. [0369] 12. Purtha W E, Tedder T F, Johnson S, Bhattacharya D, Diamond M S. 2011. Memory B cells, but not long-lived plasma cells, possess antigen specificities for viral escape mutants. The Journal of experimental medicine 208:2599-2606. [0370] 13. Georgiev I S, Doria-Rose N A, Zhou T, Kwon Y D, Staupe R P, Moquin S, Chuang G Y, Louder M K, Schmidt S D, Altae-Tran H R, Bailer R T, McKee K, Nason M, O'Dell S, Ofek G, Pancera M, Srivatsan S, Shapiro L, Connors M, Migueles S A, Morris L, Nishimura Y, Martin M A, Mascola J R, Kwong P D. 2013. Delineating antibody recognition in polyclonal sera from patterns of HIV-1 isolate neutralization. Science 340:751-756. [0371] 14. Morris L, Chen X, Alam M, Tomaras G, Zhang R, Marshall D J, Chen B, Parks R, Foulger A, Jaeger F, Donathan M, Bilska M, Gray E S, Abdool Karim S S, Kepler T B, Whitesides J, Montefiori D, Moody M A, Liao H X, Haynes B F. 2011. Isolation of a human anti-HIV gp41 membrane proximal region neutralizing antibody by antigen-specific single B cell sorting. PloS one 6:e23532. [0372] 15. Lavinder J J, Wine Y, Giesecke C, Ippolito G C, Horton A P, Lungu O I, Hoi K H, DeKosky B J, Murrin E M, Wirth M M, Ellington A D, Dorner T, Marcotte E M, Boutz D R, Georgiou G. 2014. Identification and characterization of the constituent human serum antibodies elicited by vaccination. Proceedings of the National Academy of Sciences of the United States of America 111:2259-2264. [0373] 16. Wine Y, Horton A P, Ippolito G C, Georgiou G. 2015. Serology in the 21st century: the molecular-level analysis of the serum antibody repertoire. Current opinion in immunology 35:89-97. [0374] 17. McDaniel J R, DeKosky B J, Tanno H, Ellington A D, Georgiou G. 2016. Ultra-high-throughput sequencing of the immune receptor repertoire from millions of lymphocytes. Nature protocols 11:429-442. [0375] 18. DeKosky B J, Ippolito G C, Deschner R P, Lavinder J J, Wine Y, Rawlings B M, Varadarajan N, Giesecke C, Dorner T, Andrews S F, Wilson P C, Hunicke-Smith S P, Willson C G, Ellington A D, Georgiou G. 2013. High-throughput sequencing of the paired human immunoglobulin heavy and light chain repertoire. Nature biotechnology 31:166-169. [0376] 19. DeKosky B J, Kojima T, Rodin A, Charab W, Ippolito G C, Ellington A D, Georgiou G. 2015. In-depth determination and analysis of the human paired heavy- and light-chain antibody repertoire. Nature medicine 21:86-91. [0377] 20. Gray E S, Madiga M C, Moore P L, Mlisana K, Abdool Karim S S, Binley J M, Shaw G M, Mascola J R, Morris L. 2009. Broad neutralization of human immunodeficiency virus type 1 mediated by plasma antibodies against the gp41 membrane proximal external region. Journal of virology 83:11265-11274. [0378] 21. Gray E S, Meyers T, Gray G, Montefiori D C, Morris L. 2006. Insensitivity of paediatric HIV-1 subtype C viruses to broadly neutralising monoclonal antibodies raised against subtype B. PLoS medicine 3:e255. [0379] 22. Alam S M, Morelli M, Dennison S M, Liao H X, Zhang R, Xia S M, Rits-Volloch S, Sun L, Harrison S C, Haynes B F, Chen B. 2009. Role of HIV membrane in neutralization by two broadly neutralizing antibodies. Proceedings of the National Academy of Sciences of the United States of America 106:20234-20239. [0380] 23. Alam S M, Liao H X, Dennison S M, Jaeger F, Parks R, Anasti K, Foulger A, Donathan M, Lucas J, Verkoczy L, Nicely N, Tomaras G D, Kelsoe G, Chen B, Kepler T B, Haynes B F. 2011. Differential reactivity of germ line allelic variants of a broadly neutralizing HIV-1 antibody to a gp41 fusion intermediate conformation. Journal of virology 85:11725-11731. [0381] 24. Shen X, Dennison S M, Liu P, Gao F, Jaeger F, Montefiori D C, Verkoczy L, Haynes B F, Alam S M, Tomaras G D. 2010. Prolonged exposure of the HIV-1 gp41 membrane proximal region with L669S substitution. Proceedings of the National Academy of Sciences of the United States of America 107:5972-5977. [0382] 25. Frey G, Chen J, Rits-Volloch S, Freeman M M, Zolla-Pazner S, Chen B. 2010. Distinct conformational states of HIV-1 gp41 are recognized by neutralizing and non-neutralizing antibodies. Nature structural & molecular biology 17:1486-1491. [0383] 26. Liao H X, Lynch R, Zhou T, Gao F, Alam S M, Boyd S D, Fire A Z, Roskin K M, Schramm C A, Zhang Z, Zhu J, Shapiro L, Program N C S, Mullikin J C, Gnanakaran S, Hraber P, Wiehe K, Kelsoe G, Yang G, Xia S M, Montefiori D C, Parks R, Lloyd K E, Scearce R M, Soderberg K A, Cohen M, Kamanga G, Louder M K, Tran L M, Chen Y, Cai F, Chen S, Moquin S, Du X, Joyce M G, Srivatsan S, Zhang B, Zheng A, Shaw G M, Hahn B H, Kepler T B, Korber B T, Kwong P D, Mascola J R, Haynes B F. 2013. Co-evolution of a broadly neutralizing HIV-1 antibody and founder virus. Nature 496:469-476. [0384] 27. Moody M A, Yates N L, Amos J D, Drinker M S, Eudailey J A, Gurley T C, Marshall D J, Whitesides J F, Chen X, Foulger A, Yu J S, Zhang R, Meyerhoff R R, Parks R, Scull J C, Wang L, Vandergrift N A, Pickeral J, Pollara J, Kelsoe G, Alam S M, Ferrari G, Montefiori D C, Voss G, Liao H X, Tomaras G D, Haynes B F. 2012. HIV-1 gp120 vaccine induces affinity maturation in both new and persistent antibody clonal lineages. Journal of virology 86:7496-7507. [0385] 28. Cheung W C, Beausoleil S A, Zhang X, Sato S, Schieferl S M, Wieler J S, Beaudet J G, Ramenani R K, Popova L, Comb M J, Rush J, Polakiewicz R D. 2012. A proteomics approach for the identification and cloning of monoclonal antibodies from serum. Nature biotechnology 30:447-452. [0386] 29. Wine Y, Boutz D R, Lavinder J J, Miklos A E, Hughes R A, Hoi K H, Jung S T, Horton A P, Murrin E M, Ellington A D, Marcotte E M, Georgiou G. 2013. Molecular deconvolution of the monoclonal antibodies that comprise the polyclonal serum response. Proceedings of the National Academy of Sciences of the United States of America 110:2993-2998. [0387] 30. Lavinder J J, Horton A P, Georgiou G, Ippolito G C. 2015. Next-generation sequencing and protein mass spectrometry for the comprehensive analysis of human cellular and serum antibody repertoires. Current opinion in chemical biology 24:112-120. [0388] 31. Levesque M C, Moody M A, Hwang K K, Marshall D J, Whitesides J F, Amos J D, Gurley T C, Allgood S, Haynes B B, Vandergrift N A, Plonk S, Parker D C, Cohen M S, Tomaras G D, Goepfert P A, Shaw G M, Schmitz J E, Eron J J, Shaheen N J, Hicks C B, Liao H X, Markowitz M, Kelsoe G, Margolis D M, Haynes B F. 2009. Polyclonal B cell differentiation and loss of gastrointestinal tract germinal centers in the earliest stages of HIV-1 infection. PLoS medicine 6:e1000107. [0389] 32. Scheid J F, Mouquet H, Feldhahn N, Seaman M S, Velinzon K, Pietzsch J, Ott R G, Anthony R M, Zebroski H, Hurley A, Phogat A, Chakrabarti B, Li Y, Connors M, Pereyra F, Walker B D, Wardemann H, Ho D, Wyatt R T, Mascola J R, Ravetch J V, Nussenzweig M C. 2009. Broad diversity of neutralizing antibodies isolated from memory B cells in HIV-infected individuals. Nature 458:636-640. [0390] 33. Tomaras G D, Binley J M, Gray E S, Crooks E T, Osawa K, Moore P L, Tumba N, Tong T, Shen X, Yates N L, Decker J, Wibmer C K, Gao F, Alam S M, Easterbrook P, Abdool Karim S, Kamanga G, Crump J A, Cohen M, Shaw G M, Mascola J R, Haynes B F, Montefiori D C, Morris L. 2011. Polyclonal B cell responses to conserved neutralization epitopes in a subset of HIV-1-infected individuals. Journal of virology 85:11502-11519. [0391] 34. Simek M D, Rida W, Priddy F H, Pung P, Carrow E, Laufer D S, Lehrman J K, Boaz M, Tarragona-Fiol T, Miiro G, Birungi J, Pozniak A, McPhee D A, Manigart O, Karita E, Inwoley A, Jaoko W, Dehovitz J, Bekker L G, Pitisuttithum P, Paris R, Walker L M, Poignard P, Wrin T, Fast P E, Burton D R, Koff W C. 2009. Human immunodeficiency virus type 1 elite neutralizers: individuals with broad and potent neutralizing activity identified by using a high-throughput neutralization assay together with an analytical selection algorithm. Journal of virology 83:7337-7348. [0392] 35. Walker L M, Phogat S K, Chan-Hui P Y, Wagner D, Phung P, Goss J L, Wrin T, Simek M D, Fling S, Mitcham J L, Lehrman J K, Priddy F H, Olsen O A, Frey S M, Hammond P W, Protocol GPI, Kaminsky S, Zamb T, Moyle M, Koff W C, Poignard P, Burton D R. 2009. Broad and potent neutralizing antibodies from an African donor reveal a new HIV-1 vaccine target. Science 326:285-289. [0393] 36. Walker L M, Huber M, Doores K J, Falkowska E, Pejchal R, Julien J P, Wang S K, Ramos A, Chan-Hui P Y, Moyle M, Mitcham J L, Hammond P W, Olsen O A, Phung P, Fling S, Wong C H, Phogat S, Wrin T, Simek M D, Protocol GPI, Koff W C, Wilson I A, Burton D R, Poignard P. 2011. Broad neutralization coverage of HIV by multiple highly potent antibodies. Nature 477:466-470. [0394] 37. Bonsignori M, Hwang K K, Chen X, Tsao C Y, Morris L, Gray E, Marshall D J, Crump J A, Kapiga S H, Sam N E, Sinangil F, Pancera M, Yongping Y, Zhang B, Zhu J, Kwong P D, O'Dell S, Mascola J R, Wu L, Nabel G J, Phogat S, Seaman M S, Whitesides J F, Moody M A, Kelsoe G, Yang X, Sodroski J, Shaw G M, Montefiori D C, Kepler T B, Tomaras GD, Alam S M, Liao H X, Haynes B F. 2011. Analysis of a clonal lineage of HIV-1 envelope V2/V3 conformational epitope-specific broadly neutralizing antibodies and their inferred unmutated common ancestors. Journal of virology 85:9998-10009. [0395] 38. Bonsignori M, Montefiori D C, Wu X, Chen X, Hwang K K, Tsao C Y, Kozink D M, Parks R J, Tomaras G D, Crump J A, Kapiga S H, Sam N E, Kwong P D, Kepler T B, Liao H X, Mascola J R, Haynes B F. 2012. Two distinct broadly neutralizing antibody specificities of different clonal lineages in a single HIV-1-infected donor: implications for vaccine design. Journal of virology 86:4688-4692. [0396] 39. Walker L M, Simek M D, Priddy F, Gach J S, Wagner D, Zwick M B, Phogat S K, Poignard P, Burton D R. 2010. A limited number of antibody specificities mediate broad and potent serum neutralization in selected HIV-1 infected individuals. PLoS pathogens 6:e1001028. [0397] 40. Gao F, Bonsignori M, Liao H X, Kumar A, Xia S M, Lu X, Cai F, Hwang K K, Song H, Zhou T, Lynch R M, Alam S M, Moody M A, Ferrari G, Berrong M, Kelsoe G, Shaw G M, Hahn B H, Montefiori D C, Kamanga G, Cohen M S, Hraber P, Kwong P D, Korber B T, Mascola J R, Kepler T B, Haynes B F. 2014. Cooperation of B cell lineages in induction of HIV-1-broadly neutralizing antibodies. Cell 158:481-491. [0398] 41. Amanna I J, Carlson N E, Slifka M K. 2007. Duration of humoral immunity to common viral and vaccine antigens. The New England journal of medicine 357:1903-1915. [0399] 42. Bonsignori M, Moody M A, Parks R J, Holl T M, Kelsoe G, Hicks C B, Vandergrift N, Tomaras G D, Haynes B F. 2009. HIV-1 envelope induces memory B cell responses that correlate with plasma antibody levels after envelope gp120 protein vaccination or HIV-1 infection. Journal of immunology 183:2708-2717. [0400] 43. Chuang G Y, Acharya P, Schmidt S D, Yang Y, Louder M K, Zhou T, Kwon Y D, Pancera M, Bailer R T, Doria-Rose N A, Nussenzweig M C, Mascola J R, Kwong P D, Georgiev I S. 2013. Residue-level prediction of HIV-1 antibody epitopes based on neutralization of diverse viral strains. Journal of virology 87:10047-10058. [0401] 44. Gray E S, Taylor N, Wycuff D, Moore P L, Tomaras G D, Wibmer C K, Puren A, DeCamp A, Gilbert P B, Wood B, Montefiori D C, Binley J M, Shaw G M, Haynes B F, Mascola J R, Morris L. 2009. Antibody specificities associated with neutralization breadth in plasma from human immunodeficiency virus type 1 subtype C-infected blood donors. Journal of virology 83:8925-8937. [0402] 45. Tiller T, Meffre E, Yurasov S, Tsuiji M, Nussenzweig M C, Wardemann H. 2008. Efficient generation of monoclonal antibodies from single human B cells by single cell RT-PCR and expression vector cloning. Journal of immunological methods 329:112-124. [0403] 46. Liao H X, Levesque M C, Nagel A, Dixon A, Zhang R, Walter E, Parks R, Whitesides J, Marshall D J, Hwang K K, Yang Y, Chen X, Gao F, Munshaw S, Kepler T B, Denny T, Moody M A, Haynes B F. 2009. High-throughput isolation of immunoglobulin genes from single human B cells and expression as monoclonal antibodies. Journal of virological methods 158:171-179. [0404] 47. Kepler T B. 2013. Reconstructing a B-cell clonal lineage. I. Statistical inference of unobserved ancestors. F1000Research 2:103. [0405] 48. Kepler T B, Munshaw S, Wiehe K, Zhang R, Yu J S, Woods C W, Denny T N, Tomaras G D, Alam S M, Moody M A, Kelsoe G, Liao H X, Haynes B F. 2014. Reconstructing a B-Cell Clonal Lineage. II. Mutation, Selection, and Affinity Maturation. Frontiers in immunology 5:170. [0406] 49. Felstein J. 2009. PHYLIP (Phylogeny Inference Package) version 3.69. Distributed by the author. Depai intent of Genome Sciences, University of Washington, Seattle. [0407] 50. Montefiori D C. 2005. Evaluating neutralizing antibodies against HIV, SIV, and SHIV in luciferase reporter gene assays. Current protocols in immunology/edited by John E. Coligan . . . [et al.] Chapter 12: Unit 12 11. [0408] 51. Seaman M S, Janes H, Hawkins N, Grandpre L E, Devoy C, Giri A, Coffey R T, Harris L, Wood B, Daniels M G, Bhattacharya T, Lapedes A, Polonis V R, McCutchan F E, Gilbert P B, Self S G, Korber B T, Montefiori D C, Mascola J R. 2010. Tiered categorization of a diverse panel of HIV-1 Env pseudoviruses for assessment of neutralizing antibodies. Journal of virology 84:1439-1452. [0409] 52. Haynes B F, Fleming J, St Clair E W, Katinger H, Stiegler G, Kunert R, Robinson J, Scearce R M, Plonk K, Staats H F, Ortel T L, Liao H X, Alam S M. 2005. Cardiolipin polyspecific autoreactivity in two broadly neutralizing HIV-1 antibodies. Science 308:1906-1908. [0410] 53. Sun Z Y, Oh K J, Kim M, Yu J, Brusic V, Song L, Qiao Z, Wang J H, Wagner G, Reinherz E L. 2008. HIV-1 broadly neutralizing antibody extracts its epitope from a kinked gp41 ectodomain region on the viral membrane. Immunity 28:52-63. [0411] 54. Bolotin D A, Poslaysky S, Mitrophanov I, Shugay M, Mamedov I Z, Putintseva E V, Chudakov D M. 2015. MiXCR: software for comprehensive adaptive immunity profiling. Nature methods 12:380-381. [0412] 55. Magoc T, Salzberg S L. 2011. FLASH: fast length adjustment of short reads to improve genome assemblies. Bioinformatics 27:2957-2963. [0413] 56. Alamyar E, Duroux P, Lefranc M P, Giudicelli V. 2012. IMGT® tools for the nucleotide analysis of immunoglobulin (IG) and T cell receptor (TR) V-(D)-J repertoires, polymorphisms, and IG mutations: IMGT/V-QUEST and IMGT/HighV-QUEST for NGS. Methods in molecular biology 882:569-604. [0414] 57. Otwinowski Z, Minor W. 1997. Processing of X-ray diffraction data collected in oscillation mode. Methods Enzymol. 276:307-326. [0415] 58. Adams P D, Afonine P V, Bunkoczi G, Chen V B, Davis I W, Echols N, Headd J J, Hung L W, Kapral G J, Grosse-Kunstleve R W, McCoy A J, Moriarty N W, Oeffner R, Read R J, Richardson D C, Richardson J S, Terwilliger T C, Zwart P H. 2010. PHENIX: a comprehensive Python-based system for macromolecular structure solution. Acta crystallographica. Section D, Biological crystallography 66:213-221. [0416] 59. Adams P D, Grosse-Kunstleve R W, Hung L W, loerger TR, McCoy A J, Moriarty N W, Read R J, Sacchettini J C, Sauter N K, Terwilliger T C. 2002. PHENIX: building new software for automated crystallographic structure determination. Acta Crystallogr. Sect. D-Biol. Crystallogr. 58:1948-1954. [0417] 60. Emsley P, Cowtan K. 2004. Coot: model-building tools for molecular graphics. Acta Crystallogr. Sect. D-Biol. Crystallogr. 60:2126-2132. [0418] 61. Krissinel E, Henrick K. 2007. Inference of macromolecular assemblies from crystalline state. Journal of molecular biology 372:774-797. [0419] 62. Winn M D, Ballard C C, Cowtan K D, Dodson E J, Emsley P, Evans P R, Keegan R M, Krissinel E B, Leslie A G, McCoy A, McNicholas S J, Murshudov G N, Pannu N S, Potterton E A, Powell H R, Read R J, Vagin A, Wilson K S. 2011. Overview of the CCP4 suite and current developments. Acta crystallographica. Section D, Biological crystallography 67:235-242.