Cancer treatment composition combining anti-CD26 antibody and other anticancer agent
11273217 · 2022-03-15
Assignee
Inventors
- Taketo Yamada (Tokyo, JP)
- Mutsumi Hayashi (Tokyo, JP)
- Kohji Yamada (Tokyo, JP)
- Chikao Morimoto (Tokyo, JP)
- Toshihiro Okamoto (Koshigaya, JP)
- Yutaro Kaneko (Tokyo, JP)
Cpc classification
A61K39/395
HUMAN NECESSITIES
A61K31/519
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
A61K47/6857
HUMAN NECESSITIES
G01N2800/52
PHYSICS
G01N2333/70596
PHYSICS
A61K31/5377
HUMAN NECESSITIES
A61K47/6803
HUMAN NECESSITIES
A61K31/7068
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K31/343
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
C07K16/2896
CHEMISTRY; METALLURGY
International classification
A61K39/39
HUMAN NECESSITIES
A61K31/5377
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
A61K31/343
HUMAN NECESSITIES
A61K39/395
HUMAN NECESSITIES
G01N33/50
PHYSICS
A61K45/06
HUMAN NECESSITIES
C07K16/28
CHEMISTRY; METALLURGY
A61K31/519
HUMAN NECESSITIES
A61K31/7068
HUMAN NECESSITIES
A61K47/68
HUMAN NECESSITIES
Abstract
Mesothelioma growth inhibitory effect of standard cisplatin-pemetrexed concomitant therapy is potentiated by combination with an anti-CD26 antibody. A high therapeutic effect and excellent safety is obtained by the concomitant use of an anti-CD26 antibody and gemcitabine. By conjugating an anti-CD26 antibody (YS110) with triptolide via a divalent cross-linking agent for concomitant therapy using the anti-CD26 antibody, a novel antibody-drug conjugate (Y-TR1) very highly effective for CD26-positive malignant mesothelioma cells has been successfully obtained.
Claims
1. A conjugate comprising an anti-CD26 antibody or a F(ab′).sub.2 fragment thereof which is linked to triptolide, wherein the anti-CD26 antibody or the F(ab′).sub.2 fragment thereof specifically binds to CD26, comprising: (a) a CDRH1 amino acid sequence of SEQ ID NO: 30, a CDRH2 amino acid sequence of SEQ ID NO: 31, a CDRH3 amino acid sequence of SEQ ID NO: 32, a CDRL1 amino acid sequence of SEQ ID NO: 33, a CDRL2 amino acid sequence of SEQ ID NO: 34, and a CDRL3 amino acid sequence of SEQ ID NO: 35; or (b) a CDRH1 amino acid sequence of SEQ ID NO: 36, a CDRH2 amino acid sequence of SEQ ID NO: 37, a CDRH3 amino acid sequence of SEQ ID NO: 38, a CDRL1 amino acid sequence of SEQ ID NO: 39, a CDRL2 amino acid sequence of SEQ ID NO: 40, and a CDRL3 amino acid sequence of SEQ ID NO: 41.
2. The conjugate of claim 1, wherein the anti-CD26 antibody or the F(ab′).sub.2 fragment thereof is a humanized antibody or a fragment thereof.
3. The conjugate of claim 2, wherein the humanized antibody or the F(ab′).sub.2 fragment thereof comprises a heavy chain variable region comprising an amino acid sequence having 80% or more identity to an amino acid sequence of SEQ ID NO: 8, and a light chain variable region comprising an amino acid sequence having 80% or more identity to an amino acid sequence of SEQ ID NO: 4.
4. The conjugate of claim 2, wherein the humanized antibody or the F(ab′).sub.2 fragment thereof comprises a heavy chain variable region comprising an amino acid sequence of SEQ ID NO 8, and a light chain variable region comprising an amino acid sequence of SEQ ID NO 4.
5. The conjugate of claim 2, wherein the humanized antibody comprises at least one heavy chain comprising an amino acid sequence having 90% or more sequence identity to the amino acid sequence of SEQ ID NO: 17, and at least one light chain comprising an amino acid sequence having 90% or more sequence identity to the amino acid sequence of SEQ ID NO: 18.
6. The conjugate of claim 2, wherein the humanized antibody comprises at least one heavy chain comprising an amino acid sequence from position 20 to position 465 of the amino acid sequence of SEQ ID NO: 17, and at least one light chain comprising an amino acid sequence from position 21 to position 234 of the amino acid sequence of SEQ ID NO: 18.
7. The conjugate of claim 2, wherein the humanized antibody is produced by a strain designated as s604069.YST-pABMC148 (x411) under deposition No. PTA-7695 of the American Type Culture Collection (ATCC).
8. A method for inhibiting CD26-expressing malignant mesothelioma cell growth comprising administering a conjugate of claim 1.
9. A method for lysing a CD26-expressing malignant mesothelioma cell comprising administering a conjugate of claim 1.
10. A method of treatment of CD26-expressing malignant mesothelioma, comprising administering to a patient in need thereof a pharmaceutical composition comprising a conjugate of claim 1.
Description
BRIEF DESCRIPTION OF DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
DETAILED DESCRIPTION
(34) 1. Antibody
(35) The term “antibody” herein is an immunoglobulin molecule capable of specifically binding to a target such as a carbohydrate, a polynucleotide, a lipid, or an antibody via at least one antigen recognition site in variable regions of the immunoglobulin molecule. The antibody used herein includes a complete polyclonal antibody or monoclonal antibody as well as a fragment thereof (Fab, Fab′, F(ab′)2, Fv, etc.), a single-chain variable fragment (scFv), their variants, a fusion protein containing an antibody moiety, and other modified structures of an immunoglobulin molecule containing an antigen recognition site. The antibody can be any class of antibody such as IgG, IgA, or IgM (or subclass thereof) and does not need to be of particular class. Immunoglobulins are divided into different classes according to the amino acid sequences of heavy chain constant domains of the antibody. Typical five immunoglobulin classes are IgA, IgD, IgE, IgG and IgM, some of which may be further subdivided into subclasses (isotypes), for example, IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2. The corresponding heavy chain constant domains of immunoglobulins of different classes are called α, δ, ε, γ and μ, respectively. The respective subunit structures and three-dimensional structures are well known for the immunoglobulins of different classes.
(36) The “monoclonal antibody” described herein refers to an antibody obtained from a cell population producing substantially homogeneous antibodies. Specifically, individual antibodies contained in the cell population are identical except for natural mutants that might slightly possibly be present. The monoclonal antibody is directed to a single antigen site and is very specific. In contrast to a typical polyclonal antibody against different antigens targeting different antigenic determinants (epitopes), each monoclonal antibody targets a single antigenic determinant of an antigen. The modifier “monoclonal” refers to the properties of the antibody obtained from the cell population producing substantially homogeneous antibodies and should not be interpreted as requiring particular antibody production method. The monoclonal antibody used according to the present invention can be prepared by a recombinant DNA method as described in, for example, U.S. Pat. No. 4,816,567. The monoclonal antibody can also be isolated from a phage library prepared using a technique described in, for example, McCafferty et al., 1990, Nature, 348: 552-554.
(37) The “humanized” antibody used herein refers to a form of a nonhuman (e.g., mouse) antibody that is a specific chimeric immunoglobulin or a fragment thereof containing an immunoglobulin chain or a nonhuman immunoglobulin-derived minimum sequence (Fv, Fab, Fab′, F(ab′)2, or other antigen binding partial sequences of an antibody, etc.). Some humanized antibodies are human immunoglobulins (recipient antibodies) in which complementarity determining region (CDR)-derived residues of a recipient are replaced with CDR-derived residues of a nonhuman species (donor antibody) such as a mouse, a rat or a rabbit having the desired specificity, affinity and ability. In some cases, Fv framework region (FR) residues of the human immunoglobulin are replaced with the corresponding nonhuman-derived residues. Some humanized antibodies contain at least one, usually two variable regions derived from a nonhuman species (donor antibody) such as, a mouse, a rat or a rabbit having the desired specificity, affinity and/or ability, and one or more Fv framework region residues and/or one or more Fv CDR residues are replaced with the corresponding human residues (i.e., human antibody sequence-derived residues). Most generally, at least a plurality of Fv framework region residues may be replaced in one or more variable regions of the humanized antibody. The humanized antibody may further contain a residue that is found neither in the recipient antibody nor in the grafted CDR or framework sequence and may contain a residue for further improving and optimizing antibody performance.
(38) Some humanized antibodies contain substantially the whole of at least one, generally two variable regions. In these variable regions, all or substantially all CDRs correspond to nonhuman immunoglobulin CDRs, and all or substantially all FRs are FRs of human immunoglobulin consensus sequences. Some humanized antibodies contain substantially the whole of at least one, generally two variable regions. In these variable regions, a great majority of CDR amino acid residues are derived from non-human immunoglobulin CDRs, and one or more FR amino acid residues are derived from FRs of human immunoglobulin consensus sequences. Most preferably, the humanized antibody may contain at least a portion of a human immunoglobulin constant region (Fc) or domain (generally, a human immunoglobulin). Some humanized antibodies have a modified Fc region as described in International Publication No. WO99/58572. Some forms of the humanized antibody have one or more (e.g., 1, 2, 3, 4, 5, or 6) CDRs altered from the original antibody. These CDRs are also called one or more CDRs “derived” from one or more CDRs of the original antibody.
(39) The “variable region” of an antibody refers to antibody light chain or heavy chain variable regions each alone or in combination. The heavy chain and light chain variable regions are each composed of four framework regions (FRs) linked by three complementarity determining regions (CDRs) also known as hypervariable regions. CDRs in each chain are kept in close proximity by FRs and contribute to the formation of an antigen binding site of the antibody, together with CDRs of the other chain. At least two techniques are used for determining CDRs: (1) an approach based on sequence variability between different species (e.g., Kabat et al., Sequences of Proteins of Immunological Interest, (5th ed., 1991, National Institutes of Health, Bethesda Md.)); and (2) an approach based on crystallographic research on antigen-antibody complexes (Al-Lazikani et al., (1997) J. Molec. Biol. 273: 927-948)). The combination of these two approaches is sometimes used in the art for determining CDRs.
(40) The “constant region” of an antibody refers to antibody light chain or heavy chain constant regions each alone or in combination.
(41) The term epitope “specifically binding to” an antibody is fully understood in the art, and methods for determining specific binding are also well known in the art. When a molecule reacts or mutually acts with a particular cell or substance more frequently, more rapidly, for a longer duration, and/or with larger affinity as compared with its reaction or mutual action with other cells or substances, the molecule is regarded as exhibiting “specific binding”. When an antibody binds to a target with larger affinity or binding activity, more promptly, and/or for a longer duration as compared with its binding to other substances, the antibody “specifically binds to” the target. For example, an antibody specifically binding to one CD26 epitope is an antibody binding to this CD26 epitope with larger affinity or binding activity, more promptly, and/or for a longer duration as compared with its binding to other CD26 epitopes or non-CD26 epitopes. It should be understood from this definition that, for example, an antibody (or a moiety or an epitope) specifically binding to a first target may or may not specifically bind to a second target. Thus, the “specific binding” does not necessarily require (albeit can include) exclusive binding.
(42) The “host cell” includes each individual cell or a cell culture that may serve as a recipient of a vector for the incorporation of a polynucleotide insert, or has already been the recipient. The host cell includes a progeny of a single host cell. The progeny is not necessarily required to be identical to an original parent cell (morphologically or in genomic DNA complements) due to natural, accidental or planned mutation. The host cell includes a cell transfected in vivo with the polynucleotide of the present invention.
(43) The “isolated” antibody, antibody, polynucleotide, vector, cell, or composition is an antibody, an antibody, a polynucleotide, a vector, a cell, or a composition in a form that is not found naturally. The isolated antibody, antibody, polynucleotide, vector, cell, or composition includes that purified into a form no longer found naturally. In a certain embodiment, the isolated antibody, polynucleotide, vector, cell, or composition is substantially pure.
(44) The “treatment” used herein is an approach for obtaining beneficial or desired clinical results. The beneficial or desired clinical results for the object of the present invention include, but are not limited to, the alleviation of one or more symptoms, decrease in the extent of a disease, a stabilized (i.e., non-aggravated) state of the disease, delay or slowdown of disease progression, recovery from or remission of the disease state, and relief (partial or whole), regardless of being detectable or not detectable. The “treatment” also means increase in the life expectancy of a patient with respect to the potential life expectancy of the patient without the treatment.
(45) The “effective amount” is an amount sufficient for achieving beneficial or desired clinical results including clinical results. The effective amount can be administered at one or more dosages. The effective amount of an anti-CD26 antibody conjugate, an anti-CD26 antibody and an additional anticancer agent, or the like described herein for the object of the present invention is an amount sufficient for delaying the progression of a condition associated with tumor growth. As understood in the art, for example, the effective amount of the anti-CD26 antibody conjugate or the anti-CD26 antibody and the additional anticancer agent may vary according to or depend on, particularly, other factors such as the medical history of a patient and the type (and/or amount) of the anti-CD26 antibody conjugate or the additional anticancer agent used.
(46) The “pharmaceutically acceptable carrier” or the “pharmaceutically acceptable excipient” used herein includes any material that is capable of maintaining the biological activity of an active ingredient when combined with the active ingredient, is unreactive with the immune system of a test subject when delivered, and is nontoxic to the test subject. Examples thereof include, but are not limited to, every standard pharmaceutical carrier including phosphate-buffered saline, water, emulsions such as oil/water emulsions, and various types of humectants. A preferred diluent for spray administration or parenteral administration is phosphate-buffered saline or physiological saline (0.9%). A composition containing such a carrier is formulated by a well-known conventional method (see e.g., Remington's Pharmaceutical Sciences, 18th edition, A. Gennaro ed., Mack Publishing Co., Easton, Pa., 1990; and Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing, 2000).
(47) Anti-CD26 Antibody
(48) In a certain embodiment, the anti-CD26 antibody used herein specifically binds to human CD26. In a certain embodiment, the anti-CD26 antibody described herein binds to the same epitope as that for a mouse monoclonal antibody 14D10. In a certain embodiment, the anti-CD26 antibody described herein has the ability to block the binding of the mouse monoclonal antibody 14D10 to human CD26 (competes with the mouse monoclonal antibody 14D10) in competitive assay. In a certain embodiment, the anti-CD26 antibody described herein has the ability to block the binding of a mouse monoclonal antibody 1F7 to human CD26 (competes with the mouse monoclonal antibody 1F7) in competitive assay. The competitive assay can be performed by contacting a test antibody with an immobilized epitope or antigen, then washing off unbound antibodies, subsequently contacting a labeled 14D10 antibody or 1F7 antibody with the epitope or antigen, and washing off unbound antibodies, followed by the detection of the bound 14D10 antibody or 1F7 antibody. When the binding of the 14D10 antibody or the 1F7 antibody to the epitope or the antigen contacted with the test antibody is decreased as compared with the binding of the 14D10 antibody or the 1F7 antibody to a control epitope or antigen without contact with the test antibody, the test antibody can be confirmed to have the ability to block the binding of the 14D10 antibody or the 1F7 antibody (to compete with the 14D10 antibody or the 1F7 antibody) in the competitive assay.
(49) Examples of the binding affinity of the anti-CD26 antibody used herein for human CD26 include affinity having a dissociation constant (i.e., Kd) of less than 10.sup.−5 M, less than 5×10.sup.−5 M, less than 10.sup.−6 M, less than 5×10.sup.−7 M, less than 10.sup.−7 M, less than 5×10.sup.−8 M, less than 10.sup.−8 M, less than 5×10.sup.−9 M, less than 10.sup.−9 M, less than 5×10.sup.−10 M, less than 10.sup.−10 M, less than 5×10.sup.−11 M or less than 10.sup.−11 M. The dissociation constant may also be 10.sup.−15 M or more, 5×10.sup.−15 M or more, 10.sup.−14 M or more, 5×10.sup.−14 M or more, 10.sup.−13 M or more, 5×10.sup.−13 M or more, 10.sup.−12 M or more, 5×10.sup.−12 M or more, 10.sup.−11 M or more, 5×10.sup.−11 M or more, 10.sup.−10 M or more or 5×10.sup.−10 M or more. Methods for determining affinity are known in the art. The binding affinity may be determined using, for example, a BIAcore biosensor, a KinExA biosensor, scintillation proximity assay, ELISA, ORIGEN immunoassay (IGEN International, Inc.), fluorescence quenching, fluorescence transfer, and/or yeast display. The affinity may be screened using appropriate bioassay.
(50) One method for determining the binding affinity of an antibody against CD26 is the measurement of the affinity of a monofunctional Fab fragment of the antibody. To obtain the monofunctional Fab fragment, the antibody, for example, IgG, can be cleaved with papain or expressed by a recombination technique. The affinity of the anti-CD26 Fab fragment of a monoclonal antibody can be determined using a surface plasmon resonance (SPR) system (BIAcore 3000™, BIAcore Inc., Piscataway, N.J.). A SA (streptavidin) chip is used according to the supplier's instruction manual. Biotinylated CD26 can be diluted with HBS-EP (100 mM HEPES pH 7.4, 150 mM NaCl, 3 mM EDTA, 0.005% P20) and injected at a concentration of 0.005 mg/mL onto the chip. Two ranges of antigen density are achieved using a variable flow time across the individual chip channels: 10 to 20 response units (RU) for detailed kinetic tests and 500 to 600 RU for concentrations. A mixture of Pierce elution buffer solution and 4 M NaCl (2:1) effectively removes the bound Fab while keeping the activity of CD26 on the chip for 200 or more injections. A HBS-EP buffer solution can be used as a running buffer solution in all the BIAcore assays. Serial dilutions (0.1 to 10× estimated KD) of the purified Fab sample are injected at 100 μL/min for 2 minutes, and a dissociation time up to 30 minutes is usually acceptable. The concentration of the Fab protein can be determined by ELISA and/or SDS-PAGE electrophoresis using standard Fab having a known concentration (determined by amino acid analysis). An association rate (kon) and a dissociation rate (koff) of a reaction rate are obtained at the same time by using BlAevaluation program and fitting the data to a 1:1 Langmuir binding model (Lofas & Johnsson, 1990). An equilibrium dissociation constant (KD) value is calculated as koff/kon.
(51) In a certain embodiment, the present invention relates to an anti-CD26 antibody-triptolide conjugate or a pharmaceutical composition containing an anti-CD26 antibody and an additional anticancer agent, which inhibits the growth of CD26 expressing cells. The present invention also encompasses an embodiment in which the conjugate or the composition is useful in the treatment of a condition (disease or disorder, etc.) associated with CD26 expression, for example, malignant mesothelioma. In a certain embodiment, the conjugate or the composition of the present invention may have one or more features from: (a) binding to CD26, (b) regulating CD26 activity, (c) arresting the cell cycle of CD26+ cells at the G1/S checkpoint, (d) inhibiting the growth of cells expressing CD26 (e.g., malignant mesothelioma cells), (e) inhibiting the binding of CD26 to extracellular matrix, and/or (f) being useful in the treatment of a condition associated with CD26 expression. In a certain embodiment, the condition associated with CD26 expression is a disease or a disorder associated with overexpression of CD26. In a certain embodiment, the condition associated with CD26 expression is mediated at least partially by CD26. In a certain embodiment, the condition associated with CD26 expression is a condition associated with the growth of cells expressing CD26. In a certain embodiment, the disease or the disorder is a cancer (e.g., malignant mesothelioma, lung cancer, kidney cancer, liver cancer or other malignant tumors involving the expression of CD26).
(52) In a certain embodiment, the antibody contained in the conjugate or the composition of the present invention comprises both a heavy chain variable region comprising an amino acid sequence having at least approximately 80% identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 8 to 14, and a light chain variable region comprising an amino acid sequence having at least approximately 80% identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 to 7. In a certain embodiment, the antibody contained in the conjugate or the composition of the present invention comprises a light chain variable region comprising an amino acid sequence having at least approximately 80% identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 8 to 14, and a heavy chain variable region comprising an amino acid sequence having at least approximately 80% identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 to 7.
(53) In a certain embodiment, the antibody contained in the conjugate or the composition of the present invention comprises at least 5 consecutive amino acids, at least 8 consecutive amino acids, at least approximately 10 consecutive amino acids, at least approximately 15 consecutive amino acids, at least approximately 20 consecutive amino acids, at least approximately 30 consecutive amino acids, or at least approximately 50 consecutive amino acids of an amino acid sequence of any one of SEQ ID NOs: 1 to 14.
(54) The present invention further provides an anti-CD26 antibody-triptolide conjugate or a pharmaceutical composition containing an anti-CD26 antibody and an additional anticancer agent, which includes a fragment of the antibody sequence described herein (e.g., any one of SEQ ID NOs: 1 to 7, SEQ ID NOs: 8 to 14, SEQ ID NO: 15, and SEQ ID NO: 16). In a certain embodiment, the antibody includes a fragment of the antibody sequence described herein, having a length of at least approximately 50 amino acids, at least approximately 75 amino acids, or at least approximately 100 amino acids.
(55) TABLE-US-00001 SEQ ID NO: 15 EVQLVX1SGX2X3X4X5QPGX6X7LRLX8CX9ASGX10X11LX12TYGVH WVRQAPGKGLEWX13GVIWGX14GRTDYDX15X16FMSRVTISX17DX18 SKX191X20YLQX21NSLRAEDTAVYYCX22RX23RHDWFDYWGQGTTVT VSS
(56) In the sequence described above, X1 is E or Q, X2 is A or G, X3 is G or E, X4 is L or V, X5 is V, K, or E, X6 is G or E, X7 is T or S, X8 is T or S, X9 is T or K, X10 is F or Y, X11 is S or T, X12 is T, N, or S, X13 is V or M, X14 is G or D, X15 is A or S, X16 is A or S, X17 is K or R, X18 is N or T, X19 is S or N, X20 is V or A, X21 is M or L, X22 is V, M, or T, and X23 is N or S.
(57) TABLE-US-00002 SEQ ID NO: 16 XIIX2X3TQSPSSLSX4X5X6GX7RX8TIX9CX10ASQX11IRNX12LNW YQQKPGQAPRLLIYYSSNLX13X14GVPX15RFSGSGSGTDFTLTISRLX 16X17EDX18AX19YYCQQSX20KLPX21TFGSGTKVEIK
(58) In the sequence described above, X1 is D or E, X2 is L or E, X3 is M or L, X4 is A or V, X5 is S or T, X6 is L, P, or A, X7 is D or E, X8 is V or A, X9 is T or S, X10 is S or R, X11 is G or D, X12 is S or N, X13 is H or Q, X14 is S or T, X15 is S, D, or A, X16 is E or Q, X17 is P or A, X18 is F or V, X19 is T, A, or I, X20 is I or N, and X21 is F or L.
(59) Table 1 shows the amino acid sequences of humanized VL variants X376 (SEQ ID NO: 1), X377 (SEQ ID NO: 2), X378 (SEQ ID NO: 3), X379 (SEQ ID NO: 4), X380 (SEQ ID NO: 5), X381 (SEQ ID NO: 6), and X394 (SEQ ID NO: 7). The schemes with Kabat numbering and sequential numbering correspond to light chain variable regions. Table 1 shows that CM03 VL comprises CDRL1 (SEQ ID NO: 33), CDRL2 (SEQ ID NO: 34) and CDRL3 (SEQ ID NO: 35), and that humanized VL variant X379 comprises CDRL1 (SEQ ID NO: 39), CDRL2 (SEQ ID NO: 40) and CDRL3 (SEQ ID NO: 41).
(60) Table 2 show the amino acid sequences of and humanized VH variants X384 (SEQ ID NO: 8), X385 (SEQ ID NO: 9), X386 (SEQ ID NO: 10), X387 (SEQ ID NO: 11), X388 (SEQ ID NO: 12), X399 (SEQ ID NO: 13) and X420 (SEQ ID NO: 14). The table shows both sequential numbering and Kabat numbering schemes. The Kabat numbering scheme includes 82a, 82b, and 82c. Table 2 shows that CM03 VH comprises CDRH1 (SEQ ID NO: 30), CDRH2 (SEQ ID NO: 31) and CDRH3 (SEQ ID NO: 32), and that humanized VH variant X384 comprises CDRH1 (SEQ ID NO: 36), CDRH2 (SEQ ID NO: 37) and CDRH3 (SEQ ID NO: 38).
(61) TABLE-US-00003 Sequential Numbering 10 20 30 40 50 12345678901234567890123456789012345678901234567890123456 <---------FR1---------><--CDR1---><-----FR2-----><CDR2-> CMD3 VL DIQMTQSPSSLSASLGDRVTITCSASQGIRNSLNWYQQKPDGAVKLLIYYSSNLHS X376 DILMTQSPSSLSASPGDRVTISCRASQDIRNNLNWYQQKPGQAPRLLIYYSSNLHS X377 EIELTQSPSSLSVSLGDRVTISCSASQDIRNNLNWYQQKPGQAPRLLIYYSSNLQT X378 DIEMTQSPSSLSASAGERVTISCRASQGIRNSLNWYQQKPGQAPRLLIYYSSNLQT X379 DILLTQSPSSLSATPGERATITCRASQGIRNNLNWYQQKPGQAPRLLIYYSSNLQS X380 EIEMTQSPSSLSVSAGERATISCSASQDIRNSLNWYQQKPGQAPRLLIYYSSNLHT X381 EIELTQSPSSLSVSPGDRVTISCSASQGIRNSLNWYQQKPGQAPRLLIYYSSNLHT X394 DILMTQSPSSLSASPGDRVTISCRASQDIRNNLNWYQQKPGQAPRLLIYYSSNLQT Kabat Numbering 24 34 50 56 (same as sequential numbering; no insertion) Sequential Numbering 60 70 80 90 100 789012345678901234567890123456789012345678901234567 <-------------FR3--------------><-CDR3--><--FR4---> CMD3 VL GVPSRFSGSGSGTDFSLTISNLRPEDIATYYCQQSIKLPFTFGSGTKLEIK X376 GVPDRFSGSGSGTDFTLTISRLEPEDFAAYYCQQSIKLPLTFGSGTKVEIK X377 GVPARFSGSGSGTDFTLTISRLEPEDVAAYYCQQSIKLPFTFGSGTKVEIK X378 GVPSRFSGSGSGTDFTLTISRLQAEDFATYYCQQSNKLPFTFGSGTKVEIK X379 GVPSRFSGSGSGTDFTLTISRLQPEDVAAYYCQQSIKLPFTFGSGTKVEIK X380 GVPARFSGSGSGTDFTLTISRLEPEDVAIYYCQQSNKLPLTFGSGTKVEIK X381 GVPARFSGSGSGTDFTLTISRLQAEDFATYYCQQSIKLPLTFGSGTKVEIK X394 GVPARGSGSGSGTDFTLTISRLEPEDFAAYYCQQSIKLPLTFGEGTKVEIK Kabat Numbering 89 97 (same as sequential numbering; no insertion)
(62) TABLE-US-00004 Sequential Numbering 10 20 30 40 50 60 12345678901234567890123456789012345678901234567890123456789012345 <----------FR1----------><--CDR1--><----FR2-----><----CDR2------> CMD3 VH QVKLQKSGPGLVQPSQTLSITCTVSGFSLTTYGVHVWRQSPGKGLEWLGVIWGGGRTDYDAAFIS X384 EVQLVESGAGVKQPGGTLRLTCTASGFSLTTYGVHWVRQAPGKGLEWVGVIWGDGRTDYDAAFMS X385 EVQLVQSGGGVKQPGETLRLTCTASGFSLTTYGVHWVRQAPGKGLEWVGVIWGDGRTDYDAAFMS X386 EVQLVESGAGVEQPGGTLRLTCTASGFSLTTYGVHWVRQAPGKGLEWMGVIWGDGRTDYDAAFMS X387 EVQLVESGAELVQPGGSLRLTCKASGFTLNTYGVHWVRQAPGKGLEWMGVIWGGGRTDYDASFMS X388 EVQLVQSGGGLKQPGETLRLSCTASGYSLTTYGVHWVRQAPGKGLEWMGVIWGDGRTDYDSSFMS X399 EVQLVQSGGGVKQPGETLRLTCTASGFSLSTYGVHWVRQAPGKGLEWVGVIWGDGRTDYDAAFMS X420 EVQLVESGGGVKQPGETLRLTCTASGFSLSTYGVHWVRQAPGKGLEWVGVIWGDGRTDYDAAFMS Kabat Numbering 26 35 50 65 Sequential Numbering 70 80 90 100 110 678901234567890123456789012345678901234567890123456 <-------------FR3--------------><-CDR3--><--FR4---> CMD3 VH RLSISKDNSKSQVFFKMNSLQANDTAIYYCVRNRHDWFDYWGQGTTVTVSS X384 RVTISKDTSKSTVYLQMNSLRAEDTAVYYCMRNRHDWFDYWGQGTTVTVSS X385 RVTISKDTSKSTAYLQMNSLRAEDTAVYYCMRNRHDWFDYWGQGTTVTVSS X386 RVTISRDTSKSTAYLQLNSLRAEDTAVYYCVRNRHDWFDYWGQGTTVTVSS X387 RVTISKDNSKNTAYLQLNSLRAEDTAVYYCTRSRHDWFDYWGQGTTVTVSS X388 RVTISKDTSKSTAYLQLMSLRAEDTAVYYCTRNRHDWFDYWGQGTTVTVSS X399 RVTISKDTSKSTVYLQMNSLRAEDTAVYYCMRNRHDWFDYWGQGTTVTVSS X420 RVTISKDTSKSTVYLQMNSLRAEDTAVYYCMRNRHDWFDYWGQGTTVTVSS Kabat Numbering abc3456789012345678901234567890123 82 90 100 110 95 102
(63) The antibody may further comprise the amino acid sequence of SEQ ID NO: 17 or a fragment or a variant thereof. In a certain embodiment, the antibody comprises the amino acid sequence of SEQ ID NO: 17. In a certain embodiment, the antibody comprises the amino acid sequence of SEQ ID NO: 17 except for a signal sequence (those skilled in the art will readily understand that in a certain embodiment, the signal sequence of the antibody is cleaved off from the antibody). In a certain embodiment, the antibody comprises a variable region in the amino acid sequence of SEQ ID NO: 17. In a certain embodiment, the antibody includes an antibody (or a fragment thereof) having at least approximately 80%, at least approximately 85%, at least approximately 90%, at least approximately 95%, or at least approximately 98% identity to the amino acid sequence of SEQ ID NO: 17. In a certain embodiment, the antibody includes a fragment of the amino acid sequence of SEQ ID NO: 17, having a length of at least approximately 10 amino acids, at least approximately 25 amino acids, at least approximately 50 amino acids, at least approximately 75 amino acids, or at least approximately 100 amino acids. In a certain embodiment, the antibody binds to human CD26.
(64) TABLE-US-00005 Heavy chain (SEQ ID NO: 17) MEWSWVFLFFLSVTTGVHSEVQLVESGAGVKQPGGTLRLTCTASGFSLTT YGVHWVRQAPGKGLEWVGVIWGDGRTDYDAAFMSRVTISKDTSKSTVYLQ MNSLRAEDTAVYYCMRNRHDWFDYWGQGTTVTVSSASTKGPSVFPLAPSS KSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPI EKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWE SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL HNHYTQKSLSLSPGK
(65) The antibody further comprises the amino acid sequence of SEQ ID NO: 18 or a fragment or a variant thereof. In a certain embodiment, the antibody comprises the amino acid sequence of SEQ ID NO: 18. In a certain embodiment, the antibody comprises the amino acid sequence of SEQ ID NO: 18 except for a signal sequence (those skilled in the art will readily understand that in a certain embodiment, the signal sequence of the antibody is cleaved off from the antibody). In a certain embodiment, the antibody comprises a variable region in the amino acid sequence of SEQ ID NO: 18. In a certain embodiment, the antibody includes an antibody (or a fragment thereof) having at least approximately 80%, at least approximately 85%, at least approximately 90%, at least approximately 95%, or at least approximately 98% identity to the amino acid sequence of SEQ ID NO: 18. In a certain embodiment, the antibody includes a fragment of the amino acid sequence of SEQ ID NO: 18, having a length of at least approximately 10 amino acids, at least approximately 25 amino acids, at least approximately 50 amino acids, at least approximately 75 amino acids, or at least approximately 100 amino acids. In a certain embodiment, the antibody further comprises the amino acid sequence of SEQ ID NO: 18 or a fragment or a variant thereof. In a certain embodiment, the antibody binds to human CD26. In a certain embodiment, the antibody is, for example, an antibody comprising at least one heavy chain (e.g., two heavy chains each) comprising the amino acid sequence of SEQ ID NO: 17 except for a signal sequence, and at least one light chain (e.g., two light chains each) comprising the amino acid sequence of SEQ ID NO: 18 except for a signal sequence.
(66) TABLE-US-00006 Light chain (SEQ ID NO: 18) MSVPTQVLGLLLLWLTDARCDILLTQSPSSLSATPGERATITCRASQGIR NNLNWYQQKPGQAPRLLIYYSSNLQSGVPSRFSGSGSGTDFTLTISRLQP EDVAAYYCQQSIKLPFTFGSGTKVEIKRTVAAPSVFIFPPSDEQLKSGTA SVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(67) The humanized anti-CD26 antibody “YS110” described herein means an antibody whose heavy chain constant region consists of an amino acid sequence described in SEQ ID NO: 17, and light chain constant region consists of an amino acid sequence described in SEQ ID NO: 18. Upon binding to CD26 on a malignant tumor cell membrane, YS110 has been reported to be taken up into the cell and further transferred into the nucleus (Yamada K et al., Plos One, 2013 Apr. 29; 8 (4): e62304). More specifically, YS110 is considered to be taken up into the cytoplasm by caveolin-dependent endocytosis and transported into the nucleus by early endocytic vesicles. Accordingly, in one aspect, the antitumor effect (e.g., therapeutic effect on mesothelioma) of a YS110-triptolide conjugate may be based on such action of YS110. Specifically, the anti-CD26 antibody of the present invention may be an antibody that is, upon binding to CD26 on a malignant tumor cell membrane, taken up into the cell and further transferred into the nucleus. Whether or not the antibody is, upon binding to CD26 on a malignant tumor cell membrane, taken up into the cell and further transferred into the nucleus can be determined by contacting a labeled antibody with cells, then detecting a position of the antibody based on the label under a microscope or the like, and determining the positional relationship between the position and intracellular organization.
(68) In another aspect, the antibody binds to one or more peptides selected from the group consisting of YSLRWISDHEYLY (SEQ ID NO: 19; peptide 6), LEYNYVKQWRHSY (SEQ ID NO: 20; peptide 35), TWSPVGHKLAYVW (SEQ ID NO: 21; peptide 55), LWWSPNGTFLAYA (SEQ ID NO: 22; peptide 84), RISLQWLRRIQNY (SEQ ID NO: 23; peptide 132), YVKQWRHSYTASY (SEQ ID NO: 24; peptide 37), EEEVFSAYSALWW (SEQ ID NO: 25; peptide 79), DYSISPDGQFILL (SEQ ID NO: 26; peptide 29), SISPDGQFILLEY (SEQ ID NO: 27; peptide 30), and IYVKIEPNLPSYR (SEQ ID NO: 28; peptide 63). In a certain embodiment, the antibody specifically binds to one or more of the peptides described above. These peptides are regions of human CD26. In a certain embodiment, the antibody specifically binds to one or more peptides selected from the group consisting of YSLRWISDHEYLY (SEQ ID NO: 19; peptide 6), LEYNYVKQWRHSY (SEQ ID NO: 20; peptide 35), TWSPVGHKLAYVW (SEQ ID NO: 21; peptide 55), LWWSPNGTFLAYA (SEQ ID NO: 22; peptide 84), RISLQWLRRIQNY (SEQ ID NO: 23; peptide 132), YVKQWRHSYTASY (SEQ ID NO: 24; peptide 37), EEEVFSAYSALWW (SEQ ID NO: 25; peptide 79), DYSISPDGQFILL (SEQ ID NO: 26; peptide 29), SISPDGQFILLEY (SEQ ID NO: 27; peptide 30), and IYVKIEPNLPSYR (SEQ ID NO: 28; peptide 63) as compared with one or more peptides corresponding to other regions of human CD26.
(69) In a certain embodiment, the antibody binds to each of the following peptides: YSLRWISDHEYLY (SEQ ID NO: 19; peptide 6); LEYNYVKQWRHSY (SEQ ID NO: 20; peptide 35); TWSPVGHKLAYVW (SEQ ID NO: 21; peptide 55); LWWSPNGTFLAYA (SEQ ID NO: 22; peptide 84); and RISLQWLRRIQNY (SEQ ID NO: 23; peptide 132). In a certain alternative embodiment, the antibody binds to each of the following peptides: YSLRWISDHEYLY (SEQ ID NO: 19; peptide 6); TWSPVGHKLAYVW (SEQ ID NO: 21; peptide 55); RISLQWLRRIQNY (SEQ ID NO: 23; peptide 132); YVKQWRHSYTASY (SEQ ID NO: 24; peptide 37); and EEEVFSAYSALWW (SEQ ID NO: 25; peptide 79). In a certain embodiment, the antibody binds to each of the following peptides: DYSISPDGQFILL (SEQ ID NO: 26; peptide 29); SISPDGQFILLEY (SEQ ID NO: 27; peptide 30); and TWSPVGHKLAYVW (SEQ ID NO: 21; peptide 55). In a certain alternative embodiment, the antibody binds to each of the following peptides: DYSISPDGQFILL (SEQ ID NO: 26; peptide 29); SISPDGQFILLEY (SEQ ID NO: 27; peptide 30); TWSPVGHKLAYVW (SEQ ID NO: 21; peptide 55); and IYVKIEPNLPSYR (SEQ ID NO: 28; peptide 63).
(70) Whether two antibodies bind to the same epitope by recognizing identical or sterically overlapping epitopes can be determined by competitive assay. Usually, an antigen is immobilized on a multiwell plate, and the blocking performance of an unlabeled antibody against the binding of a labeled antibody is measured. A general label for such competitive assay is a radiolabel or an enzyme label. The epitope to which the antibody binds can be determined by an epitope mapping technique known to those skilled in the art.
(71) In a certain embodiment, the antibody comprises one or more constant regions. In a certain embodiment, the antibody comprises a human constant region. In a certain embodiment, the constant region is a heavy chain constant region. In an alternative embodiment, the constant region is a light chain constant region. In a certain embodiment, the antibody comprises a constant region having at least approximately 80%, at least approximately 85%, at least approximately 90%, at least approximately 95%, at least approximately 98%, or 100% identity to a human constant region. In a certain embodiment, the antibody comprises a Fc region. In a certain embodiment, the antibody comprises a human Fc region. In a certain embodiment, the antibody comprises a Fc region having at least approximately 80%, at least approximately 85%, at least approximately 90%, at least approximately 95%, at least approximately 98%, or 100% identity to a human Fc region.
(72) In a certain embodiment, the antibody is an IgG antibody. In a certain embodiment, the antibody is an IgG1 antibody. In an alternative embodiment, the antibody is an IgG2 antibody. In a certain embodiment, the antibody is a human IgG antibody.
(73) The antibody may be an antibody in monomeric, dimeric, and multimeric forms. For example, a bispecific antibody or a monoclonal antibody having binding specificity for at least two different antigens can be prepared using the antibody disclosed herein (see e.g., Suresh et al., Methods in Enzymology, 1986, 121, 210). Heretofore, the recombinant production of the bispecific antibody has been based on the coexpression of two immunoglobulin heavy chain-light chain pairs comprising two heavy chains differing in specificity (Millstein, Cuello, Nature, 1983, 305, 537-539).
(74) According to one approach for preparing the bispecific antibody, antibody variable regions (antigen binding sites of the antibody) having the desired binding specificity are fused with immunoglobulin constant regions. Preferably, the fusion sites involve an immunoglobulin heavy chain constant region including at least moieties of a hinge and CH2 and CH3 regions. At least one fusion site preferably has the first heavy chain constant region (CH1) containing a site essential for the binding of a light chain. DNAs encoding the immunoglobulin heavy chain fusions and, if desired, DNA encoding an immunoglobulin light chain are inserted to separate expression vectors, with which an appropriate host organism is then cotransfected. In an embodiment in which unequal ratios of the three antibody chains used in the construction provide the optimum yield, it is possible to adjust the mutual proportions of these three antibody chains with high flexibility. If the expression of at least two antibody chains at equal ratios results in high yields or if the ratios are not particularly important, the coding sequences for two or all three antibody chains may be inserted to one expression vector.
(75) One example of the approach includes a bispecific antibody constituted by a hybrid immunoglobulin heavy chain having first binding specificity in one of the arms, and a hybrid heavy chain-light chain pair (having second binding specificity) in the other arm. This asymmetric structure (having an immunoglobulin light chain only in one half-antibody moiety of the bispecific antibody molecule) facilitates separating the desired bispecific compound from undesired immunoglobulin chain combinations. This approach is described in International Publication No. WO94/04690 published on Mar. 3, 1994.
(76) A heteroconjugate antibody comprising two covalently attached antibodies is also included in the scope of the antibody. Such an antibody is used for targeting cells of the immune system to unnecessary cells (U.S. Pat. No. 4,676,980) or for treating HIV infection (International Publication Nos. WO91/00360 and WO92/200373, and European Patent No. 03089). The heteroconjugate antibody may be prepared using any convenient cross-linking method. Appropriate cross-linking agents and cross-linking techniques are well known in the art and are described in U.S. Pat. No. 4,676,980.
(77) In a particular embodiment, the antibody is an antibody fragment. In a certain embodiment, the antibody is selected from the group consisting of, for example, Fab, Fab′, Fab′-SH, Fv, scFv, and F(ab′)2. In a certain embodiment, the antibody is Fab. Various techniques have been developed for antibody fragment production. These fragments can be obtained via the protein digestion of a complete antibody (see e.g., Morimoto et al., 1992, J. Biochem. Biophys. Methods 24: 107-117; and Brennan et al., 1985, Science 229: 81), or can also be produced directly from recombinant host cells. For example, Fab′-SH fragments can be recovered directly from E. coli and chemically bound to form a F(ab′)2 fragment (Carter et al., 1992, Bio/Technology 10: 163-167). In an alternative embodiment, F(ab′)2 is formed using leucine zipper GCN4 which promotes the assembly of F(ab′)2 molecules. According to an alternative approach, the Fv, Fab, or F(ab′)2 fragment is isolated directly from recombinant host cell culture.
(78) In a certain embodiment, the antibody is a single-chain variable fragment (scFv) thereof, a variant, a fusion protein containing an antibody moiety, a humanized antibody, a chimeric antibody, a diabody, a linear antibody, a single-chain antibody, or any other immunoglobulin molecule having a modified configuration.
(79) The single-chain variable fragment is prepared by linking light chain and/or heavy chain variable regions using a short linker peptide (Bird et al., (1988) Science 242: 423-426). The linker peptide is, for example, (GGGGS)3 (SEQ ID NO: 29) which cross-links approximately 3.5 nm between the carboxy terminus of one of the variable regions and the amino terminus of the other variable region. Linkers having other sequences are also designed and used (Bird et al., (1988)). The linker can then be modified for additional functions such as immobilization of a drug or immobilization on a solid carrier. The single-chain variant can be produced by any recombination technique or synthesis technique. In the scFv production by a synthesis technique, an automatic synthesizer can be used. In the scFv production by a recombination technique, an appropriate plasmid containing a polynucleotide encoding scFv can be transferred to appropriate host cells either eukaryotic (e.g., yeast cells, plant cells, insect cells or mammalian cells) or prokaryotic (E. coli). The polynucleotide encoding the scFv of interest can be prepared by a routine operation such as polynucleotide ligation. The resulting scFv can be isolated using a standard protein purification technique known in the art.
(80) Other forms of single-chain antibodies, such as a diabody, are also encompassed in the antibody. The diabody is a bivalent bispecific antibody whose VH and VL domains are expressed on a single antibody chain but forced to pair with complementary domains of another chain using a linker too short to pair these VH and VL domains on the same chain, thereby creating two antigen binding sites (see e.g., Holliger, P. et al., (1993) Proc. Natl. Acad. Sci. USA 90: 6444-6448; and Poljak, R. J. et al., (1994) Structure 2: 1121-1123).
(81) The antibody encompasses a modified form of the antibody described herein. Examples of such a modified form include functionally equivalent antibodies without markedly affecting the properties of the antibody, and variants having potentiated or attenuated activity. The antibody modification is a routine operation in the art and needs not be described in detail herein. Examples of the modified antibody include antibodies involving the conservative substitution of amino acid residues, the deletion or addition of one or more amino acids without markedly deteriorating functional activity, or use of chemical analogs.
(82) Insertion or addition to an amino acid sequence includes amino- and/or carboxyl-terminal fusion ranging in length from 1 residue to an antibody containing 100 or more residues, and the intrasequence insertion of single or multiple amino acid residues. Examples of terminal insertion variants include an antibody having a N-terminal methionyl residue or an antibody fused with an epitope tag. Other insertion variants of the antibody molecule include an antibody N- or C-terminally fused with an enzyme or an antibody increasing the serum half-life of the antibody.
(83) The substitution variant has a different residue inserted in place of at least one amino acid residue removed from the antibody sequence. CDRs are included in sites that get the most out of substitution mutagenesis, though FR alterations are also contemplated. The conservative substitution is shown in Table 3 under the heading of “conservative substitution”. Such substitution that changes biological activity is designated as “exemplary substitution” in Table 3, or more substantial change, as further described below about amino acid classes, may be introduced and products may be screened.
(84) TABLE-US-00007 TABLE 3 Amino acid substitution Original residue Conservative substitution Exemplary substitution Ala (A) Val Val; Leu; Ile Arg (R) Lys Lys; Gln; Asn Asn (N) Gln Gln; His; Asp, Lys; Arg Asp (D) Glu Glu; Asn Cys (C) Ser Ser; Ala Gln (Q) Asn Asn; Glu Glu (E) Asp Asp; Gln Gly (G) Ala Ala His (H) Arg Asn; Gln; Lys; Arg Ile (I) Leu Leu; Val; Met; Ala; Phe; Norleucine Leu (L) Ile Norleucine; Ile; Val; Met; Ala; Phe Lys (K) Arg Arg; Gln; Asn Met (M) Leu Leu; Phe; Ile Phe (F) Tyr Leu; Val; Ile; Ala; Tyr Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Ser Ser Trp (W) Tyr Tyr; Phe Tyr (Y) Phe Trp; Phe; Thr; Ser Val (V) Leu Ile; Leu; Met; Phe; Ala; Norleucine
(85) Substantial modification in the biological properties of the antibody is achieved by selecting a substitution that significantly changes the effect of the modification on the maintenance of (a) the structure of the antibody backbone at a substitution region, for example, a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain. Naturally occurring residues are classified into the following groups based on general side chain properties:
(86) (1) hydrophobic: norleucine, Met, Ala, Val, Leu, and Ile;
(87) (2) neural hydrophilic: Cys, Ser, and Thr;
(88) (3) acidic: Asp and Glu;
(89) (4) basic: Asn, Gln, His, Lys, and Arg;
(90) (5) residues influencing chain orientation: Gly and Pro; and
(91) (6) aromatic: Trp, Tyr, and Phe.
(92) Non-conservative substitution is accomplished by exchanging a member of one of these classes for a member of another class. More conservative substitution includes exchange of one member of a certain class for another member of this class.
(93) Any cysteine residue that is not involved in the maintenance of the appropriate conformation of the antibody can be substituted, usually by serine, to thereby improve the oxidative stability of the molecule and prevent abnormal cross-linking. Particularly, when the antibody is an antibody fragment such as a Fv fragment, a cysteine bond can be added to the antibody to thereby improve the stability of the antibody.
(94) The amino acid modification ranges from change or modification in one or more amino acids to the complete redesign of a region such as a variable region. Change in a variable region can change binding affinity and/or specificity. In a certain embodiment, 1 to 5 or less amino acids are conservatively substituted within a CDR domain. In an alternative embodiment, 1 to 3 or less amino acids are conservatively substituted within a CDR3 domain. In a further alternative embodiment, the CDR domain is CDRH3 and/or CDRL3.
(95) The modified antibody also includes glycosylated and nonglycosylated antibodies and antibodies having other posttranslational modifications, for example, glycosylation with different sugars, acetylation, and phosphorylation. Antibodies are glycosylated at conserved positions in their constant regions (Jefferis and Lund, 1997, Chem. Immunol. 65: 111-128; and Wright and Morrison, 1997, TibTECH 15: 26-32). The oligosaccharide side chains of immunoglobulins influence protein functions (Boyd et al., 1996, Mol. Immunol. 32: 1311-1318; and Wittwe and Howard, 1990, Biochem. 29: 4175-4180) and the intramolecular mutual action between moieties of a glycoprotein, which may influence the conformation and presented three-dimensional surface structure of the glycoprotein (Hefferis and Lund, supra; and Wyss and Wagner, 1996, Current Opin. Biotech. 7: 409-416). Given glycoproteins may target certain molecules based on specific recognition structures via oligosaccharides. Antibody glycosylation has also been reported to influence antibody-dependent cellular cytotoxicity (ADCC). Particularly, CHO cells expressing β(1,4)-N-acetylglucosaminyltransferase III (GnTIII), a glycosyltransferase catalyzing the formation of bisecting GlcNAc, under the control of tetracycline have been reported to exhibit improved ADCC activity (Umana et al., 1999, Nature Biotech. 17:176-180).
(96) The antibody glycosylation is usually either N-linked or O-linked. The N-linked glycosylation means the attachment of a carbohydrate moiety to the side chain of an asparagine residue. Tripeptide sequences asparagine-X-serine, asparagine-X-threonine, and asparagine-X-cysteine (wherein X is any amino acid other than proline) are recognition sequences for enzymatically adding a carbohydrate moiety to the asparagine side chain. Thus, any of these tripeptide sequences present in the antibody creates a potential glycosylation site. The O-linked glycosylation means the attachment of one of the carbohydrates N-acetylgalactosamine, galactose, and xylose to a hydroxyamino acid, most generally serine or threonine, though 5-hydroxyproline or 5-hydroxylysine may be used.
(97) The addition of the glycosylation site to the antibody is conveniently achieved by altering the amino acid sequence such that the antibody contains one or more of the tripeptide sequences described above (for a N-linked glycosylation site). The alteration may also be accomplished by the addition of or substitution by one or more serine or threonine residues to the sequence of the original antibody (for an O-linked glycosylation site).
(98) The glycosylation pattern of the antibody may also be altered without altering the fundamental nucleotide sequence. The glycosylation depends largely on host cells used for expressing the antibody. Since the type of cells used for expression of a recombinant glycoprotein, for example, an antibody, is rarely natural cells because of a possible treatment method, the diverse glycosylation patterns of the antibody can be predicted (see, e.g. Hse et al., 1997, J. Biol. Chem. 272: 9062-9070).
(99) In addition to the selection of host cells, factors that influence glycosylation during the recombinant production of the antibody include the mode of growth, medium formulation, culture density, oxygenation, pH, purification schemes, etc. Various methods have been proposed to alter the glycosylation pattern achieved in particular host organisms and involve introducing or overexpressing particular enzymes involved in oligosaccharide production (U.S. Pat. Nos. 5,047,335, 5,510,261, and 5,278,299). The glycosylation or a particular type of glycosylation can be removed from the glycoprotein using an enzyme, for example, endoglycosidase H (EndoH). Recombinant host cells can be genetically altered to be defective in the processing of a particular type of polysaccharide. These and similar techniques are well known in the art.
(100) Other methods for the modification include use of a coupling technique known in the art. Examples of such a technique include, but are not limited to, enzymatic approaches, oxidative substitution and chelation. For example, a label for immunoassay can be added to the antibody using the modification. The modified antibody is prepared using procedures established in the art and can be screened using standard assay known in the art. Some methods therefor are described below and in Examples.
(101) Other modified antibodies include antibodies modified as described in International Publication No. WO99/58572 published on Nov. 18, 1999. These antibodies comprise a binding domain directed to the target molecule as well as an effector domain having an amino acid sequence substantially homologous to the whole or a portion of human immunoglobulin heavy chain constant domains. These antibodies have the ability to bind to the target molecule without causing marked complement-dependent lysis or cell-mediated destruction of the target. In a certain embodiment, the effector domain can specifically bind to FcRn and/or FcγRIIb. These are usually based on chimeric domains derived from two or more human immunoglobulin heavy chain CH2 domains. The antibodies thus modified are particularly suitable for use in chronic antibody therapy and avoid inflammatory and other harmful reactions to conventional antibody therapy.
(102) The antibody includes an affinity-matured form. The affinity-matured antibody can be produced by, for example, a method known in the art (Marks et al., 1992, Bio/Technology, 10: 779-783; Barbas et al., 1994, Proc Nat. Acad. Sci, USA 91: 3809-3813; Schier et al., 1995, Gene, 169: 147-155; Yelton et al., 1995, J. Immunol., 155: 1994-2004; Jackson et al., 1995, J. Immunol., 154 (7): 3310-9; Hawkins et al., 1992, J. Mol. Biol., 226:889-896; and International Publication No. WO2004/058184). An affinity-matured antibody candidate can be screened for or selected based on improved and/or altered binding affinity by any method known in the art including any selection method known in the art including a screening method using BIAcore surface plasmon resonance analysis, phage display, yeast display, and ribosome display.
(103) The monoclonal antibody may be prepared by a hybridoma method as described in Kohler and Milstein, 1975, Nature 256: 495. In the hybridoma method, mice, hamsters, or other appropriate host animals are usually immunized with an immunizing agent to thereby induce lymphocytes producing or capable of producing antibodies specifically binding to the immunizing agent. Alternatively, lymphocytes may be immunized in vitro.
(104) The monoclonal antibody (and other antibodies) may also be prepared by a recombinant DNA method as described in U.S. Pat. No. 4,816,567. DNA encoding the monoclonal antibody is isolated and sequenced by conventional methods such as use of an oligonucleotide probe that can specifically bind to a gene encoding the heavy chain or the light chain of the monoclonal antibody. The DNA thus isolated is inserted to an expression vector, with which host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells which do not produce immunoglobulin proteins without the transfer of the expression vector are then transfected to thereby achieve monoclonal antibody synthesis in the recombinant host cells.
(105) In a certain embodiment, the antibody is expressed in any organism including, but is not limited to, bacteria, yeasts, plants, insects, and mammals, or cells derived from any organism. The particular type of the cells includes, but is not limited to, Drosophila melanogaster cells, cells of Saccharomyces cerevisiae and other yeasts, E. coli cells, Bacillus subtilis cells, SF9 cells, HEK-293 cells, cells of Neurospora, BHK cells, CHO cells, COS cells, Hela cells, fibroblasts, schwannoma cell lines, immortalized mammalian myeloid and lymphoid cell lines, Jurkat cells, mast cells and other endocrine and exocrine cells, and neuronal cells.
(106) Various protein expression systems, vectors, and cell media useful in antibody production are known to those skilled in the art. See, for example, International Publication Nos. WO03/054172, WO04/009823, and WO03/064630, all of which are incorporated herein by reference in their entirety. In a certain embodiment, a glutamine synthetase (GS) expression system is used in the expression of the antibody.
(107) Preferably, the antibody thus expressed is purified or isolated according to a method known to those skilled in the art. Examples of the purification method include electrophoretic, molecular biological, immunological and chromatographic approaches. Examples of such approaches include ion-exchange, hydrophobic affinity, reverse-phase HPLC chromatography, and isoelectric focusing. The necessary degree of purification may vary depending on the purpose of the antibody. Depending on embodiments, purification is unnecessary.
(108) The DNA may be modified, for example, by covalently linking the whole or a portion of the coding sequence of a non-immunoglobulin antibody to the immunoglobulin coding sequence. In this way, a “chimeric” or “hybrid” antibody having the binding specificity of the monoclonal antibody disclosed herein is prepared. Usually, such a non-immunoglobulin antibody is substituted by the constant domains of the antibody of the present invention or substituted by the variable domains of one antigen binding site of the antibody of the present invention to thereby create a chimeric bivalent antibody comprising one antigen binding site having specificity for one surface epitope on CD26 and another antigen binding site having specificity for a different antigen or CD26 epitope.
(109) The antibody also encompasses a humanized antibody. Therapeutic antibodies often induce adverse reactions, partly because of inducing immune response to the administered antibodies. This may result in reduction in drug efficacy, decrease in the number of cells having the target antigen, and undesirable inflammatory reaction. To circumvent these problems, a recombinant anti-CD26 humanized antibody may be prepared. The general principles of antibody humanization involve maintaining the basic sequence of the antigen binding moiety of the antibody, while swapping at least a portion of the nonhuman remainder of the antibody with a human antibody sequence. Four general conventional steps for monoclonal antibody humanization include, but are not limited to: (1) determining nucleotide sequences encoding the light chain and heavy chain variable domains of a starting antibody, and their putative amino acid sequences, (2) designing a humanized antibody, i.e., determining antibody framework regions or residues and/or CDR residues to be used in the humanization process, (3) an actual humanization methodology/technique, and (4) transfection and expression of the humanized antibody. The constant regions of the antibody for use in clinical trials and treatment in humans can also be rendered more analogous to human constant regions by a recombination technique to avoid immune response. See, for example, U.S. Pat. Nos. 5,997,867 and 5,866,692.
(110) A Fcγ moiety in a recombinant humanized antibody can be modified to thereby avoid mutual action with a Fcγ receptor and the complement immune system. Such an antibody preparation technique is described in International Publication No. WO99/58572.
(111) Many “humanized” antibody molecules comprising a nonhuman immunoglobulin-derived antigen binding site have been reported. Examples thereof include rodent V regions and their associated complementarity determining regions (CDRs) fused with human constant domains. See, for example, Winter et al., Nature 349: 293-299 (1991); Lobuglio et al., Proc. Nat. Acad. Sci. USA 86: 4220-4224 (1989); Shaw et al., J Immunol. 138: 4534-4538 (1987); and Brown et al., Cancer Res. 47: 3577-3583 (1987). Other references describe rodent CDRs grafted into human supporting framework regions (FRs) before fusion with appropriate human antibody constant domains. See, for example, Riechmann et al., Nature 332: 323-327 (1988); Verhoeyen et al., Science 239: 1534-1536 (1988); and Jones et al., Nature 321: 522-525 (1986). Another reference describes rodent CDRs supported by recombinantly veneered rodent framework regions. See, for example, European Patent Publication No. 519,596. These types of “humanized” molecules are designed to minimize unnecessary immunological response to rodent anti-human antibody molecules, which limits the therapeutic application period and efficacy of the moieties in human recipients. Other antibody humanization methods that may be used are disclosed in Daugherty et al., Nucl. Acids Res., 19: 2471-2476 (1991) and U.S. Pat. Nos. 6,180,377, 6,054,297, 5,997,867, 5,866,692, 6,210,671, and 6,350,861, and International Publication No. WO01/27160.
(112) Further exemplary methods for the antibody humanization are described in International Publication No. WO02/084277 and U.S. Patent Publication No. 2004/0,133,357, both of which are incorporated herein by reference in their entirety.
(113) Still alternatively, a fully human antibody can be obtained using commercially available mice engineered to express specific human immunoglobulin proteins. Transgenic animals designed to produce more desirable (e.g., fully human antibody) or more robust immune response may also be used in humanized or human antibody preparation. Examples of such a technique include Xenomouse™ from Abgenix Inc. (Fremont, Calif.) and HuMAb-Mouse® and TC Mouse™ from Medarex, Inc. (Princeton, N.J.).
(114) Alternatively, the antibody may be recombinantly prepared by a phage display technique. See, for example, U.S. Pat. Nos. 5,565,332, 5,580,717, 5,733,743 and 6,265,150; and Winter et al., Annu. Rev. Immunol. 12: 433-455 (1994). Alternatively, the phage display technique (McCafferty et al., Nature 348: 552-553 (1990)) can be used for producing human antibodies and human antibody fragments in vitro from immunoglobulin variable (V) domain gene repertoires from unimmunized donors. According to this technique, antibody V domain genes are cloned in frame into major or minor coat protein genes of filamentous bacteriophages, such as M13 or fd, and displayed as functional antibody fragments on the surface of the phage particles. Because the filamentous particles contain a single-stranded DNA copy of the phage genome, antibody selection based on functional properties also leads to the selection of genes encoding antibodies exhibiting these properties. Thus, the phages mimic some of the properties of B cells. The phage display can be carried out in various formats. For review, see, for example, Johnson, Kevin S. and Chiswell, David J., Current Opinion in Structural Biology 3, 564-571 (1993). A plurality of sources of V gene segments can be used in the phage display.
(115) Clackson et al. (Nature 352: 624-628 (1991)) isolated diverse arrays of anti-oxazolone antibodies from a small random combinatorial library of V genes derived from the spleens of immunized mice. V gene repertoires from unimmunized human donors can be constructed, and antibodies against diverse arrays of antigens (including self-antigens) can be isolated by essentially following a technique described by Mark et al., J. Mol. Biol. 222: 581-597 (1991) or Griffith et al., EMBO J. 12: 725-734 (1993). In natural immune response, antibody genes accumulate mutations at a high rate (somatic hypermutation). Some of introduced changes will confer high affinity, and B cells displaying a high-affinity surface immunoglobulin are preferentially replicated and differentiated during subsequent antigen challenge. This natural process can be mimicked by a technique known as “chain shuffling” (Marks, et al., Bio/Technol. 10: 779-783 (1992)). In this method, the affinity of “primary” human antibodies obtained by phage display can be improved by sequentially replacing the heavy chain and light chain V region genes with repertoires of natural variants (repertoires) of V domain genes obtained from unimmunized donors. This technique allows production of antibodies and antibody fragments having affinity in the range of pM to nM. A strategy to prepare very large phage antibody repertoires (also known as “mother-of-all libraries”) is described by Waterhouse et al., Nucl. Acids Res. 21: 2265-2266 (1993).
(116) A human antibody having affinity and specificity equivalent to those of a starting rodent antibody may be induced from the rodent antibody by gene shuffling. According to this method, also referred to as “epitope imprinting”, the heavy chain or light chain V domain genes of rodent antibodies obtained by the phage display technique are replaced with human V domain gene repertoires to create rodent-human chimeras. Selection based on an antigen brings about the isolation of human variable regions that can reconstruct a functional antigen binding site. Specifically, the epitope governs (imprints) partner selection. When the method is repeated to replace residual rodent V domains, the human antibody is obtained (see International Publication No. WO9306213 published on Apr. 1, 1993). Unlike the conventional humanization of rodent antibodies by CDR grafting, this technique provides completely human antibodies free from rodent-derived framework or CDR residues. Although the discussion described above relates to humanized antibodies, it is apparent that the general principles discussed are applicable to, for example, antibody customization for use in dogs, cats, primates, horses and cattle.
(117) The chimeric or hybrid antibody may also be prepared in vitro by a known method of synthetic protein chemistry, including a method using a cross-linking agent. For example, immunotoxins can be constructed by using disulfide exchange reaction or forming a thioether bond. Examples of reagents suitable for this purpose include iminothiolate and methyl-4-mercaptobutyrimidate.
(118) The single-chain Fv fragment may also be produced as described in Iliades et al., 1997, FEBS Letters, 409: 437-441. The coupling of such single-chain fragments using various linkers is described in Kortt et al., 1997, Protein Engineering, 10: 423-433. Various techniques regarding the recombinant production and recombinant manipulation of antibodies are well known in the art.
(119) The antibody may be conjugated with a water-soluble polymer moiety. The antibody may be conjugated with polyethylene glycol (PEG), monomethoxy-PEG, an ethylene glycol/propylene glycol copolymer, carboxymethylcellulose, dextran, polyvinyl alcohol, or the like. The antibody may be modified at random positions on the molecule or at predetermined positions on the molecule and may contain one, two, or three or more attached moieties. The polymer may have any molecular weight and may be branched or nonbranched. In a certain embodiment, the moiety is attached to the polypeptide via a linker. In a certain embodiment, the attached moiety increases the circulation half-life of the antibody in vivo in animals. Methods for attaching polymers such as PEG to antibodies are well known in the art. In a certain embodiment, the antibody is a PEGylated antibody such as a PEGylated antibody. The conjugate may be further conjugated with an additional different drug such as a chemotherapeutic, a radionuclide, an immunotherapeutic, a cytokine, a chemokine, a contrast medium, a toxin, a biological agent, an enzyme inhibitor, or an antibody.
(120) 2. Antibody-Drug Conjugate
(121) In a certain embodiment, the present invention relates to a conjugate comprising the antibody and triptolide conjugated with each other. The triptolide is (3bS,4aS,5aS,6R,6aR,7aS,7bS,8aS,8bS)-6-hydroxy-6a-isopropyl-8b-methyl-3b,4,4a,6,6a,7a,7b,8b,9,10-decahydrotrisoxireno[6,7:8a,9:4b,5]phenanthro[1,2-c]furan-1(3H)-one under IUPAC name and has a structure represented by the following formula:
(122) ##STR00001##
(123) Accordingly, the antibody-triptolide conjugate of the present invention can be represented by the following formula:
(124) ##STR00002##
wherein Ab represents the antibody, L represents a linker, and n is a natural number which represents the number of the triptolide attached to the antibody.
(125) The antibody and the triptolide are covalently attached via the linker L. To attach the antibody and the triptolide, a multivalent linker (e.g., a divalent linker) can be used as the linker L. Linkers that can attach drugs to an antibody are well known in the art. The linker may be degradable or may be nondegradable. The linker may or may not contain a sulfur atom. For example, the linker can be acid-degradable, photodegradable, peptidase-degradable, esterase-degradable, disulfide bond-reducing, or hydrophobic. The linker may have, for example, a maleimide group or a haloacetyl group as a basic skeleton.
(126) Examples of the linker includes N-succinimidyl 3-(2-pyridyldithio)-propionate (SPDP), N-[γ-maleimidobutyryloxy]succinimide ester (GMBS), succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC), N-(4-maleimidobutyryloxy) sulfosuccinimide, sodium salt (Sulfo-GMBS), N-[(4-maleimidomethyl)cyclohexylcarbonyloxy]sulfosuccinimide, sodium salt (Sulfo-SMCC), N-succinimidyl-4-(maleimidomethyl)cyclohexane-1-carboxy-(6-amidocaproate) (LC-SMCC), κ-maleimidoundeconic acid N-succinimidyl ester (KMUA), ε-maleimidocaproic acid N-succinimidyl ester (EMCS), m-maleimidobenzoyl-N-hydroxysuccinimide ester (MBS), N-(α-maleimidoacetoxy)-succinimide ester (AMSA), succinimidyl-6-(β-maleimidopropionamido)hexanoate (SMPH), N-succinimidyl-4-(p-maleimidophenyl)-butyrate (SMPB), N-(p-maleimidophenyl) isocyanate (PMIP), maleimide-based cross-linking agents containing PEG, N-succinimidyl iodoacetate (SIA), N-succinimidyl(4-iodoacetyl)aminobenzoate (SIAB), N-succinimidyl bromoacetate (SBA), and N-succinimidyl 3-(bromoacetamido) propionate (SBAP).
(127) The starting material for triptolide can be a dimer having the following structure in order to enhance preservation stability, and this dimer itself can be used with reduction.
(128) ##STR00003##
(129) In this case, the dimer is reduced to give the following substance containing a 4-oxo-4-[(2-thiolethyl)amino]butanoic acid group bonded to each triptolide.
(130) ##STR00004##
(131) The 4-oxo-4-[(2-thiolethyl)amino]butanoic acid group bonded to the triptolide may be used as the linker L. Alternatively, the 4-oxo-4-[(2-thiolethyl)amino]butanoic acid group may be removed, and the linker mentioned above may be attached directly to the triptolide as the linker L. Alternatively, the linker L may be a group in which the divalent linker mentioned above is bonded to a 4-oxo-4-[(2-thiolethyl)amino]butanoic acid group. For example, when 4-oxo-4-[(2-thiolethyl)amino]butanoic acid and SMCC are used as the linker L, the antibody-triptolide conjugate of the present invention can be represented by the following formula:
(132) ##STR00005##
(133) The number of the triptolide (represented by n in the formula described above) attached to one antibody molecule may be at least 1 and can be, for example, 2 or more, 2.5 or more, 3 or more, 3.5 or more, 4 or more, 4.5 or more, 5 or more, 5.5 or more, 6 or more, 6.489 or more, 6.5 or more, 7 or more, 7.5 or more, 8 or more, 8.5 or more, 9 or more, 9.5 or more, or 10 or more. Also, the number of the triptolide (represented by n in the formula described above) attached to one antibody molecule can be 3 or less, 3.5 or less, 4 or less, 4.5 or less, 5 or less, 5.5 or less, 6 or less, 6.5 or less, 7 or less, 7.5 or less, 8 or less, 8.5 or less, 9 or less, 9.5 or less, or 10 or less. Alternatively, the number of the triptolide attached to one antibody molecule can be 1 to 10, 1 to 9, 1 to 8, 1 to 7, 1 to 6, 1 to 5, 1 to 4, 1 to 3, 1 to 2, 2 to 10, 2 to 9, 2 to 8, 2 to 7, 2 to 6, 2 to 5, 2 to 4, 2 to 3, 3 to 10, 3 to 9, 3 to 8, 3 to 7, 3 to 6, 3 to 5, 3 to 4, 4 to 10, 4 to 9, 4 to 8, 4 to 7, 4 to 6, 4 to 5, 5 to 10, 5 to 9, 5 to 8, 5 to 7, 5 to 6, 6 to 10, 6 to 9, 6 to 8, 6 to 7, 7 to 10, 7 to 9, 7 to 8, 8 to 10, 8 to 9, 9 to 10, or 1, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 6.489, 7, 7.5, 8, 8.5, 9, 9.5 or 10.
(134) The attachment of the linker to the antibody is usually achieved by acylating a lysine residue of the antibody. The attachment position of the triptolide to the antibody is not particularly limited as long as the position does not influence the specificity of the antibody. Preferably, the triptolide is attached to a constant region of the antibody.
(135) The antibody-drug conjugate of the present invention can be manufactured by a method well known to those skilled in the art. For example, the antibody and the linker can be reacted first to bind each other, and then the linker can be attached to the drug (triptolide). Specifically, the antibody is reacted with the linker of 10 to 50 times the molar amount of the antibody dissolved in DMSO at room temperature for 30 minutes in PBS-EDTA (pH 7.5), and unreacted linkers are removed to obtain the antibody attached to the linker. A dimer of a triptolide derivative is dissolved in 100% ethanol and reduced for 2 hours. The linker-modified antibody and the triptolide can be reacted overnight at a ratio of 1:5.68 at room temperature in PBS-EDTA pH 7.5 to obtain an antibody-linker-triptolide attachment product.
(136) 3. Concomitant Drug
(137) The present invention further relates to a concomitant drug of the antibody and an additional antitumor agent. Examples of the antitumor agent that may be used concomitantly with the antibody can include: alkylating drugs including nitrogen mustards such as cyclophosphamide, ifosfamide, melphalan, busulfan, and thiotepa, and nitroureas such as nimustine, ranimustine, dacarbazine, procarbazine, temozolomide, carmustine, streptozocin, and bendamustine; platinum compounds such as cisplatin, carboplatin, oxaliplatin, and nedaplatin; antimetabolite drugs such as enocitabine, capecitabine, carmofur, cladribine, gemcitabine, cytarabine, cytarabine ocfosfate, tegafur, tegafur uracil, tegafur/gimeracil/oteracil potassium, doxifluridine, nelarabine, hydroxycarbamide, 5-fluorouracil (5-FU), fludarabine, pemetrexed, pentostatin, mercaptopurine, and methotrexate; plant alkaloids or microtubule inhibiting drugs such as irinotecan, etoposide, eribulin, sobuzoxane, docetaxel, nogitecan, paclitaxel, vinorelbine, vincristine, vindesine, and vinblastine; anticancer antibiotics such as actinomycin D, aclarubicin, amrubicin, idarubicin, epirubicin, zinostatin stimalamer, daunorubicin, doxorubicin, pirarubicin, bleomycin, peplomycin, mitomycin C, mitoxantrone, and liposomal doxorubicin; cancer vaccines such as sipuleucel-T; molecular targeting drugs such as ibritumomab tiuxetan, imatinib, everolimus, erlotinib, gefitinib, gemtuzumab ozogamicin, sunitinib, cetuximab, sorafenib, dasatinib, tamibarotene, trastuzumab, tretinoin, panitumumab, bevacizumab, bortezomib, lapatinib, and rituximab; hormone agents such as anastrozole, exemestane, estramustine, ethinylestradiol, chlormadinone, goserelin, tamoxifen, dexamethasone, toremifene, bicalutamide, flutamide, prednisolone, fosfestrol, mitotane, methyltestosterone, medroxyprogesterone, mepitiostane, leuprorelin, and letrozole; and biological response modifiers such as interferon α, interferon β, interferon γ, interleukin, ubenimex, dry BCG, and lentinan. Cisplatin, pemetrexed, or gemcitabine is preferred, and gemcitabine is more preferred.
(138) The concomitant drug (pharmaceutical composition containing two or more drugs) of the present invention may contain all or a part of two or more types of drugs to be used concomitantly in one preparation, or may be provided as separate preparations containing each drug alone for concomitant use. Alternatively, the concomitant drug of the present invention may be provided as a kit for concomitant use including separate preparations containing each drug of all or a part of two or more types of drugs to be used concomitantly.
(139) 4. Application
(140) The conjugate or the concomitant drug of the present invention is useful in various applications including, but are not limited to, a method for treatment or a method for lysing malignant cells. The present invention includes, for example, a pharmaceutical composition, a therapeutic drug for malignant mesothelioma, a malignant mesothelioma cell growth inhibitor, and a malignant mesothelioma cell lysing agent, which contain the conjugate or the concomitant drug of the present invention as an active ingredient. The present invention may also provide the conjugate or the concomitant drug of the present invention for use in a pharmaceutical composition, a therapeutic drug for malignant mesothelioma, a malignant mesothelioma cell growth inhibitor, or a malignant mesothelioma cell lysing agent. Alternatively, the present invention may provide a use of the conjugate of the present invention or a use of an anti-CD26 antibody and an antitumor agent in the manufacture of a pharmaceutical composition, a therapeutic drug for malignant mesothelioma, a malignant mesothelioma cell growth inhibitor, or a malignant mesothelioma cell lysing agent. In one aspect, the present invention includes a method for treating malignant mesothelioma, a method for inhibiting malignant mesothelioma cell growth, and a method for lysing malignant mesothelioma cells, comprising administering an effective amount of the conjugate or the concomitant drug of the present invention to a patient in need thereof. Accordingly, the present invention also provides a method for inhibiting CD26-expressing cell growth. The inhibition of CD26-expressing cell growth includes any observable inhibition, including partial growth inhibition and complete growth inhibition. In a certain embodiment, the cell growth is inhibited by at least approximately 10%, at least approximately 25%, at least approximately 50%, at least approximately 75%, at least approximately 90%, at least approximately 95%, at least approximately 98%, or approximately 100%. The method may be performed in vitro or in vivo. In a certain embodiment, the method comprises the step of contacting the cells with the conjugate or the concomitant drug described herein. In general, the cells are contacted with a sufficient amount of the conjugate or the concomitant drug for inhibiting the cell growth.
(141) In a certain embodiment, the CD26-expressing cells are mammalian cells and are preferably human cells. In a certain embodiment, the CD26-expressing cells are cancer cells. In a certain embodiment, the CD26-expressing cells are cells of malignant mesothelioma, lung cancer, kidney cancer, liver cancer or other malignant tumors involving the expression of CD26. In a certain embodiment, the tumor cells are malignant or benign.
(142) Methods for evaluating the inhibition of cell growth are known in the art. Examples thereof include MTT assay (see e.g., Aytac et al., (2003) British Journal of Cancer 88: 455-462; Ho et al., (2001) Clinical Cancer Research 7: 2031-2040; Hansen et al., (1989) J. Immunol. Methods, 119: 203-210; and Aytac et al., (2001) Cancer Res 61: 7204-7210).
(143) The present invention further provides a method for treating a condition associated with CD26 expression in a subject. The method for treating a condition associated with CD26 expression in a subject comprises administering an effective amount of a composition comprising the conjugate or the concomitant drug described herein to the subject. The condition associated with CD26 expression may be associated with the abnormal expression of CD26. The condition associated with CD26 expression may be a condition associated with a change or abnormality in CD26 expression (in a certain embodiment, increase or decrease in CD26 expression level (as compared with a normal sample) and/or inappropriate expression, for example, expression in tissues and/or cells normally expressing no CD26, or deficiency in CD26 expression in tissues or cells normally expressing CD26). The condition associated with CD26 expression may be a condition associated with CD26 overexpression. The condition associated with CD26 expression may be mediated at least partially by CD26, may be a condition associated with CD26-expressing cells, or may be a condition with the abnormal growth of CD26-expressing cells. The CD26-expressing cells may be T cells or tumor cells. The tumor cells may be malignant or benign.
(144) The condition associated with CD26 expression in the subject includes a proliferative disease, particularly, a cancer. The cancer is malignant mesothelioma, lung cancer, kidney cancer, liver cancer or any other malignant tumor involving the expression of CD26.
(145) The method (including the treatment method) described herein may be accomplished by single direct injection at one time or multiple times to single or multiple sites. The administration may also be performed to a plurality of sites at almost the same time. The frequency of administration is determined and adjusted in the course of treatment and is based on the desired results to be achieved. In some cases, a sustained-release preparation of the conjugate, the concomitant drug, or the pharmaceutical composition of the present invention may be appropriate. Various preparations and apparatuses for achieving sustained release are well known in the art.
(146) The subject for treatment or prevention includes mammals such as humans, cattle, horses, dogs, cats, pigs, and sheep and is preferably a human.
(147) The conjugate or the concomitant drug is preferably administered as being contained in a carrier (preferably a pharmaceutically acceptable carrier) to a mammal. Appropriate carriers and their preparations are described in Remington's Pharmaceutical Sciences, 18th edition, A. Gennaro ed., Mack Publishing Co., Easton, Pa., 1990 and Remington, The Science and Practice of Pharmacy, 20th edition, Mack Publishing, 2000. Usually, an appropriate amount of a pharmaceutically acceptable salt is used in a preparation so that the preparation has isotonicity. Examples of the carrier include physiological saline, Ringer's solutions and dextrose solutions. The pH of these solutions is preferably approximately 5 to approximately 8, more preferably approximately 7 to approximately 7.5. Further examples of the carrier include sustained-release preparations such as semipermeable matrices of solid hydrophobic polymers containing the antibody. The matrices are in the form of shaped articles, for example, films, liposomes, or microparticles. It will be apparent to those skilled in the art that a certain carrier may be more preferred depending upon, for example, the administration route and concentration of the antibody to be administered.
(148) The conjugate or the concomitant drug may be administered to a mammal by injection (e.g., systemic, intravenous, intraperitoneal, subcutaneous, intramuscular, or intraportal injection), or may be administered thereto by other methods (e.g., infusion) that secure delivery in an effective form to blood stream. The conjugate or the concomitant drug may be administered by an isolated perfusion method such as isolated tissue perfusion to exert a local therapeutic effect. Intravenous injection is preferred.
(149) Effective doses and schedules for administering the conjugate or the concomitant drug of the present invention are empirically determined. Methods for such determination are included within technical common sense in the art. Those skilled in the art will understand that the dose of the conjugate or the concomitant drug to be administered varies depending on, for example, the mammal that will receive the conjugate or the concomitant drug, an administration route, the specific type of the antibody used, and other drugs to be administered to the mammal. The typical daily amount of the conjugate (used alone) or the concomitant drug administered may range from approximately 1 μg/kg body weight to 100 mg/kg body weight or more per day, though depending on the factors mentioned above. In general, any of the following amounts administered may be used: at least approximately 50 mg/kg body weight; at least approximately 10 mg/kg body weight; at least approximately 3 mg/kg body weight; at least approximately 1 mg/kg body weight; at least approximately 750 μg/kg body weight; at least approximately 500 μg/kg body weight; at least approximately 250 μg/kg body weight; at least approximately 100 μg/kg body weight; at least approximately 50 μg/kg body weight; at least approximately 10 μg/kg body weight; at least approximately 1 μg/kg body weight, or more.
(150) The conjugate or the concomitant drug may be administered to the mammal by further concomitant use with effective amounts of one or more other therapeutic drugs. The conjugate or the concomitant drug may be administered sequentially or concurrently with the one or more other therapeutic agents. The amounts of the conjugate or the concomitant drug and the therapeutic drug depend on, for example, the types of the drugs used, a pathological condition to be treated, an administration schedule and an administration route and may generally be less than the amounts of the conjugate or the concomitant drug and the therapeutic drug used individually.
(151) The physiological condition of the mammal thus given the conjugate or the concomitant drug can be monitored by various methods well known to those skilled in the art.
(152) 5. Method for Screening for Compound Exhibiting Synergistic Effect by Concomitant use with Anti-CD26 Antibody
(153) In a further alternative aspect, the present invention relates to a method for screening for a compound exhibiting a synergistic effect by concomitant use with an anti-CD26 antibody. The screening method of the present invention is based on CD26 that mutually acts and counters with CD9 (Okamoto et al., PLOS One (2014) 9 (1): e86671). When a chemotherapeutic candidate mutually acts with CD26, its effect is attenuated by CD9. Therefore, a candidate differing in growth inhibitory effect between a cell line coexpressing CD26 and CD9 and a cell line expressing CD26 but expressing no CD9 can be determined as a medication exhibiting a synergistic effect by concomitant use with an anti-CD26 antibody. Specifically, the screening method of the present invention is
(154) a method for screening for a compound exhibiting a synergistic antitumor effect by concomitant use with an anti-CD26 antibody, comprising the following steps:
(155) (a) culturing a tumor cell line coexpressing CD26 and CD9, and a cell line expressing CD26 but expressing no CD9 in the presence of a test compound;
(156) (b) measuring the respective numbers of cells of the tumor cell lines thus cultured;
(157) (c) calculating a growth inhibitory effect of the test compound on the tumor cell line coexpressing CD26 and CD9, and a growth inhibitory effect of the test compound on the cell line expressing CD26 but expressing no CD9; and
(158) (d) comparing the growth inhibitory effect of the test compound on the tumor cell line coexpressing CD26 and CD9, and the growth inhibitory effect of the test compound on the cell line expressing CD26 but expressing no CD9, and selecting the test compound as a compound likely to exhibit a synergistic antitumor effect by concomitant use with an anti-CD26 antibody when the growth inhibitory effect on the cell line expressing CD26 but expressing no CD9 is better.
(159) In this method, a mesothelioma cell line MESO1 or H2452 can be used as the tumor cell line coexpressing CD26 and CD9. JMN or H226 can be used as the cell line expressing CD26 but expressing no CD9.
(160) The step of measuring the respective numbers of cells of the tumor cell lines can adopt every known method as long as the method provides measurement values reflecting the numbers of cells. For example, other numerical values serving as an index for the number of cells, such as turbidity or a measurement value of MTT assay may be used instead of the number of cells.
(161) The growth inhibitory effect on each tumor cell line may be calculated as the number of cells with that of a control defined as 100, or a numerical value serving as an index for drug efficacy, such as IC50 may be calculated. The degree of the growth inhibitory effect can be confirmed as excellent growth inhibitory effect when the number of cells whose growth has been suppressed is large.
(162) Hereinafter, the present invention will be described in more detail with reference to Examples. However, the present invention is not limited by these Examples. All literatures cited herein are incorporated herein by reference in their entirety.
(Example 1) Antibody-Drug Conjugation
(163) (1) Starting Material
(164) A humanized anti-CD26 antibody YS110 was designed based on an anti-CD26 mouse antibody 14D10 and expressed according to the already reported approach (see International Publication No. WO2007/014169); and Inamoto T et al., Clin Cancer Res (2007) 13: 4191-200). Triptolide having the following structure (molecular formula: C20H2406; MW=360.4) was purchased from Shaanxi Taiji Technology (Shanxi Sheng, China).
(165) ##STR00006##
(2) Conjugation Protocol
(166) A SH group was introduced to the triptolide by ChemGenesis Inc. (Tokyo, Japan). The obtained triptolide derivative was designated as TR1. TR1 was provided as a dimer of such triptolide derivatives bound via a S—S bond for enhanced scientific stability and had the following structure.
(167) ##STR00007##
(168) A hetero-divalent linker SPDP (N-succinimidyl 3-(2-pyridyldithio)-propionate) (catalog No. 21857, Thermo Fisher Scientific Inc., Waltham, Mass.), GMBS (N-[γ-maleimidobutyryloxy]succinimide ester) (catalog No. 22309, Thermo Fisher Scientific Inc., Waltham, Mass.), or SMCC (succinimidyl 4-[N-maleimidomethyl] cyclohexane-1-carboxylate) (catalog No. 22360, Thermo Fisher Scientific Inc., Waltham, Mass.) was dissolved in DMSO immediately before use. YS110 was modified through reaction with the hetero-divalent linker SPDP (15 times the molar quantity of the antibody), GMBS (30 times the molar quantity of the antibody), or SMCC (20 times the molar quantity of the antibody) at room temperature for 30 minutes in PBS-EDTA (pH 7.5). Unreacted linkers were removed using HiTrap Desalting column (catalog No. 21857, GE Healthcare Inc., Buckinghamshire, UK). The triptolide derivative TR1 S—S dimer was dissolved in 100% ethanol and reduced with immobilized TCEP Reducing Gel (catalog No. 77712, Thermo Fisher Scientific Inc., Waltham, Mass.) for 2 hours. The SH group concentration of the reduced TR1-SH was measured by DTNB ((5,5-dithio-bis-(2-nitrobenzoic acid)) assay. The linker-modified YS110 and the TR1-SH were reacted overnight at a ratio of 1:5.68 at room temperature in PBS-EDTA pH 7.5. Unreacted TR1-SH was removed using PD-10 column (catalog No. 17085101, GE Healthcare Inc., Buckinghamshire, UK). This reaction is summarized below.
(169) ##STR00008##
(170) The obtained product was filter-sterilized through Millex-GV Filter Unit 0.22 um (Cat no. SLGV 013SL, EMD Millipore, Billerica, Mass.). The final concentration was measured using BCA protein assay reagent kit (catalog No. 23225, Thermo Fisher Scientific Inc., Waltham, Mass.). Residual unconjugated TR1-SH in the product was measured by DTNB assay.
(171) (3) Results
(172) YS110 and TR1 were conjugated using a hetero-divalent linker (SPDP, GMBS, or SMCC) according to the method described above. The final product concentration measured using BCA protein assay reagent kit (Thermo Fisher Scientific Inc., Waltham, Mass.) was approximately 1 mg/ml. Residual unconjugated TR1-SH in the product was measured by DTNB assay, but was hardly detectable (data not shown).
(Example 2) Cell Culture
(173) A CD26-negative malignant mesothelioma cell line MSTO-211H (MSTO) (American Type Cell Culture Collection, Manassas, Va.) was transfected with CD26 gene, which was designated as MSTO clone 12 (Aoe K et al., Clin Cancer Res. (2012) 18: 1447-56). A CD26-negative T-cell leukemia cell line Jurkat (American Type Cell Culture Collection, Manassas, Va.) was transfected with CD26 gene, which was designated as Jurkat CD26(+) (Tanaka T et al., Proc Natl Acad Sci USA (1993) 90: 4586-90). A CD26-positive cell line JMN established from malignant mesothelioma was kindly provided by professor Chikao Morimoto, the Institute of Medical Science, the University of Tokyo. All the cell lines were cultured in RPMI medium (catalog No. 11875-093, Life Technologies Corp., Carlsbad, Calif.) containing 10% heat-inactivated fetal bovine serum (FBS, Life Technologies Corp., Carlsbad, Calif.), ABPC (100 μg/ml), and streptomycin (100 μg/ml) at 37° C. under 5% CO.sub.2 environment.
(Example 3) Mass Spectrometry
(174) The drug/antibody ratio of Y-TR1 was analyzed by matrix-assisted laser desorption/ionization mass spectrometry (MALDI-TOFmass) using Autoflex III (Bruker Corporation, Billerica, Mass.) after ultrafiltration.
(175) The intact masses of unconjugated YS110 and Y-TR1 (SMCC) analyzed by MALDI-TOFmass were 147012.7 and 151815.6, respectively (
(Example 4) Binding Assay
(176) To examine the binding of Y-TR1 to CD26-positive malignant mesothelioma cells, cultured MSTO-wt cells (CD26-negative) and MSTO clone 12 cells (CD26-positive) were recovered. 1×10.sup.6 cells of each cell line were cultured with 1 μg/ml, 10 μg/ml, or 100 μg/ml Y-TR1 at 4° C. for 30 minutes. The cells were washed three times and cultured with FITC-conjugated rabbit anti-human IgG (catalog No. 6140-02, Southern Biotech, Birmingham, Ala.) at a dilution ratio of 1:100 at 4° C. for 30 minutes. The cells were washed three times, followed by FACS analysis using Epics XL-MCL (Beckman Coulter, Inc., Brea, Calif.).
(177) The intact binding of Y-TR1 to the CD26-positive malignant mesothelioma cell line MSTO clone 12 was confirmed by flow cytometry analysis (
(Example 5) Cytotoxicity Assay
(178) The cytotoxicity of triptolide, YS110 and Y-TR1 to malignant mesothelioma and T-cell leukemia cell lines was measured using colorimetric cell proliferation kit WST-1 (catalog No. 11644807001, Roche Applied Science, Rotkreuz, Switzerland) based on the colorimetric detection of a formazan dye. In summary, 5×10.sup.3 MSTO-wt, MSTO clone 12, JMN, Jurkat CD26(−), or Jurkat CD26(+) cells were cultured with triptolide (0 to 100 nM), TR1 (0 to 100 nM), YS110 (0 to 100 μg/ml), or Y-TR1 (0 to 100 ug/ml) in RPMI medium containing 10% heat-inactivated fetal bovine serum, ABPC (100 μg/ml) and streptomycin (100 μg/ml) in a 96-well plate at 37° C. for 48 hours under 5% CO.sub.2 environment. WST-1 assay was conducted according to the manual provided by the manufacturer. The background absorbance of each sample at 630 nm was subtracted from the measurement value thereof at 450 nm. The experiment was conducted in triplicate, and typical results are shown.
(179) As shown in
(180) The triptolide derivative TR1 that was designed for attachment to the linker was tested for its cytotoxicity and IC50 value in the same way as above. The results are shown in
(181) Y-TR1 exhibited dose-dependent cytotoxicity to the CD26-positive malignant mesothelioma and leukemia cell lines (
(182) TABLE-US-00008 TABLE 4 IC50 of IC50 IC50 Triptolide of TR1 of Y-TR1 Cell line Origin CD26 (nM) (nM) (μg/ml) MSTO wt Mesothelioma (−) 10 250 35 MSTO clone12 Mesothelioma (+) 10 250 15 JMN Mesothelioma (+) 15 ND 30 Jurkat (−) Leukemia (−) >100 ND >100 Jurkat CD26 Leukemia (+) 6 ND 30 (+)
(183) TABLE-US-00009 TABLE 5 conjugate IC50 (ug/ml) Y-TR1 SPDP 35 Y-TR1 GMBS 18 Y-TR1 SMCC 15
(Example 6) In Vivo Effect Assay and Toxicity Study
(184) NOD/SCID (NOD/LtSz-scid) mice were maintained in a microisolator cage within a specific pathogen-free (SPF) facility and allowed to freely take sterilized diet and sterilized water. The animal experiment protocol was conducted with the approval of the Animal Care and Use Committee.
(185) 1×10.sup.7 cultured JMN cells were subcutaneously administered to 6- to 8-week-old female NOD/SCID mice. A total of 30 animals were randomly divided into 3 types of treatment groups: a control group, a YS110 administration group, and a Y-TR1 administration group. 4 mg/kg/dose of YS110 or Y-TR1 was intraperitoneally administered to the YS110 and Y-TR1 groups three times a week (a total of 9 times) from the day of tumor inoculation. The same amount of PBS was administered to the control group. When a tumor became evidently visible, the tumor was excised, and its size was measured with a vernier caliper. The estimated tumor volume was determined by calculation according to the expression: π/6×L×W×W (Tomayko M M et al., Cancer Chemother Pharmacol. (1989) 24: 148-54). The statistical difference among the average tumor volumes of these groups were determined by Fisher's protected least-square differences (PLSD) multiple comparison test. Statistical analysis was conducted using SPSS software (IBM, Armonk, N.Y.).
(186)
(Example 7) Confirmation of CD26 Expression in Mesothelioma Cell Line
(187) CD26 expression in a mesothelioma cell line was confirmed by FACS measurement. Among CD26-positive mesothelioma cell lines, ACC-MESO1 and JMN were used as sarcomatoid mesothelioma cell lines, and NCI-H2452 and NCI-H226 were used as epithelioid mesothelioma cell lines. The ACC-MESO1, JMN, NCI-H2452, and NCI-H226 cells were stained with anti-CD26 monoclonal antibody-FITC, followed by FACS analysis.
(188) The results are shown in
(Example 8) Potentiation of Cell Growth Inhibitory Effect of Cisplatin-Pemetrexed by Concomitant Use with YS110 on Mesothelioma Cell
(189) (1) Dose-Response Curves of Cisplatin and Pemetrexed
(190) MESO1 or H2452 cells (2×10.sup.3 cells/well) were inoculated to a 96-well plate. One hour later, cisplatin or pemetrexed was added thereto at 10.sup.−9, 10.sup.−8, 10.sup.−7, 10.sup.−6, 10.sup.−5, or 10.sup.−4 M (n=6). At day 2, MTT assay was conducted.
(191) The results are shown in
(192) (2) Potentiation of MESO1 Cell Growth Inhibitory Effects of Cisplatin and Pemetrexed by YS110
(193) MESO1 cells (2×10.sup.3 cells/well) were inoculated to a 96-well plate. One hour later, the combination of 0.3, 3, or 10 μM cisplatin and 0.1, 3, or 10 μg/ml YS110, or the combination of 0.03, 0.3, or 1 μM pemetrexed and 0.1, 3, or 10 μg/ml YS110 was added thereto. At day 2, MTT assay was conducted. Significant difference was tested by two-tailed t-test (vs Cont).
(194) The results are shown in
(195) Pemetrexed
(196) (3) Potentiation of H2452 Cell Growth Inhibitory Effects of Cisplatin and Pemetrexed by YS110
(197) H2452 cells (2×10.sup.3 cells/well) were inoculated to a 96-well plate. One hour later, the combination of 0.03, 0.3, or 1 μM cisplatin and 0.1, 3, or 10 μg/ml YS110, or the combination of 0.01, 0.1, or 0.3 μM pemetrexed and 0.1, 3, or 10 μg/ml YS110 was added thereto (n=6). At day 2, MTT assay was conducted. Significant difference was tested by two-tailed t-test (vs Cont).
(198) The results are shown in
(199) (4) Potentiation of MESO1 Cell Growth Inhibitory Effect of Cisplatin-Pemetrexed Concomitant use by YS110
(200) MESO1 cells (2×10.sup.3 cells/well) or H2452 cells (2×10.sup.3 cells/well) were inoculated to a 96-well plate. One hour later, 0.3 μM cisplatin-0.1 μM pemetrexed combination, or YS110 (10 μg/ml) plus the 0.3 μM cisplatin-0.1 μM pemetrexed combination was added thereto (n=6). At day 2, MTT assay was conducted. Significant difference was tested by two-tailed t-test (vs Cont).
(201) The results are shown in
(202) (5) Potentiation of in Vivo JMN Cell Growth Inhibitory Effects of Cisplatin and Pemetrexed by YS110
(203) JMN cells (3×10.sup.5 cells/animal) were subcutaneously transplanted to the backs of female SCID mice. The day of transplantation was defined as day 0. YS110 (10 mg/kg) alone, cisplatin (0.5 mg/kg) alone, pemetrexed (50 mg/kg) alone, cisplatin (0.5 mg/kg) and YS110 (10 mg/kg) used concomitantly, or pemetrexed (50 mg/kg) and YS110 (10 mg/kg) used concomitantly was intraperitoneally administered to the mice twice (days 1 and 4). At day 7, their tumors were excised, and the tumor weights were measured. Significant difference was tested by two-tailed t-test (vs Cont).
(204) The results are shown in
(205) (6) Potentiation of in Vivo JMN Cell Growth Inhibitory Effect of Cisplatin-Pemetrexed Concomitant use by YS110
(206) JMN cells (5×10.sup.3 cells/animal) were subcutaneously transplanted to the backs of female SCID mice. The day of transplantation was defined as day 0. Cisplatin (0.5 mg/kg)-pemetrexed (50 mg/kg) used concomitantly, YS110 (10 mg/kg) alone, or YS110 (10 mg/kg) used concomitantly with the cisplatin-pemetrexed concomitant use was intraperitoneally administered to the mice twice (days 1 and 4). At day 7, their tumors were excised, and the tumor weights were measured. Significant difference was tested by two-tailed t-test (vs Cont).
(207) The results are shown in
(208) (7) Potentiation of in Vivo MESO1 Cell Growth Inhibitory Effect of Cisplatin-Pemetrexed Concomitant use by YS110
(209) MESO1 cells (3×10.sup.5 cells/animal) were subcutaneously transplanted to the backs of female SCID mice. The day of transplantation was defined as day 0. YS110 (10 mg/kg) alone, cisplatin (0.5 mg/kg)-pemetrexed (50 mg/kg) used concomitantly, or YS110 (10 mg/kg) concomitantly used with the cisplatin-pemetrexed concomitant use was intraperitoneally administered to the mice twice (days 1 and 4). At day 7, their tumors were excised, and the tumor weights were measured. Significant difference was tested by two-tailed t-test (vs Cont).
(210) The results are shown in
(211) (8) Potentiation of in Vivo H2452 Cell Growth Inhibitory Effect of Cisplatin-Pemetrexed Concomitant use by YS110
(212) H2452 cells (3×10.sup.5 cells/animal) were subcutaneously transplanted to the backs of female SCID mice. The day of transplantation was defined as day 0. YS110 (10 mg/kg) alone, cisplatin (0.5 mg/kg)-pemetrexed (50 mg/kg) used concomitantly, or YS110 (10 mg/kg) used concomitantly with the cisplatin-pemetrexed concomitant use was intraperitoneally administered to the mice twice (days 1 and 4). At day 7, their tumors were excised, and the tumor weights were measured. Significant difference was tested by two-tailed t-test (vs Cont).
(213) The results are shown in
(Example 9) Potentiation of Cell Invasion Inhibitory Effect of Cisplatin-Pemetrexed by Concomitant Use with YS110 on Mesothelioma Cell
(214) (1) Action of Cisplatin and Pemetrexed on Cell Invasion
(215) MESO1 cells or H2452 cells (2.5×10.sup.4 cells/well) were inoculated to a Boyden chamber. One hour later, cisplatin (5, 10, or 30 μM) or pemetrexed (1, 10, or 30 μM) was added thereto (n=5), followed by Boyden chamber invasion assay. 24 hours after the cell inoculation, invasive cells were stained with Diff-Quik-staining kit. Significant difference was tested by two-tailed t-test (vs Cont).
(216) The results are shown in
(217) (2) Cell Invasion Inhibitory Effect of Cisplatin-Pemetrexed Concomitant Use
(218) MESO1 cells or H2452 cells (2.5×10.sup.4 cells/well) were inoculated to a Boyden chamber. One hour later, the combination of cisplatin (0, 3, or 10 μM) and pemetrexed (0, 10, or 30 μM) was added thereto (n=5), followed by Boyden chamber invasion assay. 24 hours after the cell inoculation, invasive cells were stained with Diff-Quik-staining kit. Significant difference was tested by two-tailed t-test (vs Cont).
(219) The results are shown in
(220) (3) YS110 Potentiates Cell Invasion Inhibitory Effect of Cisplatin on MESO1 Cell
(221) MESO1 cells (2.5×10.sup.4 cells/well) were inoculated to a Boyden chamber. One hour later, the combination of cisplatin (0, 3, or 10 μM) and YS110 (0, 10, or 20 μg/ml) was added thereto (n=5), followed by Boyden chamber invasion assay. 24 hours after the cell inoculation, invasive cells were stained with Diff-Quik-staining kit. Significant difference was tested by two-tailed t-test (vs Cont). Next, the interaction of YS110 with cisplatin-pemetrexed concomitant use was studied. The interaction was analyzed by two-way ANOVA.
(222) The results are shown in
(223) (4) YS110 Potentiates Cell Invasion Inhibitory Effect of Cisplatin on H2452 Cell
(224) H2452 cells (2.5×10.sup.4 cells/well) were inoculated to a Boyden chamber. One hour later, the combination of cisplatin (0, 3, or 10 μM) and YS110 (0, 10, or 20 μg/ml) was added thereto (n=5), followed by Boyden chamber invasion assay. 24 hours after the cell inoculation, invasive cells were stained with Diff-Quik-staining kit. Significant difference was tested by two-tailed t-test (vs Cont). Next, the interaction of YS110 with cisplatin-pemetrexed concomitant use was studied. The interaction was analyzed by two-way ANOVA.
(225) The results are shown in
(Example 10) Concomitant Use of Gemcitabine and YS110 in Mesothelioma Cell
(226) (1) Dose-Response Curve of Gemcitabine in Mesothelioma Cell Line
(227) Gemcitabine was studied for its effect on the growth of a mesothelioma cell line. A mesothelioma cell line MESO1, JMN, H2452, or H226 (2×10.sup.3 cells/well) was inoculated to a 96-well plate. One hour later, gemcitabine (10.sup.−9, 10.sup.−8, 10.sup.−7, 10.sup.−6, 10.sup.−5, or 10.sup.−4 M) was added thereto (N=6). 2 days later, MTT assay was conducted. Significant difference was tested by two-tailed t-test (vs Cont).
(228) The results are shown in
(229) (2) Effect of YS110 and Gemcitabine Used Concomitantly on Sarcomatoid Mesothelioma MESO1 Cell Growth
(230) MESO1 cells (2×10.sup.3 cells/well) were inoculated to a 96-well plate. One hour later, gemcitabine (0, 10.sup.−8, 3×10.sup.−8, or 10.sup.−7 M) and YS110 (0, 1, 3, or 10 μg/ml) were added thereto in combination. At day 2, MTT assay was conducted. Significant difference was tested by two-tailed t-test (vs Cont). Next, interaction in concomitant use of medications was studied (n=6). The interaction between YS110 and gemcitabine used concomitantly was analyzed by two-way ANOVA.
(231) The results are shown in
(232) (3) Effect of YS110 and Gemcitabine Used Concomitantly on Sarcomatoid Mesothelioma JMN Cell Growth
(233) JMN cells (2×10.sup.3 cells/well) were inoculated to a 96-well plate. One hour later, gemcitabine (0, 3×10.sup.−10, 10.sup.−9, or 3×10.sup.−8 M) and YS110 (0, 1, 3, or 10 μg/ml) were added thereto in combination. At day 2, MTT assay was conducted. Significant difference was tested by two-tailed t-test (vs Cont). Next, interaction in concomitant use of medications was studied (n=6). The interaction between YS110 and gemcitabine used concomitantly was analyzed by two-way ANOVA.
(234) The results are shown in
(235) (4) Effect of YS110 and gemcitabine used concomitantly on epithelioid mesothelioma H2452 cell growth
(236) H2452 cells (2×10.sup.3 cells/well) were inoculated to a 96-well plate. One hour later, gemcitabine (0, 10.sup.−8, 3×10.sup.−8, or 10.sup.−7 M) and YS110 (0, 1, 3, or 10 μg/ml) were added thereto in combination. At day 2, MTT assay was conducted. Significant difference was tested by two-tailed t-test (vs Cont). Next, interaction in concomitant use of medications was studied (n=6). The interaction between YS110 and gemcitabine used concomitantly was analyzed by two-way ANOVA.
(237) The results are shown in
(238) (5) Effect of YS110 and Gemcitabine Used Concomitantly on Epithelioid Mesothelioma H226 Cell Growth
(239) H226 cells (2×10.sup.3 cells/well) were inoculated to a 96-well plate. One hour later, gemcitabine (0, 10.sup.−8, 3×10.sup.−8, or 10.sup.−7 M) and YS110 (0, 1, 3, or 10 μg/ml) were added thereto in combination. At day 2, MTT assay was conducted. Significant difference was tested by two-tailed t-test (vs Cont). Next, interaction in concomitant use of medications was studied (n=6). The interaction between YS110 and gemcitabine used concomitantly was analyzed by two-way ANOVA.
(240) The results are shown in
(241) (6) Concomitant Use of Gemcitabine with Standard Cisplatin-Pemetrexed Therapy
(242) MESO1, JMN, H2452 or H226 cells (2×10.sup.3 cells/well were inoculated to a 96-well plate. One hour later, 3×10.sup.−8 M or 10.sup.−7 M gemcitabine was added thereto by concomitant use with the combination of cisplatin (0, 0.1, 0.3, or 1 μM) and pemetrexed (0, 0.03, 0.1, or 0.3 μM) (n=6). At day 2, MTT assay was conducted.
(243) The results are shown in
(244) (7) Concomitant Use of YS110 and Gemcitabine Against in Vivo Growth of Epithelioid Mesothelioma Cell H226
(245) H226 (3.8×10.sup.5 cells/animal) was subcutaneously transplanted to the backs of female SCID mice. The day of transplantation was defined as day 0. YS110 (10 mg/kg), gemcitabine (20 mg/kg), or YS110 (10 mg/kg)+gemcitabine (20 mg/kg) was intraperitoneally administered to the mice twice (days 2 and 4) (n=6). At day 7, their tumors were excised, and the tumor weights were measured. Significant difference was tested by two-tailed t-test (vs Cont). The interaction between YS110 and gemcitabine used concomitantly was analyzed by two-way ANOVA.
(246) The results are shown in
(247) (8) Concomitant Use of YS110 and Gemcitabine Against in Vivo Growth of Sarcomatoid Mesothelioma Cell JMN
(248) H226 cells (3×10.sup.5 cells/animal) were subcutaneously transplanted to the backs of female SCID mice. The day of transplantation was defined as day 0. YS110 (10 mg/kg), gemcitabine (10 mg/kg), or YS110 (10 mg/kg)+gemcitabine (10 mg/kg) was intraperitoneally administered to the mice twice (days 2 and 4) (n=6). At day 7, their tumors were excised, and the tumor weights were measured. Significant difference was tested by two-tailed t-test (vs Cont). The interaction between YS110 and gemcitabine used concomitantly was analyzed by two-way ANOVA.
(249) The results are shown in
(Example 11) Concomitant Use with YS110 Against In Vivo Growth of CD26-Positive Lung Cancer Cell Line (1) Concomitant Use of YS110 and Cisplatin-Pemetrexed Against In Vivo Growth of CD26-Positive Lung Cancer Cell Line HCC827
(250) HCC827 cells (1.8×10.sup.5 cells/animal) were subcutaneously transplanted to the backs of female SCID mice. The day of transplantation was defined as day 0. At day 1, YS110 (10 mg/kg) alone, cisplatin (0.5 mg/kg)+pemetrexed (50 mg/kg), or YS110 (10 mg/kg)+cisplatin (0.5 mg/kg)+pemetrexed (50 mg/kg) was intraperitoneally administered to the mice. At day 4, the same amount of the same drug was administered by the same method as in day 1 (n=6). At day 7, their tumors were excised, and the tumor weights were measured. Significant difference was tested by two-tailed t-test (vs Cont).
(251) The results are shown in
(252) (2) Concomitant Use of YS110 and Gefitinib Against In Vivo Growth of CD26-Positive Lung Cancer Cell Line HCC4006 Cell
(253) HCC827 cells (0.5×10.sup.5 cells/animal) were subcutaneously transplanted to the backs of female SCID mice. The day of transplantation was defined as day 0. YS110 (10 mg/kg, intraperitoneal administration), gefitinib (100 mg/kg, oral administration), or YS110 (10 mg/kg, intraperitoneal administration)+gefitinib (100 mg/kg, oral administration) was administered to the mice twice (days 1 and 4). At day 7, their tumors were excised, and the tumor weights were measured. Significant difference was tested by two-tailed t-test (vs Cont).
(254) The results are shown in
(255) (3) Concomitant Use of YS110 and Gefitinib Against in Vivo Growth of CD26-Positive Lung Cancer Cell Line HCC827
(256) HCC827 cells (0.9×10.sup.5 cells/animal) were subcutaneously transplanted to the backs of female SCID mice. The day of transplantation was defined as day 0. YS110 (10 mg/kg, intraperitoneal administration), gefitinib (100 mg/kg, oral administration), or YS110 (10 mg/kg, intraperitoneal administration)+gefitinib (100 mg/kg, oral administration) was administered to the mice twice (days 1 and 4). At day 7, their tumors were excised, and the tumor weights were measured. Significant difference was tested by two-tailed t-test (vs Cont).
(257) The results are shown in
(Example 12) Study on Screening System to Eetermine Whether Chemotherapeutic can be Expected to Exhibit Synergistic Effect by Concomitant Use with CD26 Antibody
(258) Medication therapy is considered to exert a synergistic effect through the mutual action between involved molecules. This suggests the possibility that a chemotherapeutic that exerts an anticancer effect while mutually acting with CD26 can be expected to exhibit a synergistic effect by concomitant use with a CD26 antibody. CD26 and CD9 mutually act and counter with each other (Okamoto et al., PLOS One (2014) 9 (1): e86671). This suggests the possibility that the effect of a chemotherapeutic that mutually acts with CD26 is attenuated by CD9. Accordingly, mesothelioma cell lines MESO1 and H2452 coexpressing CD26 and CD9 and cell lines JMN and H226 expressing CD26 but expressing no CD9 were used in study on the setting of a screening system to determine whether a chemotherapeutic could be expected to exhibit a synergistic effect by concomitant use with a CD26 antibody.
(259) (1) Comparison of Growth Inhibitory Effects of Cisplatin and Pemetrexed Using MESO1 and JMN Cell Lines
(260) The growth inhibitory effects of cisplatin (10.sup.−9 to 10.sup.−4 M) and pemetrexed (10.sup.−9 to 10.sup.−4 M) were compared using the MESO1 and JMN cell lines.
(261) The results are shown in
(262) (2) Comparison of Growth Inhibitory Effect of Gemcitabine Using MESO1, H2452, JMN, and H226 Cell Lines
(263) The growth inhibitory effect of gemcitabine (10.sup.−9 to 10.sup.−4 M) was compared using MESO1, H2452, JMN, and H226 cell lines.
(264) The results are shown in
(265) As described above, cisplatin and pemetrexed did not differ in growth inhibitory effect between MESO1 cells (CD9+) and JMN cells (CD9−). In the experiments mentioned above, the concomitant use of the anti-CD26 antibody with cisplatin or pemetrexed was confirmed to have an additive effect, indicating that a synergistic effect is obtained by concomitant use with the anti-CD26 antibody when there is no difference in growth inhibitory effect between MESO1 cells (CD9+) and JMN cells (CD9-−. On the other hand, gemcitabine exhibited significant difference in growth inhibitory effect between MESO1 (CD9+) and JMN (CD9−) and between H2452 (CD9+) and H226 (CD9−). In the experiments mentioned above, the concomitant use of the anti-CD26 antibody with gemcitabine was confirmed to have a synergistic effect, indicating that a synergistic effect is obtained by concomitant use with the anti-CD26 antibody when there is a difference in growth inhibitory effect between CD9+ cells and CD9− cells. These results indicated that a chemotherapeutic that brings about a synergistic effect by concomitant use with a CD26 antibody can be screened for by using cells coexpressing CD26 and CD9 (e.g., MESO1 or H2452) and cells expressing CD26 but expressing no CD9 (JMN or H226).