ANTIBODY AGAINST THE ENDOTHELIN RECEPTOR SUBTYPE A, AND USES THEREOF
20220089755 · 2022-03-24
Assignee
- Commissariat A L'energie Atomique Et Aux Energies Alternatives (Paris, FR)
- Universite De Paris (Paris, FR)
- Universite De Montpellier (Montpellier, FR)
- Institut National De La Sante Et De La Recherche Medicale (Paris, FR)
Inventors
- Didier Boquet (Les Pavillons Sous Bois, FR)
- Amaury Herbet (Courbevoie, FR)
- Frederic DUCANCEL (Longjumeau, FR)
- Narciso COSTA (Saulx-les-Chartreux, FR)
- Jean-Yves COURAUD (Paris, FR)
- Jean-Philippe Hugnot (Montpellier, FR)
Cpc classification
G01N33/74
PHYSICS
C07K2317/92
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
Abstract
The present invention relates to antibodies against the endothelin receptor subtype A, in particular monoclonal antibodies, fragments or derivatives thereof. The present invention also relates to the therapeutic or diagnostic use of this antibody or as a research tool in the field of cancers, in particular glioblastoma.
Claims
1. Antibody directed against the endothelin receptor subtype A having: i) at least one light-chain variable region, wherein the amino acid sequence: of the CDR1.sub.L has at least 60% identity with the following amino acid sequence: SQSIVYSNGKIYL (SEQ ID NO: 2); of the CDR2.sub.L has at least 60% identity with the following amino acid sequence: KVS; of the CDR3.sub.L has at least 60% identity with the following amino acid sequence: FQGSHLPLT (SEQ ID NO: 4); and ii) at least one heavy-chain variable region wherein the amino acid sequence: of the CDR1.sub.H has at least 60% identity with the following amino acid sequence: GFTFNIYA (SEQ ID NO: 6); of the CDR2.sub.H has at least 60% identity with the following amino acid sequence: IRSKSNNYAT (SEQ ID NO: 8); of the CDR3.sub.H has at least 60% identity with the following amino acid sequence: VSSYYSGSFFAY (SEQ ID NO: 10); a fragment or a derivative thereof.
2. The antibody according to claim 1, wherein said antibody comprises at least one light-chain variable region wherein the amino acid sequence: of the CDR1.sub.L is SQSIVYSNGKIYL (SEQ ID NO: 2); of the CDR2.sub.L is KVS; and of the CDR3.sub.L is FQGSHLPLT (SEQ ID NO: 4).
3. The antibody according to claim 1, wherein said antibody comprises at least one light-chain variable region wherein the amino acid sequence has at least 60% identity with the following sequence: TABLE-US-00011 (SEQ ID NO: 12) DVLMTQTPLSLPVSLGDQASISCRSSQSIVYSNGKIYLEWYLQKPGQSPKL LIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHLPLT FGAGTKLELKR.
4. The antibody according to claim 1, wherein said antibody comprises at least one heavy-chain variable region wherein the amino acid sequence: of the CDR1.sub.H is GFTFNIYA (SEQ ID NO: 6); of the CDR2.sub.H is IRSKSNNYAT (SEQ ID NO: 8); and of the CDR3.sub.H is VSSYYSGSFFAY (SEQ ID NO: 10).
5. The antibody according to claim 1, wherein said antibody comprises at least one heavy-chain variable region wherein the amino acid sequence has at least 60% identity with the following sequence: TABLE-US-00012 (SEQ ID NO: 14) EVQLVESGGGLVQPKGSLKLSCAASGFTFNIYAMNWIRQAPGKGLEWIARI RSKSNNYATYYADSVKDRFTISRDDSQNMVYLQMNNLKTEDTAMYYCVSSY YSGSFFAYWGQGTLVTVSA.
6. The antibody according to claim 1, wherein said antibody is an immunoglobulin of type IgG2b/kappa.
7. The antibody according to claim 1, wherein said antibody is monoclonal.
8. The antibody according to claim 1, wherein said antibody is the monoclonal murine antibody obtained from the hybridoma filed at the CNCM on 18 Oct. 2017 under the number CNCM 1-5250.
9. The antibody according to claim 1, wherein said antibody is a chimerised antibody.
10. The antibody according to claim 1, wherein said antibody is a humanised antibody.
11. Hybridoma filed at the CNCM on 18 Oct. 2017 under the number CNCM 1-5250.
12. Isolated polynucleotide chosen from the following various polynucleotides: a) a polynucleotide coding an antibody as defined in claim 1; β) a polynucleotide that is complementary to the polynucleotide as defined at point (α); and γ) a polynucleotide of at least 18 nucleotides, capable of hybridising under high-stringency conditions to the polynucleotides as defined at points (α) and (β).
13. Cloning and/or expression vector containing at least one polynucleotide according to claim 12.
14. Host organism transformed by or comprising a polynucleotide according to claim 12 or a vector according to claim 13.
15. Compound comprising an antibody according to claim 1 conjugated with an element chosen from the group consisting of a cytotoxic group, an easily detectable group or an effector group.
16. Antibody according to claim 1, polynucleotide according to claim 12 or compound according to claim 15 for use as a drug.
17. Pharmaceutical composition comprising, as active principle, an antibody according to claim 1 and a pharmaceutically acceptable vehicle.
18. Antibody according to claim 1, for use in the treatment of and/or prevention of an illness or a pathology involving a malfunctioning, direct or in association with another physiological route, of the axis comprising an endothelin and at least one of the receptors thereof such as in particular the endothelin receptor subtype A.
19. Antibody, polynucleotide, compound or pharmaceutical composition for use according to claim 18, characterised in that said illness or said pathology is a cancer.
20. Method for diagnosing a cancer such as a glioblastoma in vitro comprising the steps of: a.sub.1′) putting a biological sample of the subject in contact with a compound according to claim 15; b.sub.1′) detecting a signal emitted by the easily detectable group, and c.sub.1′) determining a presence or absence of a cancer in said subject on the basis of the signal detected at step (b.sub.1′) optionally compared with a control signal.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0187]
[0188]
[0189]
[0190]
[0191]
[0192]
[0193]
[0194]
DETAILED DISCLOSURE OF PARTICULAR EMBODIMENTS
[0195] I. Equipment and Methods
[0196] The strategy for immunisation and screening of the hybridomas used in the present invention is identical to that used in the international applications WO 2012/045776 [14] and WO 2017/220739 [15].
[0197] II. Biochemical Characterisation
[0198] After purification of the Rendomab-A63 on Protein A—PropSep high capacity (Millipore), characterisation of the biochemical properties thereof was carried out.
[0199] The isotyping of the heavy and light chains of the Rendomab-A63 was carried out using the “Rapid ELISA Mouse mAb Isotyping” kit from Piercell. This is type G immunoglobulin, of isotype 2b for the heavy chain and kappa for the light chain. Rendomab-A63 is therefore an immunoglobulin of type IgG2b/kappa.
[0200] Recognition of the ETA-R in its cell context (CHO-ETAR and Gli-7 cells) by Rendomab-A63 was established by flow cytometry and immunofluorescence cell marking.
[0201] The binding curves for Rendomab-A63 were produced
[0202] i) on the CHO (standing for “Chinese Hamster Ovary”) cell line, not expressing ETA-R (CHO-WT),
[0203] ii) on the CHO-ETAR line, CHO cells, transfected in a stable manner, to allow strong expression of ETA-R, and
[0204] iii) on the line of glioblastoma cell strains, Gli-7, established by Dr Jean-Philippe Hugnot from a biopsy following exeresis of a glioblastoma in a patient.
[0205] The fluorescence is quantified by flow cytometry on an FACSCalibur™ (BD Bioscience). A range of concentrations of antibodies lying between, at a maximum, 1 μM and, at a minimum, 5 μM was incubated for 2 hours at 4° C. in the presence or not of 100 nM ET1 (preincubated for 30 minutes at 4° C.). At 90% confluence, the cells are detached in the presence of versene and then aliquoted in tubes (300 μl/300,000 cells) in the presence of a saturation buffer (PBS-SNC 5%-BSA 0.1%) stored at 4° C. After three washes in PBS buffer, 300 μl of secondary antibody labeled with Alexa Fluor™ 488 (AF-488) diluted to 1/400 was added and incubated for 60 minutes at 4° C. (Goat anti-mouse IgG, Invitrogen-ref A10684). For each antibody concentration point, after three washes in PBS, 10,000 cells were counted with flow cytometry.
[0206] The data were analysed in the GraphPad Prism software and the curves modelled according to the parameter: a specific binding site. The apparent dissociation constants calculated gave the values of Kd close to 0.5 nM on the CHO-ETAR line in the presence or not of ET1 (
[0207] As illustrated in
[0208] III. Immunofluorescence on Glioblastoma Gli-7 Strain Cells
[0209] III.1. Preliminary Remarks
[0210] Glioblastoma tumour cells are known for overexpressing ET-1 [20] and the endothelin type A receptor (ETAR) as shown by the transcriptomic data of the Gliovis public base (http://gliovis.bioinfo.cnio.es/) presented in
[0211] III.2. Results
[0212]
[0216] The nuclei are coloured with DRAQ5 (Abcam ab108410) following the protocol of the supplier. The Gli-7 cells were incubated for 12 hours at 4° C. with either 1 μM of ET1FAM, or 30 nM final of RA63, or 30 nM final of NC. After three washes with PBS, for the labeling with the antibodies, the secondary antibody is added, diluted to 1/400, coupled with AF488 (Invitrogen—ref A10684) to the cells for 2 hours at 4° C. After three washes with PBS, the cells were mounted in an aqueous medium, Aquatex® (VWR 1 08562 0050) on plates, in order to be observed under confocal microscope (ZEISS).
[0217]
[0218] III.3. Comparative Results
[0219] In the immunisation process that made it possible to generate the RA63 antibody according to the invention, a plurality of monoclonal antibodies were obtained.
[0220] In particular, the Rendomab-Axx antibody directed against ETAR having an nM affinity but the binding of which on the endothelin receptor A is shifted by a concentration of 100 nm of ET1 (
[0221] This same antibody Raxx is not capable of binding to glioblastoma cells as shown by the immunofluorescence experiment presented in
[0222] IV. In Vivo Imaging by Fluorescence Tomography on a Preclinical Animal Model
[0223]
[0224] For
[0225] For
[0226] Ten days after IP injection, necessary for eliminating the tracers from the blood circulation, the mice were imaged with FMT 1500 (Perkin Elmer). For each mouse, a simultaneous acquisition at 680 nm and 750 nm was made. A strong fluorescence at 680 nm at the head of the xenografted mouse was observed, whereas, on this same mouse, the NC-AF750 tracer does not generate any fluorescence at 750 nm. Thus only the RA63-AF680 tracer was detected on the xenografted living mouse with the GLI-7 line. The absence of detection of the RA63-AF680 and NC-AF750 injected into the normal mouse was also noted.
[0227] For
[0228] In conclusion, the RA63 antibody can be used as a tracer (RA63-AF680), for diagnosing the presence of glioblastoma tumour cells (Gli-7) for imaging applications.
[0229] V. Molecular Cloning
[0230] Cloning of the nucleic transcripts coding the heavy chain and the light chain of Rendomab-A63, was performed using the kits: “GenElute/Total RNA” (Sigma-Aldrich) and “RACE-PCR” (Invitrogen).
[0231] The deduced nucleic amino acid sequences of the variable domains of the light chain (VL) and of the heavy chain (VH) of Rendomab-A63 are presented in
BIBLIOGRAPHIC REFERENCES
[0232] [1] Bulenger et at 2005, “Emerging role of homo- and heterodimerization in G-protein-coupled receptor biosynthesis and maturation”, Trends Pharmacol. Sci., vol. 26, pages 131-137. [0233] [2] Kenakin & Miller, 2010, “Seven Transmembrane Receptors as Shapeshifting Proteins: The Impact of Allosteric Modulation and Functional Selectivity on New Drug Discovery”, Pharmacol. Rev., vol. 62, pages 265-304. [0234] [3] Hilger et al, 2018, “Structure and dynamics of GPCR signaling complexes”, Nat. Struct. Mol. Biol., vol. 25, pages 4-12. [0235] [4] Shihoya et al, 2016, “Activation mechanism of endothelin ET.sub.B receptor by endothelin-1”, Nature, vol. 537, page 363 [0236] [5] Bagnato & Rosana, 2008, “The endothelin axis in cancer”, Int. J. Biochem. Cell Biol., vol. 40, pages 1443-1451. [0237] [6] Rosana et al, 2013, “Endothelin 1 in cancer: biological implications and therapeutic opportunities”, Nat. Rev. Cancer, vol. 13, pages 637-651. [0238] [7] Allard et at 2013, “Generation and characterization of rendomab-B1, a monoclonal antibody displaying potent and specific antagonism of the human endothelin B receptor”, mAbs, vol. 5, pages 56-69. [0239] [8] Borrull et al, 2016, “Rendomab B4, a monoclonal antibody that discriminates the human endothelin B receptor of melanoma cells and inhibits their migration”, mAbs, vol. 8, pages 1371-1385. [0240] [9] Cazaubon et al, 2006, “Endothelin-1 angiotensin II and cancer», Médecine/Sciences, vol. 22, pages 416-422. [0241] [10] Shah, 2007, “Endothelins in health and disease”, Eur. J. Int. Med., vol. 18, pages 272-282. [0242] [11] Irani et al, 2014, “A review of the profile of endothelin axis in cancer and its management”, Critical Reviews in Oncology/Hematology, vol. 89, pages 314-321. [0243] [12] Kondoh et al, 1990, “Isolation of anti-endothelin receptor monoclonal antibodies for use in receptor characterization”, BBRC, vol. 172, pages 503-510. [0244] [13] Patent application CA 2 971 491 in the name of Gmax Biopharm LLC, published on 8 Jun. 2017. [0245] [14] International application WO 2012/045776 in the name of the Commissariat à l′Energie Atomique et aux Energies Alternatives, published on 12 Apr. 2012. [0246] [15] International application WO 2017/220739 in the name of the Commissariat à l′Energie Atomique et aux Energies Alternatives, published on 28 Dec. 2017. [0247] [16] Verhoeyen et al, 1988, “Reshaping human antibodies: Grafting an antilysozyme activity”, Science, vol. 239, pages 1534-1536. [0248] [17] Patent U.S. Pat. No. 4,816,567 in the name of Genentech, published on 28 Mar. 1989. [0249] [18] Vaughan et al, 1998, “Human antibodies by design”, Nature Biotechnol. vol. 16, pages 535-539. [0250] [19] Sambrook et al, 1989, Molecular cloning, Noland C. ed., New York: Cold Spring Harbor Laboratory Press. [0251] [20] Egidy et al, 2000, “The endothelin system in human glioblastoma”, Lab. Investig. J. Tech. Methods Pathol., vol. 80, pages 1681-1689.