Modified hexa-acylated neisserial LPS
11292808 · 2022-04-05
Assignee
Inventors
- Afshin Zariri (Uithoorn, NL)
- Elder Pupo Escalona (Amersfoort, NL)
- Peter André van der Ley (Utrecht, NL)
Cpc classification
C07H15/06
CHEMISTRY; METALLURGY
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
International classification
C07H15/06
CHEMISTRY; METALLURGY
Abstract
The present invention relates to neisserial LPS having a hexa-acylated lipid A moiety, wherein the hexa-acylated lipid A moiety is modified as compared to the lipid A moiety of a wild-type neisserial LPS in that it comprises a palmitoleoyl instead of a lauroyl secondary acyl chain on the glucosamine at the non-reducing end of the lipid A moiety. The invention further relates to mixtures of the hexa-acylated LPS with the corresponding penta-acylated LPS, lacking a secondary acyl chain on the glucosamine at the non-reducing end of the lipid A moiety. The invention also relates to neisserial bacteria that have been genetically modified to reduce expression of the endogenous lpxL1 gene and to introduce expression of a heterologous thermosensitive lpxP gene for producing the hexa- and penta-acylated LPS. By selecting the time and/or temperature at which the bacterium is grown, it is feasible to increase or decrease the amount of hexa-acylated lipid A structure relative to the corresponding penta-acylated structure and thereby modulate the TLR4 agonist activity of the neisserial LPS of the invention, to the exact level of activity required for a particular immunotherapeutic approach.
Claims
1. A composition comprising a mixture of i) a neisserial LPS having a hexa-acylated lipid A moiety, wherein the hexa-acylated lipid A moiety is modified as compared to the lipid A moiety of a wild-type neisserial LPS in that it has a palmitoleoyl (instead of a lauroyl) as secondary acyl chain bound to the primary acyl chain on the glucosamine at the non-reducing end of the lipid A moiety; and ii) a neisserial LPS with a penta-acylated lipid A moiety wherein the penta-acylated lipid A moiety is modified as compared to the lipid A moiety of a wild-type neisserial LPS in that it lacks the secondary acyl chain bound to the primary acyl chain on the glucosamine at the non-reducing end of the lipid A moiety.
2. The composition of claim 1, wherein the hexa-acylated neisserial LPS, except for the hexa-acylated lipid A moiety, has the structure of an LPS of Neisseria meningitidis, Neisseria gonorrhoeae or Neisseria lactamica.
3. The composition of claim 1, wherein the hexa-acylated neisserial LPS, except for the hexa-acylated lipid A moiety, hard the structure of an LPS of a genetically modified Neisseria meningitidis, Neisseria gonorrhoeae or Neisseria lactamica that is at least one of lgtB.sup.−and galE.sup.−.
4. The composition of claim 1, wherein the hexa-acylated lipid A moiety has the structure of formula (I): ##STR00003## wherein R.sub.1 and R.sub.2, independently, are either —P(O)(OH).sub.2, —[P(O)(OH)—O].sub.2—H, —[P(O)(OH)—O].sub.2—CH.sub.2CH.sub.2NH.sub.2, —[P(O)(OH)—O].sub.3—CH.sub.2CH.sub.2NH.sub.2, —[P(O)(OH)—O].sub.3—H or —P(O)(OH)—O—CH.sub.2CH.sub.2NH.sub.2.
5. The composition of claim 1, wherein the penta-acylated neisserial LPS, except for the penta-acylated lipid A moiety, has the structure of an LPS of Neisseria meningitidis, Neisseria gonorrhoeae or Neisseria lactamica.
6. The composition of claim 1, wherein the penta-acylated neisserial LPS, except for the penta-acylated lipid A moiety, has the structure of an LPS of a genetically modified Neisseria meningitidis, Neisseria gonorrhoeae or Neisseria lactamica that is at least one of lgtB.sup.− and galE.sup.−.
7. The composition of claim 1, wherein the penta-acylated lipid A moiety has the structure of formula (II): ##STR00004## wherein R.sub.1 and R.sub.2, independently, are either —P(O)(OH).sub.2, —[P(O)(OH)—O].sub.2—H, —[P(O)(OH)—O].sub.2—CH.sub.2CH.sub.2NH.sub.2, —[P(O)(OH)—O].sub.3—CH.sub.2CH.sub.2NH.sub.2, —[P(O)(OH)—O].sub.3—H or —P(O)(OH)—O—CH.sub.2CH.sub.2NH.sub.2.
8. The composition of claim 1, wherein the composition comprises the hexa-acylated neisserial LPS and the penta-acylated neisserial LPS in a molar ratio in the range of 1:400 to 1:1.25.
9. The composition of claim 1, wherein the composition is an acellular vaccine, and wherein the composition optionally further comprises at least one non-neisserial antigen.
10. The composition of claim 1, wherein the composition comprises an outer membrane vesicle (OMV) comprising the mixture of the hexa-acylated neisserial LPS and the penta-acylated neisserial LPS.
11. The composition of claim 10, wherein the composition is an acellular vaccine and wherein the composition optionally further comprises at least one non-neisserial antigen.
12. The composition of claim 1, wherein the composition comprises a genetically modified bacterium comprising the mixture of the hexa-acylated neisserial LPS and the penta-acylated neisserial LPS, wherein the genetically modified bacterium is a bacterium of the genus Neisseria, and wherein the bacterium comprises: a) a genetic modification that eliminates the activity of a lipid A biosynthesis lauroyl acyltransferase encoded by an endogenous lpxL1 gene; and, b) a genetic modification that confers to the bacterium lipid A biosynthesis palmitoleoyltransferase activity, wherein the genetic modification introduces the expression of an LpxP lipid A palmitoleyltransferase that has at least 95% amino acid sequence identity with SEQ ID NO: 4.
13. The composition of claim 12, wherein the composition is a whole cell vaccine and wherein the composition optionally further comprises at least one non-neisserial antigen.
14. A process for producing the composition of claim 1, wherein the process comprises the steps of: a) cultivating a genetically modified bacterium of the genus Neisseria at a temperature in the range of 20-42° C., wherein the bacterium comprises: i) a genetic modification that eliminates the activity of a lipid A biosynthesis lauroyl acyltransferase encoded by an endogenous lpxL1 gene; and, ii) a genetic modification that confers to the bacterium lipid A biosynthesis palmitoleoyltransferase activity, wherein the genetic modification introduces the expression of an LpxP lipid A palmitoleoytransferase that has at least 95% amino acid sequence identity with SEQ ID No: 4; and, b) optionally, at least one of extraction and purification of the mixture of LPSs.
15. The process of claim 14, wherein the bacterium is a genetically modified Neisseria meningitidis, Neisseria gonorrhoeae or Neisseria lactamica.
16. The process of claim 14, wherein: the endogenous lxL1 gene is a gene encoding an LpxL1 protein having an amino acid sequence with at least 90% sequence identity with at least one of SEQ ID NO's: 1-3.
17. A process for producing the composition of claim 10, wherein the process comprises the steps of: a) cultivating a genetically modified bacterium of the genus Neisseria at a temperature in the range of 20-42° C., wherein the bacterium comprises: i) a genetic modification that eliminates the activity of a lipid A biosynthesis lauroyl acyltransferase encoded by an endogenous lpxL1 gene; and, ii) a genetic modification that confers to the bacterium lipid A biosynthesis palmitoleoyltransferase activity, wherein the genetic modification introduces the expression of an LpxP lipid A palmitoleoyltransferase that has at least 95% amino acid sequence identity with SEQ ID NO: 4; and, b) optionally, extracting the OMV; and, c) recovering the OMV, wherein the recovery at least comprises removal of the bacteria from the OMV.
18. The process of claim 17, wherein the process is a detergent-free process.
19. The process of claim 14, wherein in step a) the bacterium is cultured at a temperature lower than 37° C.
20. The process of claim 17, wherein in step a) the bacterium is cultured at a temperature lower than 37° C.
Description
DESCRIPTION OF THE FIGURES
(1)
(2)
(3)
(4)
EXAMPLES
(5) 1. Methods and Materials
(6) 1.1 Bacterial Strains and Plasmids
(7) All mutants were created in a N. meningitidis H44/76 strain (HB-1) strain using plasmid pMF121, resulting in deletion of the capsular biosynthesis locus including the galE gene. N. meningitidis strains were grown on GC medium base (Difco) plates supplemented with IsoVitaleX, in a humid atmosphere containing 5% CO.sub.2 at 37° C. For liquid culture, strains were grown in 36 mg/mL tryptic soy broth medium (Difco) in a conical flask at 37° C., shaken at 140 RPM. Required antibiotics were added to plate and liquid cultures (kanamycine 100 μg/ml, chlooramphenicol 3 μg/ml). The lpxL1 and lpxL2 mutants were obtained by transformation with a linearized PCRII plasmid (Invitrogen) carrying the genes with a kanamycine resistance cassette described by van der Ley et al. (15) or a pGem T easy plasmid (Promega) with the lpxL1 gene that has a deleted section replaced with a chloramphenicol (CAM) cassette. For the lptA mutant the gene was amplified by PCR from the H44/76 strain, cloned into a pGem T easy plasmid (Promega) and a kanamycine cassette was placed in the gene at the Munl restriction site. The plasmid was linearized by digestion with a restriction enzyme cleaving outside the gene and transformed into the N. meningitidis H44/76 (HB-1) strain. N. meningitidis derivatives carrying the genes pagL, lpxP and lpxE were created using a pEN11 plasmid previously described for the expression of the Bordetella bronchiseptica pagL gene (13, 18). To obtain lpxP and lpxE derivatives the pagL gene in the pEN11 plasmid was replaced with the lpxP or lpxE gene amplified by PCR from E. coli and B. bronchiseptica, respectively. Expression of the genes on the pen 11 plasmid was induced by addition of 1 mM isopropyl-β-D-thioglactopyranoside (IPTG) and CAM (3 μg/ml) to the liquid culture medium. Primers are listed in Table 1.
(8) TABLE-US-00001 TABLE 1 PCR primers used in the construction of the mutant strains SEQ Primer Sequence (5′-3′) Source ID NO LptA Fw GCCTTCCTTTCCCTGTATTC N. meningitidis 11 LptA Re GGTGTTCGGACACATATGC N. meningitidis 12 LpxL1 Fw CTGATCGGGCAGATACAG N. meningitidis 13 LpxL1 Re GTGCGCTACCGCAATAAG N. meningitidis 14 LpxL2 Fw AAACAGATACTGCGTCGGAA N. meningitidis 15 LpxL2 Re CCCTTTGCGAACCGCCAT N. meningitidis 16 PagL Fw ATGCAATTTCTCAAG B. bronchiseptica 17 PagL Re TCAGAACTGGTACGT B. bronchiseptica 18 LpxP Fw CATATGGCCGCTTACGCAGACAATACAC E. coli 19 LpxP Re GACGTCACGCCTGAATGACTTCATTACACC E. coil 20 LpxE Fw CATATGATCCGGCCCTCATCCCATTCCC B. bronchiseptica 21 LpxE Re TCATGACCCGAAAGGCGCTTCCCTTCAG B. bronchiseptica 22
1.2 LPS Isolation
(9) LPS from bacterial mutants was extracted with hot phenol-water (19) and purified further by solid phase extraction (SPE) on reverse phase cartridges. In short, cells from 50 ml of bacterial culture with an OD.sub.600nm of 1.4 (or 100 ml of the ΔlpxL1-lpxP mutant grown at 30° C.) were collected by centrifugation at 2,739×g for 1 h at 20° C. Then, bacteria were suspended in 20 ml of water and centrifuged at 2,739×g for 25 min at 20° C. For hot phenol-water extraction, bacterial pellets were suspended with 4 ml of water, heated to 70° C., mixed with 3.2 ml of phenol at the same temperature and kept under agitation for 10 min at 70° C. The aqueous phase was separated from the phenolic phase by centrifugation at 2,739×g for 15 min at 20° C. After transferring the aqueous phase to a new vial, the phenolic phase was extracted again by adding 3 ml of water at 70° C. and repeating the extraction procedure. The aqueous phases from two consecutive extractions were pooled (−6.5 ml) and prepared for SPE by adding 5 ml of 0.356 M triethylammonium acetate (TEAA) pH 7 (solvent A) and 3.8 ml of 2-propanol:water:triethylamine:acetic acid (70:30:0.03:0.01, v/v) pH 8.7 (solvent B). In total, ten LPS extracts each from a different bacterial mutant could be purified simultaneously by SPE on reverse phase Sep-Pak C18 cartridges (1 ml syringe-barrel-type Vac cartridge, 50 mg of C18 resin, Waters) using a 20-position vacuum manifold (Waters). Cartridges were conditioned for SPE by applying consecutively 1 ml of 2-propanol:water:triethylamine:acetic acid (85:15:0.015:0.005, v/v) pH 8.7 (solvent C), 0.07 mM TEAA pH 7 (solvent D) and solvent A under vacuum. Then, samples were split into two aliquots of equal volume and each aliquot was applied into a different cartridge. Next, cartridges were washed once with 1 ml of solvent A and twice with 1 ml of 20% (v/v) solvent B in solvent D. LPS was eluted from the columns by applying 0.6 ml of solvent C. Eluates from the same sample were combined (1.2 ml per sample in total) and dried in a centrifugal vacuum concentrator (Concentrator plus, Eppendorf) at room temperature. LPS concentration in isolated samples was determined by the 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) assay (20). In addition, the purity and integrity of purified samples were judged by Tricine-SDS-PAGE using 1 mm-thick, 16% precast Novex® mini-gels (Thermo Fisher Scientific Inc.), LPS silver staining (21) and protein visualization with Imperial™ Protein Stain (Thermo Scientific).
(10) 1.3 Mass Spectrometry
(11) Electrospray ionization Fourier transform mass spectrometry (ESI-FT-MS) was performed on an LTQ Orbitrap XL instrument (Thermo Scientific) in negative ion mode. LPS samples were dissolved in a mixture of water, 2-propanol and triethylamine (50:50:0.001, by volume) pH 8.5 and infused into the mass spectrometer by static nano-ESI (22, 23). The MS instrument was calibrated with a Pierce Negative Ion Calibration Solution (Thermo Scientific) and internally with taurocholic acid following standard procedures provided by the manufacturer (Thermo Scientific). Fragmentation analysis of intact LPS was carried out by in-source collision-induced fragmentation (SID). Y- and B-type fragment ions, corresponding to the lipid A and oligosaccharide moieties of LPS, respectively, were generated by SID at a potential difference of 100 V. Fragment ions are annotated according to the nomenclature of Domon and Costello (24). Mass spectra were charge-deconvoluted using the Xtract tool of Thermo Xcalibur 3.0 software (Thermo Scientific). All mass values given refer to monoisotopic molecular masses. Proposed LPS compositions are based on the general chemical structure of the L3 immunotype LPS from N. meningitidis reported previously (25, 26).
(12) 1.4 Cell Stimulation
(13) Mono Mac 6 cells were seeded at 1×10.sup.5 cells per well in 96 well microtiter plates in 100 μl Iscove's modified Dulbecco's medium (IMDM) (Invitrogen) medium supplemented with 100 units/ml penicillin, 100 μg/ml streptomycin, 292 μg/ml 1-glutamine (Invitrogen), and 10% fetal calf serum (Invitrogen). Hek blue-hTLR4 cells (Invivogen), a HEK293 cell line stably expressing human TLR4, MD-2 and CD14, were seeded at 3.5×10.sup.4 cells per well in 96-well microtiter plates in 100 μl DMEM (Invitrogen) medium supplemented with 100 units/ml penicillin, 100 μg/ml streptomycin, 292 μg/ml 1-glutamine (Invitrogen), and 10% fetal calf serum (Invitrogen). Cells were stimulated with 10-fold serial dilutions of LPS in IMDM (MM6 cells) or DMEM (HEK blue-hTLR4 cells) for 18-20 h at 37° C. in a humid atmosphere containing 5% CO.sub.2. HEK-blue-hTLR4 cells were also stimulated with serial dilution of whole bacterial cells. Cytokine concentration in the supernatants of MM6 cells was determined by enzyme-linked immunosorbent assay (ELISA). All cytokine (IL-6, IL-1β, IP-10, MCP-1) concentrations were determined using a DUOset ELISA development kit (R&D systems) following the manufacturer's instructions. To quantify alkaline phosphatase secreted by HEK-blue-hTLR4 cells, 20 μl of the supernatant from each well was added to 200 μl Quanti-blue (Invivogen) and incubated at 37° C. for 2-3 hours. Read out was done on a spectrophotometer at 649 nm. Statistically significant differences were determined by the one-way (alkaline phosphatase secretion) or two-way (Cyokine release) ANOVA test by using GraphPad Prism 6.04 statistical software (GraphPad Software, Inc.).
(14) 2. Results
(15) 2.1 Bioengineering of Modified LPS Structures
(16) LPS mutants in N. meningitidis were constructed in the HB-1 derivative of strain H44/76.The HB-1 strain is capsule deficient and has a galE deletion that results in truncation of the LPS oligosaccharide. Mass spectrometric analysis demonstrated that the HB-1 strain expresses a hexa-acylated, tri-phosphate, bis-phosphoethanolamine lipid A structure (see below). To construct a diverse set of LPS mutants in strain HB-1, we inactivated the autologous genes encoding for the LPS enzymes LptA, LpxL1 and LpxL2 and heterologously expressed the LpxE, LpxP and PagL LPS enzymes (see Table 2) by cloning the genes on the pen 11 plasmid behind a lac promotor.
(17) TABLE-US-00002 TABLE 2 Overview of the inactivated the autologous genes encoding for the LPS enzymes LptA, LpxL1 and LpxL2 and heterologously expressed the LpxE, LpxP and PagL LPS enzymes. Source Enzyme Abbr. Activity organism LpxL1 L1 Adds C.sub.12 to the primary Neisseria linked acyl meningitidis chain at 2′-position LpxL2 L2 Adds C.sub.12 to the primary Neisseria linked acyl meningitidis chain at 2-position LpxE E Removes 1 phosphate Bordetella group bronchiseptica LpxP Lp Adds palmitoleate to the Escherichia coli primary linked acyl-chain at 2′-position. PagL P Removes acyl-chain from Bordetella 3-position bronchiseptica LptA La Adds phosphoethonalamine Neisseria groups at meningitidis 1 or/and 4′-position
(18) In addition, combinations of deletion of autologous genes and expression of heterologous enzymes were constructed. This approach resulted in 11 LPS mutant strains as listed in Table 3.
(19) For the expression of LpxE (Protein ID: CAE41138.1) we initially cloned an lpxE homologue from Bordetella pertussis. However, expression of the gene in HB-1 or its lptA mutant derivative did not result in any LPS structural changes as determined by mass spectrometry. As an alternative the lpxE (Genbank accession number: WP_003809405.1) homologue from Bordetella bronchiseptica, which exists as a pseudogene in B. pertussis, was cloned and expressed in a ΔlptA mutant strain. This resulted in the loss of a phosphate group in the lipid A and was included in our panel of LPS mutant strains (
(20) LpxP (Genbank accession number: U49787.1), an enzyme known to add a secondary 9-hexadecenoic acid (C16:1) to the 2′ acyl chain in E.coli (27), was expressed in the N. meningitidis ΔlpxL1 mutant strain, because the LpxL1 enzyme also adds a secondary acyl chain on the same position. This modification was done to create a hexa-acylated lipid A structure different from the original by carrying a longer C16 secondary acyl chain in the 2′ position instead of C12. When LpxP was expressed in the ΔlpxL1 mutant strain at 37° C. this resulted in a very faint addition of C16:1. However, the C16:1 is added onto E.coli LPS only at 12° C., so for this reason we grew the bacteria at lower temperatures. Cultivation of meningococci below 25° C. is, unlike in E. coli, not possible, but at 25° C. and 30° C. we already found a much higher relative abundance of the LpxP hexa-acylated lipid A structure carrying the additional C16:1, with 25° C. resulting in the highest efficiency (at least 50% relative abundance) (
(21) TABLE-US-00003 TABLE 3 Overview of the constructed LPS mutants in the N. meningitidis HB-1 strain Phospho- Phospho- Strain Abbr. Acylation rylation ethanolamine HB-1 parent strain Hexa Tris Bis ΔlpxL1 ΔL1 Penta Tris Bis ΔlpxL2 ΔL2 Penta Bis Mono pagL P Penta Tris Bis ΔlpxL1-pagL ΔL1-P Tetra Tris Bis ΔlpxL2-pagL ΔL2-P Tetra Bis Mono ΔlpxL1-lpxP 37° C. ΔL1-Lp37 Hexa Tris Bis ΔlpxL1-lpxP 30° C. ΔL1-Lp30 Hexa Tris Bis ΔlpxL1-lpxP 25° C. ΔL1-Lp25 Hexa Tris Bis ΔlptA ΔLa Hexa Tris None ΔlptA-ΔlpxL1 ΔLa-ΔL1 Penta Tris None ΔlptA-pagL ΔLa-P Penta Tris None ΔlptA-lpxE ΔLa-E Hexa Tris None
2.2 Mass Spectrometric Characterization of Modified LPS
(22) The charge-deconvoluted ESI-FT mass spectra of intact LPS isolated from the constructed N. meningitidis mutants are shown in
(23) Analysis of the intact LPS from the ΔlpxL1 mutant revealed that he main ion peaks of the mass spectrum (3046.315, 3103.336, 3169.324 and 3226.342 u,
(24) Comparative analysis of the mass spectrum of the LPS from the ΔlpxL2 mutant displayed ion peaks of 3023.367, 2966.348, 3185.419 and 3128.398 u (
(25) The ion peaks in the mass spectrum of the LPS from the pagL mutant (3210.345, 3153.325, 3087.338 and 3030.318 u,
(26) The 4 main ion signals in the mass spectrum of the LPS from the ΔlpxL1-pagL mutant (3028.180, 2971.160, 2905.173 and 2848.152 u,
(27) The mass spectrum of the LPS from the ΔlpxL2-pagL mutant showed an ion peak of 2825.206 u (
(28) Comparison of the mass spectrum of the LPS from the ΔlpxL1-lpxP mutant grown at 30° C. (
(29) The mass spectrum of the LPS from the ΔlpxL1-lpxP mutant cultured at 25° C. (
(30) The ion peak of 3162.489 u in the mass spectrum of the LPS from the ΔlptA mutant (
(31) The mass spectrum of the LPS from the ΔlptA-ΔlpxL1 mutant displayed ion peaks of 2980.324, 2923.307, 3142.375 and 3085.354 u indicating the loss of 2PEA and a C12 from the lipid A (Δcalc.=-428.184 u) combined with non-stoichiometric substitution of the oligosaccharide with Gly or a second Hex (
(32) The main ion signals of the mass spectrum of the LPS from the ΔlptA-pagL mutant (2964.328 and 2907.311 u,
(33) Finally, the mass spectrum of the LPS from the ΔlptA-lpxE mutant showed 2 main ion peaks of 3082.525 and 3025.508 u consistent with loss of 2PEA and P from the lipid A (Δcalc.=−325.983 u) in combination with non-stoichiometric substitution of the oligosaccharide with Gly (
(34) 2.3 TLR4 Stimulation by the LPS Mutant Strains
(35) To determine the scope of TLR4 activation by the entire set of lipid A mutant structures, an initial screening was done using HEK-Blue humanTLR4 cells. These cells express human TLR4, MD-2, and CD14 and contain a nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) and activator protein 1 (AP-1) dependent secreted embryonic alkaline phosphatase (SEAP) reporter gene. Stimulation of cells with serial dilutions of the different LPS mutants yielded a wide range of TLR4 activities (
(36) Expression of LpxP at 25° C. in combination with deletion of LpxL1 resulted in a heterogeneous hexa- and penta-acylated structure-LPS expressing strain with a slightly reduced TLR4 activating potential compared to the wild type bacteria. Cultivation of this strain at 30° C. resulted in less hexa-acylated lipid A and even slightly less TLR4 activity.
(37) Surprisingly, when the ΔlpxL1 strain was combined with expression of PagL, reducing the penta-acylated lipid A structure to a tetra-acylated lipid A structure, an increase of TLR4 activity was obtained. This was unexpected as tetra-acylated lipid A structures typically acts as a TLR4 antagonists as reported for E. coli lipid Iva (7, 9, 28).
(38) 2.4 Human TLR4 Stimulation using Purified Mutant LPS
(39) We also purified LPS from all strains and used them to stimulate HEK-Blue TLR4 cells to confirm our initial findings with whole bacteria. Purified LPS generally yielded similar results as those obtained with intact bacteria although purified LPS, ΔlpxL1, ΔlptA-ΔlpxL1, ΔlpxL2 and ΔlpxL2-pagL showed almost no induction of TLR4 activity and were barely distinguishable from each other (
(40) 2.5 Cytokine Induction by the Purified Mutant LPS
(41) The cytokine induction profile of the modified LPS structures was investigated in the human monocytic cell line Mono Mac 6 (MM6). The concentration of secreted MyD88 dependent cytokines IL-6 (
(42) A wide variety of cytokine levels was determined from the different LPS structures, with the highest levels being produced by the HB-1 wild type hexa-acylated LPS and all other LPS ranging from close to wild type until virtually zero cytokine induction as seen for ΔlpxL2 LPS. Besides quantitative differences in cytokine induction, we also observed qualitative differences with LPS structures causing reduced levels of certain cytokines, but still capable of producing others. Some examples are pagL and ΔlptA-pagL LPS, which displayed a reduced capacity to induce the production of MyD88 dependent pro-inflammatory cytokines IL-6 and IL-1β only inducing 10% and 25% of the levels induced by wild-type LPS, respectively, but retained most of the ability to induce the secretion of TRIF dependent IP-10 (50%) and MCP-1 (90%). Interestingly, differences were observed between ΔlpxL1-lpxP grown at 30° C. and 25° C., with ΔlpxL1-lpxP grown at 30° C. producing 30-40% IL-6 and IL-1β and 60-85% of those cytokines at 25° C., whereas IP-10 and MCP-1 induction were similar. These results emphasize how LPS bioengineering can provide a wide range of agonists to fine-tune cytokine release.
(43) 3. Discussion
(44) Although LPS has great potential as an adjuvant, adverse effects keep being a concern. Finding the optimal balance between adjuvant activity and minimal toxic effects requires the development of new LPS derivatives. Here we report a collection of novel meningococcal LPS structures inducing a broad range of TLR4 responses and differential cytokine patterns. These combinatorial bioengineered LPS mutants can be used as part of a whole cell vaccine, OMV vaccine or as purified LPS or lipid A molecule. OMVs of N. meningitidis are being actively investigated as potential vaccines and have been already approved for use in humans as a component of the Bexsero vaccine against serogroup B meningococcal disease (29,30). Attenuated ΔlpxL1 LPS is under investigation as constituent of meningococcal OMV vaccines and is a safe method to detoxify OMVs (16,31). In addition, in an immunization study purified ΔlpxL1 LPS retained similar adjuvant activity compared to wild type meningococcal LPS, but with reduced toxicity (15).
(45) The modified LPS molecules LpxL1, LpxL2 and PagL all result in a reduced TLR4 activity compared to the parent strain (13,15). This was expected because they reduce the number of acyl chains in LPS from hexa to penta. Surprisingly, the expectation that tetra-acylated LPS is always less active than penta-acylated LPS is challenged by our results. Tetra-acylated lipid IVa of E. coli is a known antagonist of the human TLR4/MD-2 complex (7, 9, 28). Yet, we show that meningococcal tetra-acylated ΔlpxL1-pagL LPS is more active than the penta-acylated ΔlpxL1 LPS, whereas tetra-acylated ΔlpxL1-ΔlpxL2 LPS did not yield detectable activity (data not shown). Stimulation with ΔlpxL2-pagL whole bacteria that also carry a tetra-acylated LPS again increased TLR4/MD-2 activity compared to its penta-acylated ΔlpxL2 parent strain, although purified LPS from both the ΔlpxL2-pagL and ΔlpxL2 were inactive. Together these findings indicate that removal of C12OH from the 3′position by PagL in combination with deletion of a secondary acyl chain resulting in tetra-acylated lipid A yields a higher TLR4 activity compared to sole removal of the secondary acyl chain or both secondary acyl chains.
(46) Interestingly, introduction of LpxP from E. coli into N. meningitidis conferred temperature-sensitive lipid A modification to N. meningitidis. Since conservation of temperature-sensitive gene expression signals is unlikely, this means that the enzyme itself is most active at lower temperatures. Selection of a temperature of 25 or 30° C. for culture of the ΔlpxL1-lpxP strain influenced the amount of hexa-acylated LPS species present in the mixture of penta- and hexa-acylated LPS produced by this mutant, with the lower temperature leading to the highest degree of substitution. The temperature sensitivity of the LpxP enzyme thus enables to prepare penta- and hexa-acylated LPS mixtures in a controlled manner. By selecting the time and/or temperature that the mutant strain is grown, it is feasible to increase or decrease the amount of hexa-acylated lipid A structure and thereby the TLR4 activity and cytokine profile. This provides a new approach of fine-tuning the immunological properties of meningococcal OMV vaccines.
(47) In addition, we have obtained new insight in the specificity of the LpxE enzyme. Previously, the lpxE gene from Francisella tularensis or Francisella novicida expressed in E. coli was shown to be specific for the removal of the P group in the 1′position (32, 33). We have found that the lpxE homologue from B. bronchiseptica removed only one P group from the total of three present in the lipid A of N. meningitidis. MS/MS spectra of the lipid A from ΔlptA-lpxE mutants were consistent with the presence of a P group at both the 1 and 4′positions of the lipid A. In addition, removal of the P group was only seen in double ΔlptA-lpxE mutants, therefore only in the absence of PEA substitution of the lipid A. Thus, it is likely that the presence of PEA prevents lpxE from removing the P group. Most likely, the newly described LpxE enzyme is a pyrophosphatase, only catalysing hydrolysis between two phosphate groups. The absence of PEA in the lipid A through deletion of the lptA gene resulted in a reduced TLR4/MD-2 activity. This concurs with earlier observations by John et al. (34) that show a significant reduction of TNFα release by THP-1 cells upon stimulation with LptA lacking strains. Here we showed that reduction of the activity is even more apparent when stimulated with penta-acylated ΔlptA-pagL LPS or whole bacteria.
(48) Interestingly, our results indicate that the absence of 2′ C12 fatty acyl chain by deletion of LpxL2 is accompanied by removal of a single P group and PEA group. This was previously not observed due to isolation of lipid A by an acid hydrolysis method before mass spectrometric analysis, which can result in the loss of P groups from the lipid A (15). In the present study, we used complete LPS molecules without introducing any deleterious chemical modifications for mass spectrometric analysis, giving us the possibility to observe new phosphorylation changes of the lipid A.
(49) Several of the constructed attenuated LPS structures did not only need a higher concentration to induce TLR4 stimulation, but also did not yield the level of activation observed for the parent strain. This was most apparent for pagL LPS. The reason for this phenomenon is unclear, but could be due to instable dimerization of the LPS-TLR4-MD2 receptor complex at the cell surface but stable dimerization inside the cell, and/or to a less stable dimerization with high concentrations of the particular LPS. In addition, certain LPS species showed no activation at all and could potentially have antagonistic features, and might therefore serve as a TLR4 blocking drug. Indeed, meningococcal ΔlpxL1 and pagL penta-acylated LPS can block the TLR4 response when administered together with hexa-acylated wild type meningococcal LPS (13).
(50) In the present study, we have used combinatorial bioengineering in meningococci to produce a range of LPS species with a broad array of TLR4 activity and cytokine profile. The application of these structures can be very broad, from inclusion into vaccines as adjuvants to their use in various forms of immunotherapy which have been described or suggested for LPS, such as cancer therapy, Alzheimer's disease or generalized immune stimulation to prevent diverse infections (3, 35-37).
(51) TABLE-US-00004 TABLE 4 Multiple sequence alignment of the LpxP proteins. Sequences were aligned using ClustalW (2.1) (clustalw.ddbj.nig.ac.jp/) using default settings and the Gonnet protein weight matrix. Hyphens indicate gaps introduced for optimal alignment. Absolutely conserved residues are marked with asterisks. Colons and dots indicate strongly and weakly conserved residues, respectively. Sequences are from Escherichia coli (Genbank AAB66658), Citrobacter youngae (Genbank EFE09970), Haemophilus aegyptius (Genbank EGF15820), Klebsiella sp. (Genbank EFD82732), Salmonella enterica subsp. enterica serovar Typhimurium (Genbank CBW18471), Serratia plymuthica (Genbank EKF62147) and Shigella flexneri (Genbank ADA74790). AAB66658 MFPQ--CKFSREFLHPRYWLTWFGLGVLWLWVQLPYPVLCFLGTRIGAMARPFLK--RRE 56 ADA74790 MFPQ--CKFSREFLHPRYWLTWFGLGVLWLWVQLPYPVLCFLGTRIGAMARPFLK--RRE 56 CBW18471 MFPQ--SKFSRAFLHPRYWLTWFGVGILWLLVQLPYPVLRFLGTRTGKLARPFLK--RRE 56 EFE09970 MFPQ--CKFSRAFLHPRYWLTWFGVGVLWLLVQLPYPLLCFLGTRTGTLARPFLK--RRE 56 EFD82732 --MA--CVFNKQLLHPRNWLTWFGLGILWLIVQLPYPLLHFIGTSAGRLSRRFLK--RRE 54 EKF62147 MKRP--QEFRSALLHPRYWFTWFGLAILFLLVQLPYPLLHKLGVWMGRTSMRFLK--RRV 56 EGF15820 MKNEKLPQFQPHFLVPKYWLFWLGVAIWRSILCLPYPILRHIGHGLGWLFSHLNEGKRRA 60 * :* *: *: *:*:.: : ****:* :* * : : ** AAB66658 SIARKNLELCFPQHSAEEREKMIAENFRSLGMALVETGMAWFWPDSRVRKWFDVEGLDNL 116 ADA74790 SIARKNLELCFPQHSAEEREKMIAENFRSLGMALVETGMAWFWPDSRVRKWFDVEGLDNL 116 CBW18471 SIAQKNIELCFPTLSREEREKLIAENFHSLGMALLETGMAWFWPDSRVRKWFDVDGLDNL 116 EFE09970 SIARKNLELCFPNLSQEERDKLVDENFRSLGMGLLETGMAWFWPDRRVRKWFDVEGLDNL 116 EFD82732 HIARRNIELCFPDMSPAARETLIDQNFMSLGMGLIETGMAWFWSDERVKKWFDVEGFANL 114 EKF62147 AITRRNLELCFPDMDEAQRERKVIGNFESLGMGLLETGMAWFWSDKRVKRWFNVSGINHL 116 EGF15820 AIARRNLELCFPYMPENERETILQENLRSVGMAIIETGMAWFWSDSRIKKWSKVEGLHYL 120 *:::*:***** *: : *: *:**.::********.* *:::* .*.*: * AAB66658 KRAQMQNRGVMVVGVHFMSLELGGRVMGLCQPMMATYRPHNNQLMEWVQTRGRMRSNKAM 176 ADA74790 KRAQMQNRGVMVVGVHFMSLELGGRVMGLCQPMMATYRPHNNQLMEWVQTRGRMRSNKAM 176 CBW18471 TRAQAQNRGVMVVGVHFMSLELGGRVMGLCQPMMATYRPHNNPLMEWVQTRGRMRSNKAM 176 EFE09970 QRAQIEGRGVMVVGVHFMSLELGGRVMGLCQPTMATYRPHNNKLMEWIQTRGRMRSNKAM 176 EFD82732 NHALSGGKGVMVVGVHFMSLELGGRAMGLCRPMMATYRPHNSPLMEWVQTRGRLRSNKAM 174 EKF62147 KMAQQNERGVLVIGVHFMSLELGGRAMGLCQPMMAMYRPHNNKAMEWAQTKGRMRSNKAM 176 EGF15820 KENQKD--GIVLVGVHFLTLELGARIIGLHHPGIGVYRPNDNPLLDWLQTQGRLRSNKDM 178 *::::****::****.* :** :* :. ***::. ::* **:**:**** * AAB66658 IGRNNLRGIVGALKKGEAVWFAPDQDYGRKGSSFAPFFAVENVATTNGTYVLSRLSG-AA 235 ADA74790 IGRNNLRGIVGALKKGEAVWFAPDQDYGRKGSSFAPFFAVENVATTNGTYVLSRLSG-AA 235 CBW18471 IGRNNLRGIVGALKKGEAVWFAPDQDYGPKGSSFAPFFAVENVATTNGTYVLSRLSG-AA 235 EFE09970 IGRNNLRGIVGALKKGEAVWFAPDQDYGRKGSSFAPFFAVKDVATTNGTYVLSRLSG-AA 235 EFD82732 IDRNNLTGLVHALKSGEAVWFAPDQDYGPKGSVFAPFFSVPQAATTNGTYVLSRLSG-AK 233 EKF62147 LDRKDLRGMVHALKRGEAVWFAPDQDYGPRGSVFAPLFAVDQAATTSGTFMLARMAK-PA 235 EGF15820 FDRKDLRGMIKALRHEETIWYAPDHDYGRKNAVFAPFFAVPDACTTTGSYYLLKSSQNSK 238 :.*::* *:: **: *::*:***:*** :.: ***:*:* :..**.*:: * : : . AAB66658 MLTVTMVRKADYSGYRLFITPEMEGYPTDENQAAA-YMNKIIEKEIMRAPEQYLWIHRRF 294 ADA74790 MLTVTMVRKADYSGYRLFITPEMEGYPTDENQAAA-YMNKIIEKEIMRAPEQYLWIHRRF 294 CBW18471 MLTVTMVRKSDNSGYRLYITPEMEGYPADENQAAA-YMNKIIEKEIMRAPEQYLWIHRRF 294 EFE09970 MLTVTMVRKADNSGYRLFITPQMEGYPADESQAAA-YMNKIIEKEIMRAPEQYLWIHRRF 294 EFD82732 MLSISMVRKLDRQGYSLHISEVMNDYPGEDKQIAAGYINKVIEREILRAPEQYLWVHRRF 293 EKF62147 LVPVVLIRREKGRGYDLLIQPALEDYPIGDELAAAAYMNKVVEKEIMRAPEQYMWLHRRF 295 EGF15820 VIPFAPLRNKDGSGYTVSISAPVDFTDLQDETAIATRMNQIVEKEIMKGISQYMWLHRRF 298 ::.. :*. . ** : * :: :. * :*:::*:**::. .**:*:**** AAB66658 KTRP-VGESSLYI 306 (SEQ ID NO: 4) ADA74790 KTRP-VGESSLYI 306 (SEQ ID NO: 10) CBW18471 KTRP-LGEASLYI 306 (SEQ ID NO: 8) EFE09970 KTRP-MGEASLYI 306 (SEQ ID NO: 5) EFD82732 KTRP-LGEPSVY- 304 (SEQ ID NO: 7) EKF62147 KTRP-IGAPSLY- 306 (SEQ ID NO: 9) EGF15820 KTRPDEKTPSLYD 311 (SEQ ID NO: 6) **** .*:*
(52) TABLE-US-00005 TABLE 5 TLR4 activation by N. meningitidis strains (the same data are graphically presented in FIG. 2A). HEK-blue hTLR4 cells were stimulated with 5-fold serial dilutions at A600 nm (y-axis) of heat-inactivated N. meningitidis for 20 h. TLR4 activation was measured by detection of secreted alkaline phosphatase at A649 nm. Data are expressed as mean values of three independent experiments. A600 nm HB-1 ΔL1 ΔL2 P ΔL1-P ΔL2-P ΔL1-Lp37 ΔL1-Lp30 ΔL1-Lp25 ΔLa ΔLa-ΔL1 ΔLa-P ΔLa-E 0.01 1.102 0.318 0.124 0.715 0.596 0.277 0.534 1.070 1.011 0.874 0.157 0.501 0.911 0.002 1.083 0.247 0.092 0.692 0.569 0.199 0.450 0.967 0.964 0.855 0.098 0.469 0.872 0.0004 1.093 0.187 0.096 0.703 0.536 0.172 0.340 0.925 0.974 0.856 0.090 0.431 0.915 0.00008 1.031 0.124 0.100 0.723 0.387 0.115 0.217 0.607 0.687 0.836 0.087 0.354 0.840 1.6E−05 0.959 0.089 0.094 0.669 0.164 0.111 0.146 0.301 0.344 0.553 0.088 0.156 0.466 3.2E−06 0.551 0.101 0.092 0.377 0.100 0.094 0.137 0.189 0.162 0.219 0.083 0.107 0.174 6.4E−07 0.239 0.089 0.100 0.164 0.104 0.108 0.135 0.167 0.116 0.098 0.079 0.081 0.106 1.3E−07 0.141 0.095 0.116 0.125 0.101 0.110 0.138 0.169 0.102 0.087 0.094 0.089 0.090 2.6E−08 0.131 0.101 0.097 0.115 0.099 0.104 0.141 0.171 0.103 0.089 0.087 0.091 0.092 5.1E−09 0.134 0.095 0.108 0.108 0.098 0.114 0.158 0.188 0.101 0.088 0.085 0.095 0.094 1E−09 0.151 0.107 0.119 0.120 0.104 0.120 0.165 0.205 0.133 0.098 0.090 0.111 0.112
(53) TABLE-US-00006 TABLE 6 Cytokine release of MM6 cells stimulated with purified LPS (the same data are graphically presented in FIG. 4). MM6 cells were incubated with 10-fold serial dilution of different LPS mutants for 20 h. IL-6, IP-10, IL-1β, MCP-1production was measured by ELISA. Data shown are depicted as the mean values in pg/mL of two independent experiments. LPS (ng/mL) HB-1 ΔL1 ΔL2 P ΔL1-P ΔL2-P ΔL1-Lp30 ΔL1-Lp25 ΔLa ΔLa-ΔL1 ΔLa-P ΔLa-E A: IL-6 (pg/mL) 5 2418.74 8.19 7.85 298.35 16.78 3.40 519.86 1490.81 1471.22 7.96 64.14 1868.77 0.5 1563.59 1.01 3.02 185.57 8.53 1.13 320.98 877.57 819.39 3.90 50.82 1054.23 0.05 368.77 0.00 1.51 7.54 0.28 2.59 51.98 185.12 159.19 2.52 11.49 287.74 0.005 23.15 0.00 1.88 0.00 0.00 0.00 2.35 15.92 8.49 3.29 0.39 18.04 0.0005 0.00 0.00 0.73 1.45 0.00 0.28 0.01 1.49 1.71 4.15 0.08 1.35 B: IP-10 (pg/mL) 5 2285.04 82.21 62.66 1325.52 322.33 104.11 1615.79 1933.60 2146.18 153.76 1247.00 2286.09 0.5 2039.96 32.05 40.90 1100.20 260.54 35.18 1594.91 1696.40 1904.13 49.04 827.49 2196.92 0.05 1378.14 2.32 12.51 231.93 30.34 75.39 784.55 1162.30 1142.07 12.36 296.77 1688.99 0.005 449.26 0.00 0.00 4.43 17.83 0.00 104.71 373.72 239.53 19.44 24.38 511.23 0.0005 55.89 0.00 0.00 0.00 0.00 0.00 20.82 42.53 34.85 12.55 17.63 64.73 C: IL-1β (pg/mL) 5 883.53 26.80 26.06 109.46 31.74 21.90 207.76 666.32 516.85 28.80 46.79 880.08 0.5 430.02 19.36 26.28 58.08 23.39 21.29 111.23 312.46 213.05 27.70 40.54 394.26 0.05 90.35 17.73 18.01 18.87 13.16 14.47 34.21 73.87 63.95 23.69 22.59 100.26 0.005 15.50 10.94 10.45 14.46 9.82 14.37 26.28 28.38 31.30 27.03 22.73 30.80 0.0005 13.46 11.31 11.18 15.06 6.98 11.68 17.93 22.72 20.74 28.69 23.05 27.98 D: MCP-1 (pg/mL) 5 5248.05 1587.37 1340.99 4983.60 2780.68 1416.04 5248.05 5248.05 5248.05 1442.22 4251.98 5127.77 0.5 5248.05 1309.56 1156.87 4127.69 1449.70 1085.53 5248.05 5248.05 5248.05 934.29 3771.32 5020.45 0.05 5248.05 1172.01 1085.39 1370.45 1053.58 1046.54 4864.54 5158.56 4237.64 777.19 1470.83 4211.41 0.005 3338.36 1287.71 1166.78 942.49 1323.53 1357.65 1459.20 3657.48 2654.60 869.76 1651.58 2457.90 0.0005 1807.16 1201.89 1038.39 901.63 1122.21 833.56 1763.86 1466.27 1172.02 923.73 1191.91 1176.04
(54) TABLE-US-00007 TABLE 7 Cytokine release in percentages of MM6 cells stimulated with purified LPS (the same data are graphically presented in FIG. 4) MM6 cells were stimulated with 5 ng/ml LPS. Data are expressed as mean values of two independent experiments. IL-6 (%) SEM IL-1b (%) SEM IP-10 (%) SEM MCP-1 (%) SEM IL-10 (%) SEM HB-1 100.00 4.07 100.00 6.08 100.00 7.68 100.0 0.00 100.00 19.63 ΔL1 0.34 0.20 3.03 0.72 3.60 0.88 30.25 1.38 12.26 7.49 ΔL2 0.32 0.20 2.95 0.69 2.74 0.35 25.55 2.30 11.69 6.77 P 12.33 0.75 12.39 0.40 58.01 5.08 94.96 5.04 41.61 14.45 ΔL1-P 0.69 0.34 3.59 0.86 14.11 1.89 52.99 16.31 15.41 8.41 ΔL2-P 0.14 0.08 2.48 0.96 4.56 0.60 26.98 1.83 11.39 6.58 ΔL1-Lp30 21.49 2.86 23.51 5.58 70.71 11.46 100.00 0.00 48.97 8.55 ΔL1-Lp25 61.64 6.63 75.42 9.59 84.62 9.85 100.00 0.00 79.72 9.28 ΔLa 60.83 3.58 58.50 8.23 93.92 13.41 100.00 0.00 79.33 12.54 ΔLa-ΔL1 0.33 0.09 3.26 0.92 6.73 1.41 27.48 1.41 12.74 7.48 ΔLa-P 2.65 0.28 5.30 0.46 54.57 5.77 81.02 11.52 22.94 11.66 ΔLa-E 77.26 6.43 99.61 9.70 100.05 13.99 97.71 2.29 83.23 13.21 No LPS 0.12 0.05 3.62 1.01 2.41 0.82 22.94 3.23 10.69 6.27
(55) TABLE-US-00008 SUPPLEMENTAL TABLE 1 Composition of the main ion peaks observed in charge-deconvoluted ESI-FT mass spectra of intact LOS from twelve mutants of N. meningitidis (see FIG. 1). Measured Proposed LOS composition Calculated Deviation Bacteria mass (u) Oligosaccharide Lipid A mass (u) (ppm) HB-1 3408.507 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 3408.514 2.2 3351.488 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 3351.493 1.5 3285.501 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 3285.506 1.5 3228.480 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 3228.484 1.4 ΔlpxL1 3226.342 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3226.347 1.7 3169.324 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3169.326 0.6 3103.336 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3103.339 0.9 3046.315 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3046.317 0.8 3388.394 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3388.400 1.8 3331.373 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3331.379 1.7 ΔlpxL2 3023.367 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.2•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3023.373 1.8 2966.348 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.2•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 2966.351 1.0 3185.419 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.2•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3185.425 2.0 3128.398 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.2•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3128.404 1.9 2843.340 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 2843.343 0.9 2720.331 Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo2 P.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 2720.334 1.1 pagL 3210.345 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.1C14OH.sub.2 3210.352 2.3 3232.326* PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.1C14OH.sub.2 3232.335 2.8 3153.325 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.1C14OH.sub.2 3153.331 1.9 3175.306* PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.1C14OH.sub.2 3175.313 2.4 3087.338 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.2•C12OH.sub.1C14OH.sub.2 3087.344 1.9 3109.320* PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.2•C12OH.sub.1C14OH.sub.2 3109.326 2.1 3030.318 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.2•C12OH.sub.1C14OH.sub.2 3030.322 1.5 3052.298* PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.2•C12OH.sub.1C14OH.sub.2 3052.305 2.3 2971.161 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.1•C14OH.sub.2 2971.164 1.0 2950.352 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.2•PEA.sub.1•HexN.sub.2•C12.sub.2•C12OH.sub.1•C14OH.sub.2 2950.356 1.4 2848.152 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.1•C14OH.sub.2 2848.155 1.2 3408.505 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 3408.514 2.8 3351.485 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 3351.493 2.4 3372.396 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.1C14OH.sub.2 3372.405 2.8 3315.376 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.1C14OH.sub.2 3315.384 2.4 ΔlpxL1- 3028.180 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.1•C14OH.sub.2 3028.185 1.8 pagL 2971.160 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.1•C14OH.sub.2 2971.164 1.3 2905.173 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.1•C14OH.sub.2 2905.177 1.3 2848.152 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.1•C14OH.sub.2 2848.155 1.2 3226.339 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3226.347 2.6 3169.319 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3169.326 2.2 3190.232 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.1•C14OH.sub.2 3190.238 2.0 3133.210 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.1•C14OH.sub.2 3133.217 2.2 3103.331 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3103.339 2.5 ΔlpxL2- 2825.206 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.2•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.1•C14OH.sub.2 2825.211 1.6 pagL 2768.187 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.2•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.1•C14OH.sub.2 2768.189 0.8 2987.257 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.2•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.1•C14OH.sub.2 2987.263 2.1 2930.236 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.2•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.1•C14OH.sub.2 2930.242 2.0 2966.344 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.2•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 2966.351 2.4 2548.127 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.1 P.sub.2•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.1•C14OH.sub.2 2548.131 1.5 2645.178 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.1•C14OH.sub.2 2645.181 1.0 2720.331 Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 2720.334 1.1 ΔlpxL1- 3046.315 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3046.317 0.8 lpxP 3103.333 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2Gly.sub.1 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3103.339 1.9 30° C. 3169.322 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3169.326 1.2 3226.340 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2Gly.sub.1 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3226.347 2.3 3208.364 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3208.370 1.9 3265.382 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2Gly.sub.1 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3265.392 3.0 3331.372 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3331.379 2.0 3388.391 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2Gly.sub.1 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3388.400 2.7 3282.524 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1 3282.531 2.3 3339.543 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2Gly.sub.1 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1 3339.553 3.0 3405.533 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1 3405.540 2.0 3462.553 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2Gly.sub.1 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1 3462.561 2.4 3444.574 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1 3444.584 3.0 3567.585 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1 3567.593 2.2 3624.606 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1 3624.614 2.3 ΔlpxL1- 3046.314 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3046.317 1.1 lpxP 3103.333 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2Gly.sub.1 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3103.339 1.9 25° C. 3169.321 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3169.326 1.6 3226.341 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3226.347 2.0 3208.366 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3208.370 1.3 3265.386 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3265.392 1.7 3331.373 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3331.379 1.7 3388.393 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3388.400 2.1 3254.494 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1—C2H4 3254.500 1.9 3282.526 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1 3282.531 1.6 3311.516 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2Gly.sub.1 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1—C2H4 3311.522 1.7 3339.546 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1 3339.553 2.1 3377.502 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1—C2H4 3377.509 2.0 3405.535 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1 3405.540 1.4 3434.522 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1—C2H4 3434.530 2.4 3462.554 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1 3462.561 2.1 3444.575 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1 3444.584 2.7 3501.596 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1 3501.606 2.8 3567.586 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1 3567.593 1.9 3624.608 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•PEA.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1 3624.614 1.7 ΔlptA 3162.489 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 3162.497 2.7 3184.471* PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 3184.480 2.8 3105.471 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 3105.476 1.6 3127.452* PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 3127.458 2.0 3025.506 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 3025.510 1.2 3324.541 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly P.sub.3•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 3324.550 2.8 3267.521 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 3267.529 2.4 ΔlptA- 2980.324 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 2980.330 2.1 ΔlpxL1 2923.307 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 2923.309 0.6 3142.375 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3142.383 2.6 3085.354 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 3085.362 2.5 ΔlptA- 2964.328 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•HexN.sub.2•C12.sub.2•C12OH.sub.1•C14OH.sub.2 2964.335 2.5 pagL 2986.309* PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•HexN.sub.2•C12.sub.2•C12OH.sub.1•C14OH.sub.2 2986.318 3.0 2907.311 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•HexN.sub.2•C12.sub.2•C12OH.sub.1•C14OH.sub.2 2907.314 1.0 2929.290* PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•HexN.sub.2•C12.sub.2•C12OH.sub.1•C14OH.sub.2 2929.296 2.2 3069.359 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•HexN.sub.2•C12.sub.2•C12OH.sub.1•C14OH.sub.2 3069.367 2.5 3105.468 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 3105.476 2.6 3126.379 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•HexN.sub.2•C12.sub.2•C12OH.sub.1•C14OH.sub.2 3126.388 3.0 3162.488 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 3162.497 3.0 2725.144 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.3•HexN.sub.2•C12.sub.1•C12OH.sub.1•C14OH.sub.2 2725.147 1.1 2782.165 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.3•HexN.sub.2•C12.sub.1•C12OH.sub.1•C14OH.sub.2 2782.168 1.2 2827.344 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.1•C14OH.sub.2 2827.348 1.3 2687.254 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.1 P.sub.3•HexN.sub.2•C12.sub.2•C12OH.sub.1•C14OH.sub.2 2687.256 0.6 ΔlptA- 3082.525 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 3082.531 2.0 lpxE 3104.507* PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 3104.514 2.1 3025.508 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 3025.510 0.5 3047.488* PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 3047.492 1.3 3069.468** PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 3069.475 2.1 3244.576 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 P.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 3244.584 2.4 3187.556 PEA.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 P.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 3187.562 2.0 2805.449 PEA.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.1 P.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 2805.451 0.8 *Monosodium adduct. **Disodium adduct. Abbreviations: Kdo, 3-deoxy-D-manno-oct-2-ulosonic acid; Hep, L-glycero-D-manno-heptose; Hex, hexose; HexNAc, N-acetylhexosamine; Gly, glycine; PEA, phosphoethanolamine; P, phosphate; C12OH, 3-hydroxy-dodecanoic acid; C14OH, 3-hydroxy-tetradecanoic acid; C12, dodecanoic acid; C16:1, 9-hexadecenoic acid
(56) TABLE-US-00009 SUPPLEMENTAL TABLE 2 Proposed compositions for charge-deconvoluted fragment ion peaks obtained by in-source collision-induced dissociation ESI-FT MS of LOS. Fragment ion Measured Proposed LOS composition Calculated Deviation Bacteria type.sup.a) mass (u) Oligosaccharide Lipid A mass (u) (ppm) HB-1 B 1369.404 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1369.406 1.1 B-Kdo-CO2 1105.355 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1105.357 2.2 B-Kdo-CO2 1048.334 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1048.336 1.9 Y 1916.098 P.sub.3•PE.sub.1•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 1916.100 1.2 Y 2039.106 P.sub.3•PE.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 2039.109 1.4 ΔlpxL1 B 1369.405 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1369.406 0.4 B-Kdo-CO2 1105.356 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1105.357 1.3 B-Kdo-CO2 1048.335 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1048.336 0.9 Y 1733.933 P.sub.3•PE.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 1733.933 0.2 Y 1856.942 P.sub.3•PE.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 1856.942 0.1 ΔlpxL2 B 1369.404 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1369.406 1.1 B-Kdo-CO2 1105.356 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1105.357 1.3 B-Kdo-CO2 1048.335 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1048.336 0.9 B-Kdo-CO2 1267.409 PE.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1267.410 1.0 B-Kdo-CO2 1210.387 PE.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1210.389 1.5 Y 1530.957 P.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 1530.958 0.9 Y 1653.965 P.sub.2•PE.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 1653.967 1.2 pagL B 1369.404 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1369.406 1.1 B 1312.381 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1312.384 2.4 B-Kdo-CO2 1105.356 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1105.357 1.3 B-Kdo-CO2 1048.335 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1048.336 0.9 B-Kdo-CO2 1210.387 PE.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1210.389 1.5 Y 1717.937 P.sub.3•PE.sub.1•HexN.sub.2•C12.sub.2•C12OH.sub.1•C14OH.sub.2 1717.938 0.8 Y 1840.946 P.sub.3•PE.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.1•C14OH.sub.2 1840.947 0.5 ΔlpxL1- B 1369.404 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1369.406 1.1 pagL B-Kdo-CO2 1105.356 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1105.357 1.3 B-Kdo-CO2 1048.335 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1048.336 0.9 B-Kdo-CO.sub.2 1267.409 PE.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1267.410 1.0 B-Kdo-CO.sub.2 1210.387 PE.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1210.389 1.5 Y 1535.77 P.sub.3•PE.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.1•C14OH.sub.2 1535.771 0.8 Y 1658.779 P.sub.3•PE.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.1•C14OH.sub.2 1658.780 0.5 Y 1856.943 P.sub.3•PE.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 1856.942 0.6 Y 1733.933 P.sub.3•PE.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 1733.933 0.2 ΔlpxL2- B-Kdo-CO2 1105.355 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1105.357 2.2 pagL B-Kdo-CO2 1048.334 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1048.336 1.9 B-Kdo-CO2 1267.408 PE.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1267.410 1.8 B-Kdo-CO2 1210.387 PE.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1210.389 1.5 Y 1455.802 P.sub.2•PE.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.1•C14OH.sub.2 1455.805 2.0 Y 1653.964 P.sub.2•PE.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 1653.967 1.8 Y 1530.955 P.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 1530.958 2.2 ΔlpxL1- B 1369.403 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1369.406 1.9 LpxP B-Kdo-CO2 1105.356 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1105.357 1.3 30° C. B-Kdo-CO2 1048.335 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1048.336 0.9 B-Kdo-CO2 1267.408 PE.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1267.410 1.8 B-Kdo-CO2 1210.387 PE.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1210.389 1.5 Y 1856.941 P.sub.3•PE.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 1856.942 0.4 Y 1733.932 P.sub.3•PE.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 1733.933 0.7 Y-P 1653.965 P.sub.3•PE.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 1653.967 1.2 Y-2P-H2O 1555.988 P.sub.3•PE.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 1555.990 1.3 Y 2093.153 P.sub.3•PE.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1 2093.156 1.4 Y 1970.147 P.sub.3•PE.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1 1970.147 0.2 Y-P 1890.182 P.sub.3•PE.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1 1890.181 0.5 Y-2P-H2O 1792.202 P.sub.3•PE.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1 1792.204 1.2 ΔlpxL1- B 1369.404 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1369.406 1.1 LpxP B 1312.379 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1312.384 3.9 25° C. B-Kdo-CO2 1105.356 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1105.357 1.3 B-Kdo-CO2 1048.335 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1048.336 0.9 B-Kdo-CO2 1267.409 PE.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1267.410 1.0 B-Kdo-CO2 1210.387 PE.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1210.389 1.5 Y 1856.941 P.sub.3•PE.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 1856.942 0.4 Y 1733.932 P.sub.3•PE.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 1733.933 0.7 Y-P 1653.965 P.sub.3•PE.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 1653.967 1.2 Y-2P-H2O 1555.988 P.sub.3•PE.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 1555.990 1.3 Y 2093.152 P.sub.3•PE.sub.2•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1 2093.156 1.8 Y 1970.147 P.sub.3•PE.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1 1970.147 0.2 Y-P 1890.18 P.sub.3•PE.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1 1890.181 0.5 Y-2P-H2O 1792.203 P.sub.3•PE.sub.1•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2•C16:1.sub.1 1792.204 0.6 ΔlptA B 1369.404 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1369.406 1.1 B 1312.38 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1312.384 3.1 B-Kdo-CO2 1105.356 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1105.357 1.3 B-Kdo-CO2 1048.335 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1048.336 0.9 B-Kdo-CO2 1267.408 PE.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1267.410 1.8 B-Kdo-CO2 1210.387 PE.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1210.389 1.5 Y 1793.09 P.sub.3•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 1793.092 1.0 Y 1713.123 P.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 1713.125 1.5 ΔlptA- B 1369.405 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1369.406 0.4 ΔlpxL1 B 1312.38 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1312.384 3.1 B-Kdo-CO2 1105.356 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1105.357 1.3 B-Kdo-CO2 1048.335 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1048.336 0.9 B-Kdo-CO2 1267.409 PE.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1267.410 1.0 B-Kdo-CO2 1210.388 PE.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1210.389 0.7 Y 1610.923 P.sub.3•HexN.sub.2•C12.sub.1•C12OH.sub.2•C14OH.sub.2 1610.925 1.1 ΔlptA- B 1369.404 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1369.406 1.1 pagL B 1312.382 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1312.384 1.6 B-Kdo-CO2 1105.356 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1105.357 1.3 B-Kdo-CO2 1048.335 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1048.336 0.9 B-Kdo-CO2 1267.409 PE.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1267.410 1.0 B-Kdo-CO2 1210.387 PE.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1210.389 1.5 Y 1594.928 P.sub.3•HexN.sub.2•C12.sub.2•C12OH.sub.1•C14OH.sub.2 1594.930 1.2 Y 1514.961 P.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.1•C14OH.sub.2 1514.964 1.7 Y 1793.092 P.sub.3•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 1793.092 0.1 Y 1713.125 P.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 1713.125 0.3 ΔlptA- B 1369.404 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1369.406 1.1 LpxE B 1312.382 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1312.384 1.6 B 1474.436 PE.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1474.437 0.6 B-Kdo-CO2 1105.355 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2•Gly.sub.1 1105.357 2.2 B-Kdo-CO2 1048.335 PE.sub.1•Hex.sub.1•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1048.336 0.9 B-Kdo-CO2 1210.387 PE.sub.1•Hex.sub.2•Hep.sub.2•HexNAc.sub.1•Kdo.sub.2 1210.389 1.5 Y 1713.124 P.sub.2•HexN.sub.2•C12.sub.2•C12OH.sub.2•C14OH.sub.2 1713.125 0.9 In-source collision-induced dissociation of LOS produced B- and Y-type fragment ions corresponding to oligosaccharide and lipid A domains due to the rupture of the glycosidic bond between Kdo and lipid A. Fragment ions are assigned according to the nomenclature of Domon and Costello (24). Mass numbers given refer to monoisotopic masses of the neutral molecules. Abbreviations: Kdo, 3-deoxy-D-manno-oct-2-ulosonic acid; Hep, L-glycero-D-manno-heptose; Hex, hexose; HexNAc, N-acetylhexosamine; Gly, glycine; PEA, phosphoethanolamine; P, phosphate; C12OH, 3-hydroxy-dodecanoic acid; C14OH, 3-hydroxy-tetradecanoic acid; C12, dodecanoic acid; C16:1, 9-hexadece
REFERENCES
(57) 1. Aderem, A., and Ulevitch, R. J. (2000) Toll-like receptors in the induction of the innate immune response. Nature 406, 782-787 2. Loppnow, H., Brade, H., Durrbaum, I., Dinarello, C. A., Kusumoto, S., Rietschel, E. T., and Flad, H. D. (1989) IL-1 induction-capacity of defined lipopolysaccharide partial structures. Journal of immunology 142, 3229-3238 3. Zariri, A., and van der Ley, P. (2015) Biosynthetically engineered lipopolysaccharide as vaccine adjuvant. Expert review of vaccines 14, 861-876 4. Akira, S., and Takeda, K. (2004) Toll-like receptor signalling. Nature reviews. Immunology 4, 499-511 5. Raetz, C. R., and Whitfield, C. (2002) Lipopolysaccharide endotoxins. Annual review of biochemistry 71, 635-700 6. Salomao, R., Brunialti, M. K., Rapozo, M. M., Baggio-Zappia, G. L., Galanos, C., and Freudenberg, M. (2012) Bacterial sensing, cell signalling, and modulation of the immune response during sepsis. Shock 38, 227-242 7. Park, B. S., Song, D. H., Kim, H. M., Choi, B. S., Lee, H., and Lee, J. 0. (2009) The structural basis of lipopolysaccharide recognition by the TLR4-MD-2 complex. Nature 458, 1191-1195 8. Raetz, C. R., Reynolds, C. M., Trent, M. S., and Bishop, R. E. (2007) Lipid A modification systems in gram-negative bacteria. Annual review of biochemistry 76, 295-329 9. Ohto, U., Fukase, K., Miyake, K., and Shimizu, T. (2012) Structural basis of species-specific endotoxin sensing by innate immune receptor TLR4/MD-2. Proceedings of the National Academy of Sciences of the United States of America 109, 7421-7426 10. Gandhapudi, S. K., Chilton, P. M., and Mitchell, T. C. (2013) TRIF is required for TLR4 mediated adjuvant effects on T cell clonal expansion. PloS one 8, e56855 11. Mata-Haro, V., Cekic, C., Martin, M., Chilton, P. M., Casella, C. R., and Mitchell, T. C. (2007) The vaccine adjuvant monophosphoryl lipid A as a TRIF-biased agonist of TLR4. Science 316, 1628-1632 12. Casella, C. R., and Mitchell, T. C. (2008) Putting endotoxin to work for us: monophosphoryl lipid A as a safe and effective vaccine adjuvant. Cellular and molecular life sciences:CMLS 65, 3231-3240 13. Pupo, E., Hamstra, H. J., Meiring, H., and van der Ley, P. (2014) Lipopolysaccharide engineering in Neisseria meningitidis: structural analysis of different pentaacyl lipid A mutants and comparison of their modified agonist properties. The Journal of biological chemistry 289, 8668-8680 14. Zughaier, S. M., Lindner, B., Howe, J., Garidel, P., Koch, M. H., Brandenburg, K., and Stephens, D. S. (2007) Physicochemical characterization and biological activity of lipooligosaccharides and lipid A from Neisseria meningitidis. Journal of endotoxin research 13, 343-357 15. van der Ley, P., Steeghs, L., Hamstra, H. J., ten Hove, J., Zomer, B., and van Alphen, L. (2001) Modification of lipid A biosynthesis in Neisseria meningitidis lpxL mutants: influence on lipopolysaccharide structure, toxicity, and adjuvant activity. Infection and immunity 69, 5981-5990 16. van de Waterbeemd, B., Streefland, M., van der Ley, P., Zomer, B., van Dijken, H., Martens, D., Wijffels, R., and van der Pol, L. (2010) Improved OMV vaccine against Neisseria meningitidis using genetically engineered strains and a detergent-free purification process. Vaccine 28, 4810-4816 17. Steeghs, L., Keestra, A. M., van Mourik, A., Uronen-Hansson, H., van der Ley, P., Callard, R., Klein, N., and van Putten, J. P. (2008) Differential activation of human and mouse Toll-like receptor 4 by the adjuvant candidate LpxL1 of Neisseria meningitidis. Infection and immunity 76, 3801-3807 18. Geurtsen, J., Steeghs, L., Hamstra, H. J., Ten Hove, J., de Haan, A., Kuipers, B., Tommassen, J., and van der Ley, P. (2006) Expression of the lipopolysaccharide-modifying enzymes PagP and PagL modulates the endotoxic activity of Bordetella pertussis. Infection and immunity 74, 5574-5585 19. Westphal, O., and Jann, K. (1965) Bacterial lipopolysaccharides. Extraction with phenol-water and further applications of the procedure in Methods in Carbohydrate Chemistry (Whistler, R. L., and Wolfan, M. L. eds.), Academic Press, Inc., New York. pp 83-91 20. Karkhanis, Y. D., Zeltner, J. Y., Jackson, J. J., and Carlo, D. J. (1978) A new and improved microassay to determine 2-keto-3-deoxyoctonate in lipopolysaccharide of
(58) Gram-negative bacteria. Analytical biochemistry 85, 595-601 21. Tsai, C. M., and Frasch, C. E. (1982) A sensitive silver stain for detecting lipopolysaccharides in polyacrylamide gels. Analytical biochemistry 119, 115-119 22. Kondakov, A., and Lindner, B. (2005) Structural characterization of complex bacterial glycolipids by Fourier transform mass spectrometry. European journal of mass spectrometry 11, 535-546 23. Wilm, M. S., and Mann, M. (1994) Electrospray and Taylor-Cone theory, Dole's beam of macromolecules at last? Int J Mass Spectrom Ion Proc 136, 167-180 24. Domon, B., and Costello, C. E. (1988) A Systematic Nomenclature for Carbohydrate Fragmentations in FAB-MS/MS Spectra of Glycoconjugates. Glycoconjugate J 5, 397-409 25. Pavliak, V., Brisson, J. R., Michon, F., Uhrin, D., and Jennings, H. J. (1993) Structure of the sialylated L3 lipopolysaccharide of Neisseria meningitidis. The Journal of biological chemistry 268, 14146-14152 26. van der Ley, P., Kramer, M., Martin, A., Richards, J. C., and Poolman, J. T. (1997) Analysis of the icsBA locus required for biosynthesis of the inner core region from Neisseria meningitidis lipopolysaccharide. FEMS microbiology letters 146, 247-253 27. Carty, S. M., Sreekumar, K. R., and Raetz, C. R. (1999) Effect of cold shock on lipid A biosynthesis in Escherichia coli. Induction At 12 degrees C. of an acyltransferase specific for palmitoleoyl-acyl carrier protein. The Journal of biological chemistry 274, 9677-9685 28. Golenbock, D. T., Hampton, R. Y., Qureshi, N., Takayama, K., and Raetz, C. R. (1991) Lipid A-like molecules that antagonize the effects of endotoxins on human monocytes. The Journal of biological chemistry 266, 19490-19498 29. Findlow, J., Borrow, R., Snape, M. D., Dawson, T., Holland, A., John, T. M., Evans, A., Telford, K. L., Ypma, E., Toneatto, D., Oster, P., Miller, E., and Pollard, A. J. (2010) Multicenter, open-label, randomized phase II controlled trial of an investigational recombinant Meningococcal serogroup B vaccine with and without outer membrane vesicles, administered in infancy. Clinical infectious diseases: an official publication of the Infectious Diseases Society of America 51, 1127-1137 30. Snape, M. D., Dawson, T., Oster, P., Evans, A., John, T. M., Ohene-Kena, B., Findlow, J., Yu, L. M., Borrow, R., Ypma, E., Toneatto, D., and Pollard, A. J. (2010) Immunogenicity of two investigational serogroup B meningococcal vaccines in the first year of life: a randomized comparative trial. The Pediatric infectious disease journal 29, e71-79 31. Keiser, P. B., Biggs-Cicatelli, S., Moran, E. E., Schmiel, D. H., Pinto, V. B., Burden, R. E., Miller, L. B., Moon, J. E., Bowden, R. A., Cummings, J. F., and Zollinger, W. D. (2011) A phase 1 study of a meningococcal native outer membrane vesicle vaccine made from a group B strain with deleted lpxL1 and synX, over-expressed factor H binding protein, two PorAs and stabilized OpcA expression. Vaccine 29, 1413-1420 32. Needham, B. D., Carroll, S. M., Giles, D. K., Georgiou, G., Whiteley, M., and Trent, M. S. (2013) Modulating the innate immune response by combinatorial engineering of endotoxin. Proceedings of the National Academy of Sciences of the United States of America 110, 1464-1469 33. Wang, X., Karbarz, M. J., McGrath, S. C., Cotter, R. J., and Raetz, C. R. (2004) MsbA transporter-dependent lipid A 1-dephosphorylation on the periplasmic surface of the inner membrane: topography of francisella novicida LpxE expressed in Escherichia coli. The Journal of biological chemistry 279, 49470-49478 34. John, C. M., Liu, M., Phillips, N. J., Yang, Z., Funk, C. R., Zimmerman, L. I., Griffiss, J. M., Stein, D. C., and Jarvis, G. A. (2012) Lack of lipid A pyrophosphorylation and functional lptA reduces inflammation by Neisseria commensals. Infection and immunity 80, 4014-4026 35. Michaud, J. P., Halle, M., Lampron, A., Theriault, P., Prefontaine, P., Filali, M., Tribout-Jover, P., Lanteigne, A. M., Jodoin, R., Cluff, C., Brichard, V., Palmantier, R., Pilorget, A., Larocque, D., and Rivest, S. (2013) Toll-like receptor 4 stimulation with the detoxified ligand monophosphoryl lipid A improves Alzheimer's disease-related pathology. Proceedings of the National Academy of Sciences of the United States of America 110, 1941-1946 36. Peri, F., and Piazza, M. (2012) Therapeutic targeting of innate immunity with Toll-like receptor 4 (TLR4) antagonists. Biotechnology advances 30, 251-260 37. Adams, S. (2009) Toll-like receptor agonists in cancer therapy. Immunotherapy 1, 949-964