Fusion respiratory syncytial virus inhibitors and use thereof
11299518 · 2022-04-12
Assignee
Inventors
- Origene Nyanguile (Grimisuat, CH)
- Jean-Manuel Segura (Vevey, CH)
- Dominique Garcin (Chens-Sur-Leman, FR)
Cpc classification
A61K38/16
HUMAN NECESSITIES
C12N2760/18534
CHEMISTRY; METALLURGY
C12N2760/18521
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention relates novel peptides useful for the prevention and/or treatment of respiratory syncytial virus (RSV) infections.
Claims
1. A compound selected from the group consisting of SEQ ID NOs: 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, and 49.
2. The compound according to claim 1, wherein said compound is SEQ ID NO: 36 or 37.
3. The compound according to claim 1, wherein said compound is SEQ ID NO: 38 or 39.
4. The compound according to claim 1, wherein said compound is SEQ ID NO: 40 or 41.
5. The compound according to claim 1, wherein said compound is SEQ ID NO: 42 or 43.
6. The compound according to claim 1, wherein said compound is SEQ ID NO: 44 or 45.
7. The compound according to claim 1, wherein said compound is SEQ ID NO: 46 or 47.
8. The compound according to claim 1, wherein said compound is SEQ ID NO: 48 or 49.
9. A pharmaceutical composition comprising at least one compound according to claim 1.
10. The pharmaceutical composition according to claim 9, wherein the composition further comprises at least one agent useful for the treatment of viral infections.
11. A method for reducing the likelihood of RSV infection or treating a subject suffering from a RSV infection comprising administering at least one compound according to claim 1 or a pharmaceutical formulation thereof to a subject in need thereof.
12. The method according to claim 11, wherein said RSV infection is lower respiratory infection caused by RSV.
13. The method according to claim 11, wherein said at least one compound is SEQ ID NO: 46.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
DETAILED DESCRIPTION OF THE INVENTION
(4) The term “efficacy” of a treatment according to the invention can be measured based on changes in the course of disease in response to a use according to the invention. For example, the efficacy of a treatment according to the invention can be measured by a decrease. As used herein, “treatment” and “treating” and the like generally mean obtaining a desired pharmacological and physiological effect. The effect may be prophylactic in terms of preventing or partially preventing a disease, symptom or condition thereof and/or may be therapeutic in terms of a partial or complete cure of a disease, condition, symptom or adverse effect attributed to the disease.
(5) The term “treatment” as used herein covers any treatment of a disease in a mammal, particularly a human, and includes: (a) preventing the disease from occurring in a subject which may be predisposed to the disease but has not yet been diagnosed as having it; (b) inhibiting the disease, i.e., arresting its development; or relieving the disease, i.e., causing regression of the disease and/or its symptoms or conditions. For example, the ability of the compounds of invention in inhibiting RSV fusion can be tested in known assays such as an antiviral MTT assay, a virus yield reduction assay, effect of time addition, virus inactivation, inhibition on viral RNA and protein synthesis, resistance studies (Andries, 2003, Antiviral Res., 60 209-219), plaque assay, syncytia formation assay, viral fusion assay, genotypic profiling or those described therein.
(6) As another example, the efficacy of the compounds of invention in the treatment of RSV related disorders can be assayed in the viral load, total mucus weight, sputum, change from baseline in total symptom-diary scores to the end of the quarantine period. The term “subject” as used herein refers to mammals. For examples, mammals contemplated by the present invention include human, primates, domesticated animals such as cattle, sheep, pigs, horses, laboratory rodents and the like.
(7) The term “pharmaceutically active derivative” refers to any compound that upon administration to the recipient, is capable of providing directly or indirectly, the activity disclosed herein.
(8) The term “cross-linking bridge” or “staple” refers to cross-linking between two non-contiguous amino acid residues of a peptide obtained via a hydrocarbon “staple” selected from an olefin-containing side chain such as described in Kim et al., 2011, Nature Protocols 6, 761-771; Verdine et al., 2011, Methods in Enzymology, 503, 3-33, and obtainable by ring-closing olefin metathesis (RCM), a disulfide bridge such as described in Jackson et al., 1991, Journal of the American Chemical Society, 113(24) 9391-9392; an ABA (4-aminobenzoic acid) residue, AMBA (4-(aminomethyl, benzoic acid) residue, APA (4-aminophenyl acetic acid) residue and AMPA (p-(aminomethyl)phenylacetic acid) residue with ((S)-2,3-diaminopropionic acid residue (Dap) in position 3 is linked to Glu.sup.10 via the carboxyl function of a bridging 4-(aminomethyl)phenylacetic acid residue) staple such as described in Yu et al., 1999, Bioorganic and Medicinal Chemistry, 7(1), 161-175; a lactam-bridge such as described in Ösapay et al., 1992, Journal of the American Chemical Society, 114 (18), 6966-6973, 1992, a disulfide bridge (Jackson et al., 1991, Journal of the American Chemical Society, 113(24) 9391-9392, a thio-based bridge (Mas-Moruno, Angew. Chem. Int. ed. 2011, 50, 9496), a thioether bond, biaryl-bridges, bridges obtained through the incorporation of heterocycles, and carbon-carbon bonds (White et al., 2011, Nat. Chem., 3, 509; Marsault et al., 2011, J. Med. Chem., 54, 1961) and perfluoroaromatic staples (Spokoyny et al., 2013, Journal of the American Chemical Society, 135, 5946-5949). Alternatively, the crosslinking bridges between the aminoacids are achieved via double olefin bearing amino acids which allow forming dual hydrocarbon staples emerge from common attachment points in the peptide as described in Hilinski et al., 2014, JACS, 136, 12314-12322. In this case, only three olefin-bearing amino acids are necessary to form a total of two cross-linking bridges.
(9) According to a particular embodiment, cross-linked amino acids are of the following Formula (III):
(10) ##STR00001##
wherein R.sup.1 is a residue from a natural or non-natural such as alanine or glycine (e.g. methyl or H) and m is an integer from 0 to 5, such as from 2 to 5, in particular 2. According to a particular embodiment, cross-linked amino acids are selected from —(S)-2-(3-butenyl)alanine, —(R)-2-(3-butenyl)alanine, (S)-2-(4-pentenyl)alanine, (R)-2-(4-pentenyl)alanine, —(S)-2-(5-hexenyl)alanine, (R)-2-(5-hexenyl)alanine —(S)-2-(6-heptenyl)alanine, —(R)-2-(6-heptenyl)alanine, (S)-2-(7-octenyl)alanine, (R)-2-(7-octenyl)alanine, —(S)-2-(3-butenyl)glycine, —(R)-2-(3-butenyl)glycine (S)-2-(4-pentenyl)glycine, (R)-2-(pentenyl)glycine, —(S)-2-(5-hexenyl)glycine, (R)-2-(5-hexenyl)glycine —(S)-2-(6-heptenyl)glycine, —(R)-2-(6-heptenyl)glycine (S)-2-(7-octenyl)glycine and (R)-2-(7-octenyl)glycine and 2,2-bis(4-pentenyl)glycine.
(11) According to a further particular embodiment, cross-linked amino acids are selected from (S)-2-(4-pentenyl)alanine, (R)-2-(4-pentenyl)alanine and (R)-2-(4-pentenyl)glycine.
(12) According to a further particular embodiment, cross-linked amino acids are (S)-2-(4-pentenyl)glycine.
(13) According to a further particular embodiment, cross-linked amino acids are selected from (S)-2-(4-pentenyl)alanine.
(14) According to a further particular embodiment, cross-linked amino acids are selected from (S)-2-(4-pentenyl)alanine and (R)-2-(4-pentenyl)alanine.
(15) According to a further particular embodiment, cross-linked amino acids are selected from (R)-2-(4-pentenyl)alanine and (S)-2-(4-pentenyl)glycine.
(16) According to a particular embodiment, cross-linked amino acids are of Formula (III) wherein R.sup.1 is methyl and m is an integer from 2 to 5, in particular 2.
(17) According to a particular embodiment, cross-linked amino acids are of the following Formula (IV):
(18) ##STR00002##
wherein and m is an integer from 0 to 5, such as from 2 to 5, in particular 2.
(19) According to another particular embodiment, cross-linked amino acids are of Formula (IV) wherein m is an integer from 2 to 5, in particular 2.
(20) According to a particular embodiment, cross-linked amino acids are selected from one olefin bearing amino-acids such as on (S)-α-methyl,α-pentenylglycine and (S)-α-methyl,α-octenylglycine or (R)-α-methyl, α-pentenylglycine and (R)-α-methyl,α-octenylglycine and two olefin-bearing amino acids such as bispentenylglycine (B5, 2-(((9H-Fluoren-9-yl)methoxy)-carbonylamino)-2-(pent-4-enyl)hept-6-enoic acid).
(21) The term “variant”, applied to a peptide or polypeptide, as referred to herein means a peptide or polypeptide substantially homologous to the referenced peptide sequence, but which has at least one amino acid different from that of the referenced sequence because of one or more amino acid deletion, insertion and/or substitution. Substantially homologous means a variant amino acid sequence which is identical to the referenced peptide sequence except for the deletion, insertion and/or substitution of 1, 2, 3, 4, 5 or 6 amino acid residues. In a more particular embodiment, a variant amino acid sequence is identical to the referenced peptide sequence except for the deletion and/or conservative substitution of 1, 2, 3, 4, 5 or 6 amino acid residues. The identity of two amino acid sequences can be determined by visual inspection and/or mathematical calculation, or more easily by comparing sequence information using known computer program used for sequence comparison such as Clustal package version 1.83. A variant may comprise a sequence having at least one conservatively substituted amino acid, meaning that a given amino acid residue is replaced by a residue having similar physicochemical characteristics. Examples of conservative substitutions include substitution of one aliphatic residue for another, such as Ile, Val, Leu, or Ala for one another, or substitutions of one polar residue for another, such as between Lys and Arg; Glu and Asp; or Gln and Asn. Amino acid hydrophobicity can be found on the basis of known scales such as Kyte, et al, 1982, J. Mol. Biol., 157: 105-131; Eisenberg, 1984, Ann. Rev. Biochem., 53: 595-623. Other such conservative substitutions, for example, substitutions of entire regions having similar hydrophobicity characteristics or α-helical propensity, are well known (Kyte, et al, 1982, supra). For example, a “conservative amino acid substitution” may involve a substitution of a native amino acid residue with a non-native residue such that there is little or no effect on the polarity or charge of the amino acid residue at that position. Desired amino acid substitutions (whether conservative or non-conservative) can be determined by those skilled in the art at the time such substitutions are desired. Exemplary amino acid substitutions are presented in Tables 1a and 1b below. The term “variant” also includes a peptide or polypeptide substantially homologous to the referenced peptide sequence, but which has an amino acid sequence different from that of the referenced sequence because one or more amino acids have been chemically modified or substituted by amino acids analogs. For example non-natural residues can be introduced to enhance the pharmacological properties of peptide-based therapeutics (Geurink et al., 2013, J. Med. Chem., 56, 1262; Rand et al., 2012, Med. Chem. Commun, 3, 1282). According to a particular embodiment, apolar amino acid according to the invention can be a non-natural amino acid. In particular, an apolar amino acid can be selected from a non-polar amino acid from Table 1a:
(22) TABLE-US-00001 TABLE 1a Name Abbreviation Structure L-2-Cyclopentyl- Glycine Cpg
(23) The term “indirectly” also encompasses active forms of compounds of the invention into which the compounds of Formula (I) may be converted for example via endogenous enzymes or metabolism. Compounds of Formula (I) comprise chemically or metabolically decomposable groups and may be converted into a pharmaceutically active compound in vivo under physiological conditions.
(24) The invention further encompasses any tautomers, geometrical isomers, optically active forms as enantiomers, diastereomers and racemate forms of the compounds according to the invention.
(25) TABLE-US-00002 TABLE 1b Amino acids Examples of « conservative » substitutions Ala (A) Val, Leu, Ile Arg (R) Lys, Gln, Asn Asn (N) Gln Asp (D) Glu Cys (C) Ser, Ala Gln (Q) Asn Glu (E) Asp Gly (G) Pro, Ala His (H) Asn, Gln, Lys, Arg Ile (I) Leu, Val, Met, Ala, Phe, Norleucine Leu (L) Ile, Val, Met, Ala, Phe, Norleucine Lys (K) Arg, Gln, Asn Met (M) Leu, Ile, Phe Phe (F) Leu, Val, Ile, Ala, Tyr Pro (P) Ala, Gly Ser (S) Thr, Ala, Cys Trp (W) Phe, Tyr Thr (T) Ser Tyr (Y) Trp, Phe, Thr, Ser Val (V) Ile Met, Leu, Phe, Ala, Norleucine
(26) According to another particular embodiment, the peptides of the invention can be optionally acetylated at the N-terminus and/or amidated at the C-terminus.
(27) The term “pharmaceutical formulation” refers to preparations which are in such a form as to permit biological activity of the active ingredient(s) to be unequivocally effective and which contain no additional component which would be toxic to subjects to which the said formulation would be administered.
(28) Compounds of the Invention
(29) According to one aspect, is provided a compound comprising the following amino acid sequence:
(30) Xaa1 Xaa2 Xaa3 Xaa4 Xaa5 Xaa6 Xaa7 Xaa8 Xaa9 Xaa10 Xaa11 Xaa12 Xaa13 Xaa14 Xaa15 Xaa16 Xaa17 Xaa18 Xaa19 Xaa20 (SEQ ID NO: 1), wherein Xaa1, Xaa6, Xaa14 and Xaa18 are independently selected from any amino acid; Xaa2, Xaa4, Xaa5 and Xaa19 are independently selected from any amino acid or a cross-linked amino-acid; Xaa3, Xaa7, Xaa9, Xaa10, Xaa16, Xaa17 and Xaa20 are an independently selected apolar amino acid. Examples of apolar amino-acid comprise Ile, Leu, Phe, Val and Ala; Xaa8 is a cross-linked amino-acid; Xaa11 and Xaa12 are independently selected from a polar amino acid and a cross-linked amino-acid. Examples of polar amino-acid comprise Arg, Lys, Asp and Glu; Xaa13 is Serine and Xaa15 is selected from a polar amino acid, such as Glu, Asp, Arg, and Lys and a cross-linked amino-acid, wherein the peptide contains a total of two cross-linking bridges, each between two cross-linked amino acids spaced by 2 or three amino-acids (i, i+3 and/or i, i+4 staples), as well as pharmaceutically acceptable salts and pharmaceutically active variants thereof.
(31) According to a particular embodiment, is provided a compound consisting of SEQ ID NO: 1 and pharmaceutically active variants thereof.
(32) According to another particular aspect, a pharmaceutically active variant according to the invention consists in SEQ ID NO: 1 wherein 1, 2, 3, 4, 5 or 6 amino acid residues have been deleted at positions not bearing a cross-linked bridge.
(33) According to another further particular aspect, a pharmaceutically active variant according to the invention consists in SEQ ID NO: 1 wherein 1 or 2 amino acid residues have been deleted at the N-terminus when those positions not bearing a cross-linked bridge.
(34) According to another further particular aspect, a pharmaceutically active variant according to the invention consists in SEQ ID NO: 1 wherein 1, 2 or 3 amino acid residues have been deleted at the C-terminus when those positions not bearing a cross-linked bridge.
(35) According to a further aspect, is provided a compound comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa1 is Glu or Ala, more particularly Glu.
(36) According to a further aspect, is provided a compound comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa2 is Lys or Ala, more particularly Lys or a cross-linked amino-acid, in particular (R)-2-(4-pentenyl)alanine.
(37) According to a further aspect, is provided a compound comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa3 is Ile or Ala, more particularly Ile.
(38) According to a further aspect, is provided a compound comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa4 is Asn, Glu or a cross-linked amino-acid, in particular (S)-2-(4-pentenyl)alanine.
(39) According to a further aspect, is provided a compound comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa5 is Gln or a cross-linked amino-acid, in particular (S)-2-(4-pentenyl)alanine.
(40) According to a further aspect, is provided a compound comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa6 is Ser or Ala, more particularly Ser.
(41) According to a further aspect, is provided a compound comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa7 is Leu or Ala, more particularly Leu.
(42) According to a further aspect, is provided a compound comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa7 is a non-natural apolar amino acid, more particularly one selected from Cpg, tBa, Cha and Chg, in particular Cpg, tBa and Chg.
(43) According to a further aspect, is provided a compound comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa8 is (S)-2-(4-pentenyl)alanine.
(44) According to a further aspect, is provided a compound comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa9 is Phe or Ala, more particularly Phe.
(45) According to a further aspect, is provided a compound comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa10 is Ile or Ala, more particularly Ile. According to a further aspect, is provided a compound comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa11 is Arg or a cross-linked amino-acid, in particular (S)-2-(4-pentenyl)alanine.
(46) According to a further aspect, is provided a compound comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa12 is Lys or a cross-linked amino-acid, in particular (S)-2-(4-pentenyl)alanine.
(47) According to a further aspect, is provided a compound comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa14 is Asp or Ala, more particularly Asp.
(48) According to a further aspect, is provided a compound comprising the amino acid sequence of SEQ ID NO: 2, wherein Xaa15 is Glu or a cross-linked amino-acid, in particular (S)-2-(4-pentenyl)alanine.
(49) According to a further aspect, is provided a compound comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa16 is Leu or Ala, more particularly Leu.
(50) According to a further aspect, is provided a compound comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa16 is a non-natural apolar amino acid, more particularly one selected from Cpg, tBa, Cha and Chg, in particular tBa and Cha.
(51) According to a further aspect, is provided a compound comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa17 is Leu or Ala, more particularly Leu.
(52) According to a further aspect, is provided a compound comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa17 is a non-natural apolar amino acid, more particularly one selected from Cpg, tBa, Cha and Chg, in particular tBa.
(53) According to a further aspect, is provided a compound comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa18 is His or Ala, more particularly His.
(54) According to a further aspect, is provided a compound comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa19 is Asn, Ala, more particularly Asn or a cross-linked amino-acid, in particular (S)-2-(4-pentenyl)alanine.
(55) According to a further aspect, is provided a compound comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa20 is Val or Ala, more particularly Val.
(56) According to another further embodiment, is provided a peptide of the invention comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa4, Xaa8, Xaa11 and Xaa15 are each independently a cross-linked amino-acid (SEQ ID NO: 2).
(57) According to another further embodiment, is provided a peptide of the invention comprising the following amino acid sequence: Glu Lys Ile Xaa4 Gln Ser Leu Xaa8 Phe Ile Xaa11 Lys Ser Asp Xaa15 Leu Leu His Asn Val (SEQ ID NO: 3), wherein Xaa4, Xaa8, Xaa11 and Xaa15 are each independently a cross-linked amino-acid, for example independently a cross-linked amino-acid of Formula (III), as well as pharmaceutically acceptable salts and pharmaceutically active variants thereof.
(58) According to another further embodiment, is provided a peptide of the invention comprising a sequence of SEQ ID NO: 2 or 3, wherein the cross-linked amino-acids are (S)-2-(4-pentenyl)alanine.
(59) According to another further embodiment, is provided a peptide of the invention comprising a sequence of SEQ ID NO: 2 or 3, wherein the cross-linked amino-acids are (S)-2-(4-pentenyl)glycine.
(60) According to another further embodiment, is provided a peptide of the invention of SEQ ID NO: 35.
(61) According to another further embodiment, is provided a peptide of the invention of formula (C1).
(62) According to another further embodiment, is provided a peptide of the invention of formula (C3).
(63) According to another further embodiment, is provided a peptide of the invention comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa2, Xaa5, Xaa8 and Xaa12 are each independently a cross-linked amino-acid are each independently a cross-linked amino-acid (SEQ ID NO: 17).
(64) According to another further embodiment, is provided a peptide of the invention comprising the following amino acid sequence: Glu Xaa2 Ile Asn Xaa5 Ser Leu Xaa8 Phe Ile Arg Xaa12 Ser Asp Glu Leu Leu His Asn Val (SEQ ID NO: 18), wherein Xaa2, Xaa5, Xaa8 and Xaa12 are each independently a cross-linked amino-acid, as well as pharmaceutically acceptable salts and pharmaceutically active variants thereof.
(65) According to another further embodiment, is provided a peptide of the invention comprising a sequence of SEQ ID NO: 17 or 18, wherein the cross-linked amino-acids are (S)-2-(4-pentenyl)alanine or (R)-2-(4-pentenyl)alanine.
(66) According to another further embodiment, is provided a peptide of the invention comprising a sequence of SEQ ID NO: 17 or 18, wherein the cross-linked amino-acids are (R)-2-(4-pentenyl)alanine or (S)-2-(4-pentenyl)glycine.
(67) According to another further embodiment, is provided a peptide of the invention comprising a sequence of SEQ ID NO: 17 or 18, wherein the cross-linked amino-acids Xaa5, Xaa8 and Xaa12 are (S)-2-(4-pentenyl) alanine and Xaa2 is (R)-2-(4-pentenyl)alanine.
(68) According to another further embodiment, is provided a peptide of the invention comprising a sequence of SEQ ID NO: 17 or 18, wherein the cross-linked amino-acids Xaa5, Xaa8 and Xaa12 are (S)-2-(4-pentenyl)glycine and Xaa2 is (R)-2-(4-pentenyl)alanine.
(69) According to another further embodiment, is provided a peptide of the invention of SEQ ID NO: 36.
(70) According to another further embodiment, is provided a peptide of the invention of SEQ ID NO: 49.
(71) According to another further embodiment, is provided a variant of peptide of SEQ ID NO: 36 according to the invention.
(72) According to another further embodiment, is provided a variant of peptide of SEQ ID NO: 17 according to the invention wherein Xaa1 is deleted.
(73) According to another further embodiment, is provided a variant of peptide of SEQ ID NO: 17 according to the invention wherein Xaa7 is a non-natural apolar amino acid.
(74) According to another further embodiment, is provided a variant of peptide of SEQ ID NO: 17 according to the invention wherein Xaa19 and Xaa20 are deleted.
(75) According to another further embodiment, is provided a variant of peptide of SEQ ID NO: 17 according to the invention wherein Xaa18, Xaa19 and Xaa20 are deleted.
(76) According to another further embodiment, is provided a variant of peptide of SEQ ID NO: 17 according to the invention wherein Xaa16 is a non-natural apolar amino acid.
(77) According to another further embodiment, is provided a variant of peptide of SEQ ID NO: 17 according to the invention wherein Xaa17 is a non-natural apolar amino acid. According to another further embodiment, is provided a variant of peptide of SEQ ID NO: 17 according to the invention wherein Xaa16 and/or Xaa17 is a non-natural apolar amino acid selected from Table 1a or isomers thereof.
(78) According to another further embodiment, is provided a variant of peptide of SEQ ID NO: 17 according to the invention wherein Xaa16 and/or Xaa17 is tBa.
(79) According to another further embodiment, is provided a peptide of the invention of formula (C2).
(80) According to another further embodiment, is provided a variant of peptide of SEQ ID NO: 36 according to the invention.
(81) According to another further embodiment, is provided a variant of peptide of SEQ ID NO: 49.
(82) According to another further embodiment, is provided a peptide of the invention of formula (C6).
(83) According to another further embodiment, is provided a variant of peptide of SEQ ID NO: 36 selected from a peptide of SEQ ID NOs: 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48 and 49.
(84) According to another further embodiment, is provided a peptide of the invention comprising the amino acid sequence of SEQ ID NO: 1, wherein Xaa8, Xaa12, Xaa15, and Xaa19 are each independently a cross-linked amino-acid (SEQ ID NO: 33).
(85) According to another further embodiment, is provided a peptide of the invention comprising the following amino acid sequence: Glu Lys Ile Asn Gin Ser Leu Xaa8 Phe Ile Arg Xaa12 Ser Asp Xaa15 Leu Leu His Xaa19 Val (SEQ ID NO: 34), wherein Xaa8, Xaa12, Xaa15 and Xaa19 are each independently a cross-linked amino-acid, as well as pharmaceutically acceptable salts and pharmaceutically active variants thereof.
(86) According to another further embodiment, is provided a peptide of the invention comprising a sequence of SEQ ID NO: 33 or 34, wherein the cross-linked amino-acids are (S)-2-(4-pentenyl)alanine.
(87) According to another further embodiment, is provided a peptide of the invention comprising a sequence of SEQ ID NO: 33 or 34, wherein the cross-linked amino-acids are (S)-2-(4-pentenyl)glycine.
(88) According to another further embodiment, is provided a peptide of the invention of SEQ ID NO: 19, as well as pharmaceutically acceptable salts and pharmaceutically active variants thereof.
(89) According to another further embodiment, is provided a peptide of the invention of SEQ ID NO: 50, as well as pharmaceutically acceptable salts and pharmaceutically active variants thereof.
(90) According to another further embodiment, is provided a peptide of the invention of SEQ ID NO: 20, as well as pharmaceutically acceptable salts and pharmaceutically active variants thereof.
(91) According to another further embodiment, is provided a peptide of the invention of formula (C4).
(92) According to another further embodiment, is provided a peptide of the invention of formula (C5).
(93) According to another further embodiment, is provided a peptide of the invention of formula (C7).
(94) According to a particular embodiment, a variant of a peptide according to the invention is selected from the group consisting of: V4bb.sub.497, V4bb.sub.498, V4bb.sub.499, V4bb.sub.501, V4bb.sub.502 V4bb.sub.503, V4bb.sub.505, V4bb.sub.510, V4bb.sub.512, V4bb.sub.514, V4bb.sub.515 and V4bb.sub.516 (SEQ ID NO.: 4-6 and 8 to 16) as defined herein.
(95) According to a particular embodiment, a variant of a peptide according to the invention is V4a.sub.500 (SEQ NO.: 7).
(96) According to a particular embodiment, a variant of a peptide according to the invention is V4ca.sub.515 (SEQ NO.: 37).
(97) According to a particular embodiment, a variant of a peptide according to the invention encompasses fragments of SEQ ID NO: 1 which can have between about 17 and about 20 amino acids. According to a further particular embodiment, a variant of a peptide according to the invention can be a fragment of SEQ ID NO: 1, wherein 1, 2, 3, 4, 5, 6 or 7 amino acid(s), for example 1, 2, 3 or 4, is (are) removed at the N or C-terminus not bearing a cross-linked bridge.
(98) According to a further particular embodiment, a variant of a peptide according to the invention wherein Xaa1 is deleted.
(99) According to another further particular embodiment, a variant of a peptide according to the invention wherein Xaa20 is deleted.
(100) According to another further particular embodiment, a variant of a peptide according to the invention wherein Xaa20 and Xaa19, when not bearing a cross-linked bridge, are deleted.
(101) According to another further particular embodiment, a variant of a peptide according to the invention wherein Xaa20 and Xaa19 and Xaa18, when not bearing a cross-linked bridge, are deleted.
(102) According to a further particular embodiment, a variant of a peptide according to the invention wherein Xaa1, Xaa20, Xaa18 and Xaa19, when not bearing a cross-linked bridge, are deleted.
(103) According to a particular embodiment, the cross-linked amino-acids are C-alpha alkylated, in particular methylated.
(104) According to a particular embodiment, the cross-linked amino-acids are both C-alpha alkylated, in particular methylated and acetylated at the N-terminus.
(105) Compositions
(106) The invention provides pharmaceutical or therapeutic agents as compositions and methods for treating a subject, preferably a human subject who is suffering from a medical disorder, and in particular a disorder associated with RSV infection such as lower respiratory disorders.
(107) Pharmaceutical compositions of the invention can contain one or more compound according to the invention in any form described herein. Compositions of this invention may further comprise one or more pharmaceutically acceptable additional ingredient(s) such as alum, stabilizers, antimicrobial agents, buffers, coloring agents, flavoring agents, adjuvants, and the like.
(108) The compounds of the invention, together with a conventionally employed adjuvant, carrier, diluent or excipient may be placed into the form of pharmaceutical compositions and unit dosages thereof, and in such form may be employed as solids, such as tablets or filled capsules, or liquids such as solutions, suspensions, emulsions, elixirs, or capsules filled with the same, all for oral use, or in the form of sterile injectable solutions for parenteral (including subcutaneous) use. Such pharmaceutical compositions and unit dosage forms thereof may comprise ingredients in conventional proportions, with or without additional active compounds or principles, and such unit dosage forms may contain any suitable effective amount of the active ingredient commensurate with the intended daily dosage range to be employed. Compositions according to the invention are preferably sprayable or inhalable.
(109) Compositions of this invention may also be liquid formulations including, but not limited to, aqueous or oily suspensions, solutions, emulsions, syrups, and elixirs. Liquid forms suitable for oral administration may include a suitable aqueous or non-aqueous vehicle with buffers, suspending and dispensing agents, colorants, flavors and the like. The compositions may also be formulated as a dry product for reconstitution with water or other suitable vehicle before use. Such liquid preparations may contain additives including, but not limited to, suspending agents, emulsifying agents, non-aqueous vehicles and preservatives. Suspending agent include, but are not limited to, sorbitol syrup, methyl cellulose, glucose/sugar syrup, gelatin, hydroxyethylcellulose, carboxymethyl cellulose, aluminum stearate gel, and hydrogenated edible fats. Emulsifying agents include, but are not limited to, lecithin, sorbitan monooleate, and acacia. Non-aqueous vehicles include, but are not limited to, edible oils, almond oil, fractionated coconut oil, oily esters, propylene glycol, and ethyl alcohol. Preservatives include, but are not limited to, methyl or propyl p-hydroxybenzoate and sorbic acid. Further materials as well as processing techniques and the like are set out in The Science and Practice of Pharmacy (Remington: The Science & Practice of Pharmacy), 22.sup.nd Edition, 2012, Lloyd, Ed. Allen, Pharmaceutical Press, which is incorporated herein by reference.
(110) Solid compositions of this invention may be in the form of tablets or lozenges formulated in a conventional manner. For example, tablets and capsules for oral administration may contain conventional excipients including, but not limited to, binding agents, fillers, lubricants, disintegrants and wetting agents. Binding agents include, but are not limited to, syrup, acacia, gelatin, sorbitol, tragacanth, mucilage of starch and polyvinylpyrrolidone. Fillers include, but are not limited to, lactose, sugar, microcrystalline cellulose, maizestarch, calcium phosphate, and sorbitol. Lubricants include, but are not limited to, magnesium stearate, stearic acid, talc, polyethylene glycol, and silica. Disintegrants include, but are not limited to, potato starch and sodium starch glycolate. Wetting agents include, but are not limited to, sodium lauryl sulfate. Tablets may be coated according to methods well known in the art.
(111) Injectable compositions are typically based upon injectable sterile saline or phosphate-buffered saline or other injectable carriers known in the art.
(112) Compositions of this invention may also be formulated as suppositories, which may contain suppository bases including, but not limited to, cocoa butter or glycerides. Compositions of this invention may also be formulated for inhalation, which may be in a form including, but not limited to, a solution, suspension, or emulsion that may be administered as a dry powder or in the form of an aerosol using a propellant, such as dichlorodifluoromethane or trichlorofluoromethane.
(113) Compositions of this invention may also be formulated transdermal formulations comprising aqueous or non-aqueous vehicles including, but not limited to, creams, ointments, lotions, pastes, medicated plaster, patch, or membrane.
(114) Compositions of this invention may also be formulated for parenteral administration including, but not limited to, by injection or continuous infusion. Formulations for injection may be in the form of suspensions, solutions, or emulsions in oily or aqueous vehicles, and may contain formulation agents including, but not limited to, suspending, stabilizing, and dispersing agents. The composition may also be provided in a powder form for reconstitution with a suitable vehicle including, but not limited to, sterile, pyrogen-free water.
(115) Compositions of this invention may also be formulated as a depot preparation, which may be administered by implantation or by intramuscular injection. The compositions may be formulated with suitable polymeric or hydrophobic materials (as an emulsion in an acceptable oil, for example), ion exchange resins, or as sparingly soluble derivatives (as a sparingly soluble salt, for example).
(116) Compositions of this invention may also be formulated as a liposome preparation. The liposome preparation can comprise liposomes which penetrate the cells of interest or the stratum corneum, and fuse with the cell membrane, resulting in delivery of the contents of the liposome into the cell. Other suitable formulations can employ niosomes. Niosomes are lipid vesicles similar to liposomes, with membranes consisting largely of non-ionic lipids, some forms of which are effective for transporting compounds across the stratum corneum.
(117) The compounds of this invention can also be administered in sustained release forms or from sustained release drug delivery systems. A description of representative sustained release materials can also be found in the incorporated materials in Remington's Pharmaceutical Sciences.
(118) Alternatively, compositions of this invention may also be formulated as an aerosolable solution or an inhalable pharmaceutically acceptable composition, e.g. suitable for prevention and/or treatment of respiratory diseases. In such a formulation, the compound according to the invention is prepared for example as an inhalable dry powder or as an aerosolable solution.
(119) Mode of Administration
(120) Compositions of this invention may be administered/delivered in any manner including, but not limited to, orally, parenterally, sublingually, transdermally, transmucosally, topically, via inhalation, via buccal or intranasal administration, or combinations thereof. Parenteral administration includes, but is not limited to, intravenous, intra-arterial, intra-peritoneal, subcutaneous and intramuscular.
(121) The compositions of this invention may also be administered in the form of an implant, which allows slow release of the compositions as well as a slow controlled i.v. infusion.
(122) In another particular embodiment, a compound according to the invention is administered systemically by injection.
(123) In another particular embodiment, a compound according to the invention is administered by inhalation or spraying.
(124) In a specific embodiment, the method according to the invention is a method of administering a compound according to the invention to the lungs of a subject, comprising: dispersing a dry powder composition or an inhalable formulation comprising a compound according to the invention to form an aerosol; and delivering the aerosol to the lungs of the subject by inhalation of the aerosol by the subject, thereby ensuring delivery of the compound according to the invention to the lungs of the subject. Typically, the aerosol is delivered to the endobronchial space of airways from the subject.
(125) For example, the compound according to the invention is delivered by a dry powder inhaler or by a metered dose inhaler.
(126) This invention is further illustrated by the following examples that are not intended to limit the scope of the invention in any way.
(127) The dosage administered, as single or multiple doses, to an individual will vary depending upon a variety of factors, including pharmacokinetic properties, subject conditions and characteristics (sex, age, body weight, health, size), extent of symptoms, concurrent treatments, frequency of treatment and the effect desired.
(128) Combination
(129) According to the invention, the compound can be administered alone or in combination with a co-agent useful in the prevention and/or treatment of a viral infection such as for example Synagis (Mejias et al., 2008. Biologics, 2 (3), 433-439) and also with the non-fusion inhibitors currently in the clinics ALX-0171 (Detalle L et al., 2017, supra) and ALS-008176 (DeVincenzo, et al., 2015, N Engl J Med, 373:2048-2058) or further inhibitors targeting the RSV N0-P complex (WO 2015/135925), RV568/JnJ 49095397 (protein kinase inhibitor) and ALN-RSV01.
(130) According to a particular aspect, the compounds of the invention are administered in combination with at least one smoothened receptor (Smo) antagonist as a co-agent such as described in Bailly et al., 2016, Scientific Reports, 6: 25806.
(131) According to a particular aspect, the said Smo antagonist is selected from cyclopamine or jervine.
(132) The invention encompasses the administration of a compound of the invention wherein the compound is administered to an individual prior to, simultaneously or sequentially with other therapeutic regimens or co-agents useful in the prevention and/or treatment of respiratory diseases or disorders such as asthma and bronchiolitis (e.g. multiple drug regimens), in a therapeutically effective amount.
(133) The invention encompasses the administration of a compound of the invention wherein the compound is administered to an individual prior to, simultaneously or sequentially with other co-agents useful in the prevention and/or treatment. The compound according to the invention that is administered simultaneously with said co-agents can be administered in the same or different compositions and in the same or different routes of administration.
(134) Patients
(135) In an embodiment, subjects according to the invention are patients suffering from or at risk of suffering from a disease or disorder related to a RSV infection, especially lower respiratory infections.
(136) In another embodiment, patients according to the invention are patients suffering from severe asthma and bronchiolitis due to RSV infection.
USE ACCORDING TO THE INVENTION
(137) The compounds according to the invention are useful in the prevention and/or treatment of a disease or a disorder related to a RSV infection, especially lower respiratory infections caused by RSV.
(138) Within the context of this invention, the beneficial effect includes but is not limited to an attenuation, reduction, decrease or diminishing of the pathological development after onset of the disease.
(139) In one embodiment, the invention provides a compound of SEQ ID NO: 1 or variants thereof for use according to the invention.
(140) In another embodiment, the invention provides a compound for use according to the invention, wherein the compound is of SEQ ID NO: 2 or a variant thereof.
(141) In another embodiment, the invention provides a compound for use according to the invention, wherein the compound is of SEQ ID NO: 3 or a variant thereof.
(142) In another embodiment, the invention provides a compound for use according to the invention, wherein the compound is of SEQ ID NO: 17 or a variant thereof.
(143) In another embodiment, the invention provides a compound for use according to the invention, wherein the variant is of SEQ ID NO: 4-6 or 8 to 16.
(144) In another embodiment, the invention provides a compound for use according to the invention, wherein the compound is of SEQ ID NO: 33 or a variant thereof.
(145) In another embodiment, the invention provides a compound for use according to the invention, wherein the variant is of SEQ ID NO: 34 or a variant thereof.
(146) In another embodiment, the invention provides a compound for use according to the invention, wherein the variant is of SEQ ID NO: 18 or a variant thereof.
(147) In another embodiment, the invention provides a compound for use according to the invention, wherein the compound is of SEQ ID NO: 36 or a variant thereof.
(148) In another embodiment, the invention provides a compound for use according to the invention, wherein the variant is of SEQ ID NO: 37.
(149) In another embodiment, the invention provides a compound for use according to the invention, wherein the variants are selected from a compound of SEQ ID NO: 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48 and 49.
(150) In another embodiment, the invention provides a compound for use according to the invention, wherein the variants are selected from a compound of SEQ ID NO: 38, 39, 43, 44, 45, 46, 47 and 49.
(151) In another embodiment, the invention provides a compound for use according to the invention, wherein the compound is of SEQ ID NO: 19 or a variant thereof.
(152) In another embodiment, the invention provides a compound for use according to the invention, wherein the compound is of SEQ ID NO: 50 or a variant thereof.
(153) In another embodiment, the invention provides a compound for use according to the invention, wherein the variant is of SEQ ID NO: 7.
(154) In another embodiment, the invention provides a compound for use according to the invention, wherein the compound is of SEQ ID NO: 20 or a variant thereof.
(155) In another embodiment, the invention provides a compound for use according to the invention, wherein the compound is of Formula (C1).
(156) In another embodiment, the invention provides a compound for use according to the invention, wherein the compound is of Formula (C2).
(157) In another embodiment, the invention provides a compound for use according to the invention, wherein the compound is of Formula (C3).
(158) In another embodiment, the invention provides a compound for use according to the invention, wherein the compound is of Formula (C4).
(159) In another embodiment, the invention provides a compound for use according to the invention, wherein the compound is of Formula (C5).
(160) In another embodiment, the invention provides a compound for use according to the invention, wherein the compound is of Formula (C6) and isomers thereof.
(161) In another embodiment, the invention provides a compound for use according to the invention, wherein the compound is of Formula (C7).
(162) In a further embodiment, the mammal is human, in particular a newborn or infant.
(163) The novel derivatives according to the invention can be prepared from readily available starting materials using the following general methods and procedures. It will be appreciated that where typical or preferred experimental conditions (i.e. reaction temperatures, time, moles of reagents, solvents etc.) are given, other experimental conditions can also be used unless otherwise stated. Optimum reaction conditions may vary with the particular reactants or solvents used, but such conditions can be determined by the person skilled in the art, using routine optimization procedures.
(164) In particular, cross-linked amino acids according to the invention can be obtained as described herein.
(165) References cited herein are hereby incorporated by reference in their entirety. The present invention is not to be limited in scope by the specific embodiments described herein, which are intended as single illustrations of individual aspects of the invention, and functionally equivalent methods and components are within the scope of the invention. Indeed, various modifications of the invention, in addition to those shown and described herein will become apparent to those skilled in the art from the foregoing description. Such modifications are intended to fall within the scope of the appended claims. The invention having been described, the following examples are presented by way of illustration, and not limitation.
EXAMPLES
(166) The following abbreviations refer respectively to the definitions below:
(167) FCS (Foetal Calf Serum); HCTU (2-(6-Chloro-1H-benzotriazole-1-yl)-1,1,3,3-tetramethylaminium hexafluorophosphate), TFA (trifluoroacetic acid), TIS (Triisopropylsilane).
(168) The following commercial materials were used: Fmoc-amino acids and coupling reagents were purchased from Aapptec, Novabiochem and Bachem. The non-natural olefinic containing amino-acids were purchased at Okeanos Tech. Co., LTD. Solvents were purchased from Acros, Biosolve and Sigma-Aldrich. HEp-2 (ATCC number CCL-23) cells were maintained in Eagle's minimum essential medium (EMEM) supplemented with 10% FCS, 2 mM L-glutamine, and penicillin-streptomycin solution. The cells were grown in an incubator at 37° C. in 5% CO.sub.2. Cytotoxicity assays were done with the CellTiter-Glo Luminescent cell viability assay (Promega). Cells were transfected using Lipofectamine 2000 (Invitrogen, Cergy-Pontoise, France) as described by the manufacturer.
Example 1: Synthesis of Compounds According to the Invention
(169) The general synthetic approach for obtaining compounds of Formula (I) comprises a classical solid phase peptide synthetic process wherein non-commercial groups are first prepared separately according to standard methods before grafting.
(170) Compounds of the invention were synthesized by solid phase peptide chemistry on a Rink Amide AM resin LL (100-200 mesh, Novabiochem) using an Apex 396 Automated Multiple Peptide Synthesizer (Aapptec) at a 50 μmol scale. Each coupling to was performed for 1 h at room temperature, using 200 μmol of Fmoc amino acid pre-activated with 190 μmol of HCTU and 400 μmol of diisopropyldiethylamine (DIEA) in N-Methyl-2-pyrrolidone (NMP). For the coupling following the non-natural olefinic amino acids ((S)-2-(4-pentenyl)alanine, (R)-2-(4pentenyl)alanine), HCTU was replaced by 200 μmol of PyClock or HATU, and the coupling was performed twice for two hours at room temperature. Following final Fmoc deprotection and N-terminal acetylation, the metathesis was performed under constant nitrogen degassing, in a 2 ml solution containing 10 mM 1.sup.st generation Grubbs' catalyst in dichloroethane (DCE). The metathesis was performed twice for 2 hours at room temperature. Peptides were deprotected and cleaved from the resin with a cleavage cocktail consisting of TFA:TIS:H.sub.2O (95/2.5/2.5) for 1 h30. Crude peptides were analyzed by UPLC/MS (Waters Acquity Ultra Performance LC/Micromass Quattro micro API) on a ACQUITY UPLC BEH C18 column (1.7 μl, 1.0×50 mm), and purified by HPLC preparative (Waters 2777 sample manager, Waters 2545 binary gradient module, Waters 2487 Dual X Absorbance Detector) using a Waters C18 Xbridge PreShield RP18 column (19×100 mm; diam. particle size, 5 μm). Samples were lyophilized and quantified with the Qubit® 2.0 Fluorometer (Life Technologies).
(171) The peptides of the invention were compared to comparative peptides of the same length and to the best peptide candidate (SAH-RSVF.sub.BD), a 35-mer, reported by Bird et al., 2014, supra based on the T118 sequence (
(172) Further peptides of the invention have been synthesized according to similar methods. Non-natural amino acids are introduced by standard Fmoc solid state peptide synthesis by using fmoc-protected amino acid starting material.
(173) Peptides 4ca18, 4ca16 and 4cavar8 are variants of 4ca having respectively 18, 16 and 18 amino acids. Peptides 4cavar1, 4cavar2, 4cavar3, 4cavar4, 4cavar5, 4cavar6, 4cavar7, 4cavar8 and 4cavar9 are variants of 4ca containing non-natural apolar amino acids. Peptide 4ca2 is a variant of 4ca having different cross-linking amino acid ((S)-2-(4-pentenyl)glycine instead of (R)-2-(4-pentenyl)alanine in positions X.sub.aa5, X.sub.aa8, X.sub.aa12 of SEQ ID NO: 1, 17 or 18) and peptide 4a2 is a variant of 4a having different cross-linking amino acid ((S)-2-(4-pentenyl)glycine instead of (S)-2-(4-pentenyl)alanine in positions X.sub.aa8, X.sub.aa12, X.sub.aa15 and X.sub.aa19 of SEQ ID NO: 1, 33 or 34).
(174) SAH-RSVF.sub.BD was synthesized by solid phase peptide synthesis. Unexpectedly, two isomers of identical mass were identified during the analysis of the crude material, which most likely result from the formation of two isomers at the staple olefinic bond. This isomerization has not been reported by the authors. The isomers were purified and arbitrarily assigned these isomers as SAH-RSVF.sub.BD (Z) and RSVF.sub.BD (E). The identity of both isomers was confirmed by UPLC, ES-MS and amino acid analysis.
(175) The secondary structure of the peptides was then characterized by circular dichroism (DC) as described below. The peptides sequences of peptides of the invention, including the variants of 4bb (V4bb), 4a and 4ca, and together with the comparative peptides are presented in Tables 2 and 3 from
(176) The helicities of peptides of the invention comparted to those of the comparative peptides are presented in Table 4 below.
(177) TABLE-US-00003 TABLE 4 Peptide % helicity 4bb 52.9 4ca >100 3 6.6 3a 33.9 3ac 47.2 4ca18 43 4ca16 >100 4ca-var1 89.3 4ca- var2 90.3 4ca- var3 91.4 4ca- var4 98.4 4ca- var5 82.3 4ca- var6 85.6 4ca- var7 91.4 4ca- var8 75.8 4ca2 58.1 4 6.6 4e 23.3 4a 23.5 4a2 46 4ef 50.7 4bf >100 1eg 35.3 T118 23.4
(178) As expected, stapling conferred a significant enhancement of α-helical content to all peptides as observed by the displacement of the random coil minimum toward 208 nm and the appearance of a second minimum at 222 nm (
(179) Double stapled comparative peptide 4a displayed an unusual strong negative Cotton effect at 222 nm in the CD spectra (
(180) The CD spectra of the peptides of the invention 4bb and 3ac and comparative peptide 4ef and leg appeared to display similar negative Cotton effect at the minima of 208 nm and 222 nm, with α-helical contents in a similar range. The CD spectra of the peptide of the invention 4ca and comparative peptide 4bf showed unusual conformational properties for peptides of this size in an aqueous environment, suggesting that they are fully folded into α-helices.
(181) Variants of peptides of the invention 4bb mutated with one alanine (SEQ ID NO: 4-5, 7 and 10-16) overall retained a helical content similar to peptide 4bb (approximately 50%), except mutants V4bb.sub.501 (SEQ ID NO: 3 wherein Q.sub.5 is replaced by A), V4bb.sub.502 (SEQ ID NO: 3 wherein S.sub.6 is replaced by A), and V4bb.sub.499 variants (SEQ ID NO: 3 wherein I.sub.3 is replaced by A), (SEQ ID NO: 8, 9 and 6) that appeared to be less α-helical 12, 15 and 24%, respectively.
(182) A loss of inhibition was observed with SEQ ID NO: 3 wherein I.sub.10, R.sub.11, K.sub.12 and S.sub.13 are mutated by Ala was not due to a decrease of α-helical content, which remains similar. Most of the tested peptides of the invention have a helicity higher than 45%.
(183) CD Spectroscopy
(184) The circular dichroism spectra were acquired on a Jasco J-810 and on a Chirascan spectropolarimeter. The samples were prepared in 10 mM phosphate buffer, pH 7.5, at a peptide concentration of 50 μM. Data were recorded at 25° C. by stepscan from 180 nm to 260 nm in a 0.1 cm pathlength quartz cell using 0.2 nm wavelength increments, 1 nm bandwidth and a response time of 0.5 sec. Each spectrum was an average of three measurements and was subtracted from buffer baseline. The data were converted to per residue molar ellipticity units [θ] (deg.Math.cm2.Math.dmol−1.Math.residue−1) and smoothed using the Igor software. The percentage of helicity was calculated as it follows:
(185)
whereby CD222=molar ellipticity [0] at 222 nm in [mdeg], N=number of amino acids in the peptide and C=peptide molar concentration [mol/l].
Example 2: Inhibitory Activity of Compounds of the Invention on Viral Fusion by Competition with HR2 Fluorescently Labeled Peptide (T108)
(186) To assess the propensity of the peptides to inhibit viral fusion, a 5 helix-bundle (5HB) biochemical polarization competition assay that has been described previously (Park et al., 2011, Anal. Biochem., 409:195-201) is used. Briefly, each stapled peptides were assessed for their ability to compete with the binding of a HR2 fluorescently labeled peptide (T108) to 5HB, a recombinant 5 helix bundle protein (5HB) containing 3 HR1 domains covalently attached to 2 HR2 domains prepared as described below.
(187) Variants of SEQ ID NO: 4-6, 8-16 of peptide of the invention 4bb, variant of SEQ ID NO: 7 of peptide of the invention 4a and variant of SEQ ID NO: 37 of peptide of the invention 4ca mutated with an alanine were capable to block the increase of FP in similar extent than 4bb.
(188) Cloning, Expression and Purification of 5HB
(189) The coding sequence of 5HB was designed as described previously and de novo synthesized by Genscript (Park et al., 2011, supra). The HR1 (126-182) and HR2 (476-524) coding sequences from wild type RSV A2 strain (Yunus et al., 2010, Virology, 396:226-23721) were codon optimized for overexpression in E. Coli and cloned in the NdeI/BamHI restriction sites to of pET-15b to generate the expression plasmid for 5HB. The 5HB expression construct was transformed into Escherichia coli BL21 (DE3). 100 ml of LB medium supplemented with ampicillin (100 μg/ml) was inoculated with 50 μl of cryopreserved transformant overnight at 37° C., the preculture was transferred to 1 liter of fresh LB medium supplemented with ampicillin to reach reached an optical density of 0.1 measured at 600 nm. Cells were grown at 37° C. to an optical density at 600 nm of 0.8 followed by induction with isopropyl-1-thio-β-D-galactopyranoside at final concentration of 0.5 mM. After overnight of induction, cells were harvested by centrifugation, washed twice with PBS and resuspended in 20 ml of PBS, pH 7.4, 500 mM NaCl and 1% Triton X-100 supplemented with complete protease inhibitor. Cell suspensions were disrupted by sonication. Cell debris was removed through ultracentrifugation at 18,000×g for 1 h at 4° C., and clarified cell lysate was mixed with 1 ml of Ni-NTA agarose beads (QIAGEN) pre-equilibrated with 20 ml of lysis buffer. The suspension was agitated for one hour at 4° C. and loaded onto a 5 ml polypropylene column (QIAGEN). The column was washed twice with 8 ml of PBS, pH 7.4, 500 mM NaCl, 1% Triton X-100 and 100 mM imidazole. Proteins were eluted with 5×500 μl of a buffer containing PBS, pH 7.4, 300 mM imidazole and 500 mM NaCl. The imidazole was removed by dialysis, and protein purity was assessed SDS polyacrylamide gel electrophoresis on Nu-PAGE precast gels (Invitrogen, Carlsbad, Calif.). Protein concentration was determined with the Qubit® 2.0 Fluorometer (Life Technologies).
(190) 5HB Fluorescence Polarization Assay
(191) The T108 peptide probe was synthesized by standard SPPS procedures using HCTU as a coupling reagent as described above. The fluorescence polarization assay was performed in 384-well plates using a Spectramax Paradigm (Molecular devices), using an excitation and emission wavelength of 485 nm and 535 nm, respectively. The acquisition time was of 700 ms and the read height was of 1 mm. 10 μL of recombinant 5HB protein in FP buffer (20 mM PBS, pH 7.4, 500 mM NaCl, 0.01% [v/v] Tween 20, and 0.05 mg/ml bovine gamma globulin, was preincubated for 10 minutes at room temperature with 10 μL of the appropriate peptide inhibitor concentration, after which 10 μL of FITC-T108 was added and further incubated for 30 min. at rt. The final concentration of protein and probe was of 50 nM and 2 nM, respectively. All experiments were performed in duplicate. The percentage of inhibition was calculated as described (Park et al., 2011, supra), and the K.sub.D value was calculated with the Igor software.
Example 3: Inhibitory Activity of Compounds of the Invention on Cellular Viral Fusion
(192) The inhibitory activity of the peptides of the invention was assessed in a cellular viral fusion assay as compared to comparative peptides as follows. A549 cells were infected with a recombinant green fluorescent protein (GFP)-expressing RSV virus (strain A2) obtained as described below and in Hallak et al., 2000, Virology, 271:264-275, and the inhibitory activity of the peptides was quantified by flow cytometry.
(193) Peptide of the invention 3ac was capable to block viral infection of cells with an EC.sub.50 value of 15.3±5.9 μM, similarly to T108. Under those conditions, T108 was significantly less potent (EC.sub.50=20.9 μM) than reported previously (EC.sub.50=1.48 μM) (Lambert et al., 1996, supra). The single stapled comparative peptides 3a and 4e were inactive in the cellular assay (EC.sub.50>90 μM for both peptides) despite of at least 20% of α-helical content and reasonable activity in the biochemical 5HB assay above.
(194) Peptide 4a was slightly more potent than peptide 3ac in the cellular viral fusion assay (EC.sub.50=10.6 μM versus EC.sub.50=15.3 μM, respectively) and peptides of the invention 4bb and 4ca were more clearly potent inhibitors (EC.sub.50=2.27 μM and EC.sub.50=4.08 μM, respectively) than comparative peptide 4a. Comparative peptides 4ef and 4bf were inactive in cellular settings.
(195) Variants of SEQ ID NO: 4-6, 8-16 of peptide of the invention 4bb mutated with an alanine had a similar activity as 4bb.
(196) Inhibitory activity of SAH-RSVF.sub.BD (Z) and (E) were similar to the activities of peptides 4bb and 4ca.
(197) These findings indicates that high helical contents do not necessarily parallel antiviral potencies as shown by comparative peptides 4bf and 4ef showing high helical content and low or lack of potency as compared to peptides of the invention.
(198) Further, the lower activity of peptides 4bf and 4ef also indicate that stapling at the non-interacting face of the helix of the HR-2 domain (i.e. residues E497, K498, N500, Q501, L503, A504, F505, R507, K508, D510, E511, L512, H514 and N515) will not necessarily result in conservatively active peptides, as opposed to what was previously believed (Bird et al., 2014, supra). Finally, improved activity of peptides of the invention as compared to peptides 4bf and 4ef is also unexpected in view of the earlier disclosed advantages of i, i+7 staples over i, i+4 (Bird et al., 2014, supra).
(199) HRSV-eGFP Inhibition Assay
(200) Following rapid thawing of the frozen eGFP encoding RSV virus at 370° C., the virus was vortexed for 2 min, and pipetted up and down to break aggregates. Serial 4-fold dilutions of inhibitors were prepared in glass tubes and mixed with a volume of virus required to achieve approximately 50% of infection in 200 μl of media containing 2% of FCS. The resulting mixture was added to 24-well plates containing A549 cells. Cells were incubated for 2 hours at 37° C., the media was replaced, and cells were incubated for an additional 24 hours. Cells were treated with 300 μl of trypsin for 10 min at 37° C., and the detached cells were diluted in 1 ml of culture medium. Following centrifugation at 1′700 rpm, the pellet was resuspended in 300 μl of PBS+1% SBF (V/V) and GFP positive cells were counted by FACS analysis.
Example 4: Inhibitory Activity of Peptides of the Invention in HEp-2 Cells
(201) The inhibitory activity of the peptides of the invention was assessed in HEp-2 cells as described below:
(202) A mCherry-expressing virus recently developed (Rameix-Welti et al., 2014, Nat. Commun., 5:5104) was used to avoid the cumbersome manipulations required with the GFP-expressing virus. Under these assay conditions peptides of the invention 4a, 4ca, 4bb and 4bb′ show clear higher activities as compared to comparative peptides T118, 4ef, 4bf (Table 5). In particular, the comparative single stapled peptides 3a and 3c were inactive. The finding that peptide 4bb′ is almost as active than its parent peptide 4bb, shows that the alpha-methyl moiety of the non-natural amino acids used for the stapling is not required to successfully inhibit viral fusion.
(203) TABLE-US-00004 TABLE 5 EC.sub.50 values [μM] Peptide Average 4ca 0.59 ± 0.13 4bb 0.74 ± 0.27 T118 6.33 ± 1.49 4ef 3.07 ± 1.45 4bf 2.49 ± 0.09 4a 1.82 ± .0.42 4ca18 0.23 ± 0.03 4ca16 0.72 ± 0.06 4ca-var1 1.36 ± 0.19 4ca-var2 1.49 ± 0.14 4ca-var3 0.77 ± 0.08 4ca-var4 0.20 ± 0.05 4ca-var5 0.85 ± 0.08 4ca-var6 2.31 ± 0.44 4ca-var7 0.231 ± 0.03 4ca-var8 1.32 ± 0.08 4ca-var9 1.89 ± 0.32 4ca2 0.33 ± 0.05 1b >25 3a >25 3c >25 3f 51.26 ± 5.24 4bb′ 0.99
(204) These data show that the presence of two staples in peptide of the invention such as 4ca, 4bb, 4bb′ and 4a unexpectedly resulted in an increase of antiviral potency of 11-, 9-, 6- and 3-fold, respectively, despite the reduction of size from 35 amino acids in T118 to 20 amino acids. Likewise, the double stapled peptides 4ca and 4bb displayed an inhibitory activity similar to the double stapled peptide SAH-RSVBD (Z) and (E) that also contain 35 amino acids. 4bb′ is a 4bb variant as described in
(205) rHRSV-mCherry Inhibition Assay
(206) HEp-2 cells were seeded at 5×104 cells per well in 96 wells plate the day before the infection. Peptides were 2-fold serially diluted in DMSO (11 dilutions), then further diluted in MEM medium and pre-incubated for 15-20 minutes with 0.2 MOI of RSV-mCherry (Rameix-Welti et al., 2014, supra). Following the washing of Hep-2 cells with MEM without phenol red medium, the cells were incubated with the virus/peptide mixtures for a period of 1 h30-2 h. The cells were washed and further incubated in MEM media containing fetal bovine serum and the same concentration of peptide that was used during the infection step. Plates were incubated 48 h at 37° C. and the mCherry fluorescence was measured using a spectrofluorometer (Tecan infinite M200PRO) with excitation and emission wavelengths of 580 and 620 nm, respectively (expressed in relative fluorescence units RFU). Non-infected HEp-2 cells were used as standards for fluorescence background levels. Each experiment was performed in duplicate and repeated at least twice.
Example 5: Stability of the Compounds of the Invention after Treatment with Proteases
(207) The compounds according to the invention are tested for their stability in a proteolytic stability assay as described below which is an important parameter to assess for the development of peptide therapeutics. Peptides of the invention 4bb, 4ca, 4a and their unstapled comparative peptide 4, as well as both SAH-RSVF.sub.BD isomers were treated with chymotrypsin and trypsin, and analysed by LC/MS to quantify the reaction products over time. As expected, all stapled peptides were significantly more stable to proteolytic degradation than the native peptide 4, which is fully degraded in 10 min (Table 6).
(208) TABLE-US-00005 TABLE 6 t.sub.1/2 (min) t.sub.1/2 (min) Peptide Chymotrypsin Trypsin 4 4.5 5 4a 4481.5 76 4bb 3008.0 20 4ca 10′795.0 2′277 .sup. RSV-SAH.sub.BD (Z) 442.1 5 RSV-SAH.sub.BD (E) 391.3 1
(209) As it can be seen in
(210) Proteolytic Stability Assay
(211) In vitro proteolytic degradation was measured via LC-MS using an Agilent Infinity 1280 UHPLC system coupled to an Agilent quadruple-time-of-flight (QTOF) 6530 with an Agilent Jet Stream electrospray ionisation (AJS ESI) source (all Agilent Technologies, Waldbronn, Germany). 5 μl of digested sample were injected onto a C18 column (Zorbax Eclipse Plus RRHD, 1.8 μm, 2.1*100 mm, Agilent Technologies, Waldbronn, Germany) equilibrated with solvent A and eluted with a flow rate of 0.4 ml/min over a 5-95% gradient of solvent B in 5 minutes, followed by 1.5 minutes at 95% and 0.5 minutes post-time where solvent A was 95% water, 5% acetonitrile with 0.2% formic acid and solvent B was 5% water, 95% acetonitrile with 0.2% formic acid. The AJS ESI source was operated with a capillary voltage of 4000V and a nozzle voltage of 600V with a drying gas temperature of 325° C. and flow rate of 10 l/min, nebulising gas pressure of 20 psi, and a sheath gas temperature of 300° C. and flow rate of 11l/min. Mass spectra were acquired in the positive ion mode from 100-3200 m/z at a rate of 1 scan per second in extended dynamic range (2 GHz) mode. The fragmentor, skimmer and octopole Radio Frequency voltages were set to 200, 60 and 750 V respectively. Data were acquired and analysed with Agilent MassHunter Workstation (version B.05).
(212) Peptide digestion was performed as it follows: 10 μl of peptide at 0.29 mM in 50/50 acetonitrile/water were dissolved in 990 μl 100 mM Tris-HCl, pH 8.0 with 10 mM CaCl.sub.2. Following measurement of the undigested (to) sample, 10 μl of chymotrypsin at 50 μg/ml in 100 mM Tris-HCl, pH 8.0 with 10 mM CaCl.sub.2 were added and the sample was vortexed and placed immediately in the autosampler, set to 25° C. Trypsin digestion was performed as with chymotrypsin except that the buffer was in 50 mM Tris-HCl, pH8. Chymotrypsin and trypsin were purchased from Thermo Fisher Scientific.
(213) The level of intact peptide was quantified by serial injection over time. Integration of the intact peptide compound chromatogram was performed using the Agilent Molecular Feature Extraction (MFE) algorithm. A plot of the intact peptide MFE peak area over time gave an exponential decay curve, from which the half-life was determined using MatLab (Matrix Science).
Example 6: In Vivo Activity of Peptide of the Invention in a Mice Luciferase Assay
(214) The efficacy of peptides of the invention is tested in the following model of rHRSV infection.
(215) Female BALB/c mice around 8 weeks of age are purchased. Mice are bred in a pathogen-free animal facility. For infection experiments, mice will be housed in cages inside stainless steel isolation cabinets that are ventilated under negative pressure with high-efficiency particulate air-filtered air. Female BALB/c mice (n=5 per group) are anesthetized by a mixture of ketamine and xylazine (1 and 0.2 mg per mouse, respectively) and infected by intranasal inoculation with 50 μl of PBS containing 6.10.sup.4 p.f.u. of rHRSV-Luc (Luc-encoding virus that enables direct visualization of RSV replication in living mice). Peptides of the invention are administered intranasally to the mice infected or uninfected with RSV-Luc, on day 0, 2 and 4 post-infection. Body weight and temperature is monitored at days 3-10. In vivo imaging is performed each two days on anesthetized mice. At day 8, mice are killed and the safety of the treatment is investigated by a complete toxicopathological evaluation of treated mice (histologic analysis of lungs with sections of each lobe, turbinates, heart, spleen, liver, kidneys).
(216) At day 7 pi, a time corresponding to the end of the infection in mice, the animals were sacrificed and the lungs were collected in order to perform a histological analysis. The aim of this histological analysis was to validate indirectly the efficiency of peptide 4ca by the observation of the clinical hallmarks of RSV infection. Additionally, potential toxicity of peptide 4ca due to the treatment at the tissue scale, and the potential immune response induced upon treatment was investigated. No histological changes were noticed in the lung parenchyma between mock and 4ca inoculated animals, suggesting to the absence of toxicity of 4ca in the lungs. Infection by RSV was responsible for a multifocal extensive marked interstitial pneumonia characterized by a diffuse thickening of the alveolar walls, by mononuclear cell infiltration, and by a BALT hyperplasia. In contrast, no interstitial pneumonia was observed after infection by RSV upon inoculation of 4ca, although some BALT hyperplasia and the presence of some degenerating cells inside the bronchial epithelium were observed. These observations confirm the antiviral effect of peptide 4ca.
SEQUENCE LISTING
(217) TABLE-US-00006 (Consensus) SEQ ID No: 1 Xaa.sub.1 Xaa.sub.2 Xaa.sub.3 Xaa.sub.4 Xaa.sub.5 Xaa.sub.6 Xaa.sub.7 Xaa.sub.8 Xaa.sub.9 Xaa.sub.10 Xaa.sub.11 Xaa.sub.12 Xaa.sub.13 Xaa.sub.14 Xaa.sub.15 Xaa.sub.16 Xaa.sub.17 Xaa.sub.18 Xaa.sub.19 Xaa.sub.20
wherein Xaa1, Xaa6, Xaa14 and Xaa18 are independently selected from any amino acid; Xaa2, Xaa4, Xaa5 and Xaa19 are independently selected from any amino acid or a cross-linked amino-acid; Xaa3, Xaa7, Xaa9, Xaa10, Xaa16, Xaa17 and Xaa20 are an independently selected apolar amino acid; Xaa8 is a cross-linked amino-acid; Xaa11 and Xaa12 are independently selected from a polar amino acid and a cross-linked amino-acid; Xaa13 is Serine; Xaa15 is selected from a polar amino acid and a cross-linked amino-acid; wherein the peptide contains a total of two cross-linking bridges, each between two cross-linked amino acids spaced by 2 or three amino-acids (i, i+3 and/or i, i+4 staples).
(218) TABLE-US-00007 (Consensus for 4bb) SEQ ID No: 2 Xaa.sub.1 Xaa.sub.2 Xaa.sub.3 Xaa.sub.4 Xaa.sub.5 Xaa.sub.6 Xaa.sub.7 Xaa.sub.8 Xaa.sub.9 Xaa.sub.10 Xaa.sub.11 Xaa.sub.12 Xaa.sub.13 Xaa.sub.14 Xaa.sub.15 Xaa.sub.16 Xaa.sub.17 Xaa.sub.18 Xaa.sub.19 Xaa.sub.20
wherein Xaa.sub.1, Xaa.sub.2, Xaa5, Xaa6, Xaa14, Xaa18 and Xaa19 are independently selected from any amino acid; Xaa3, Xaa7, Xaa9, Xaa10, Xaa16, Xaa17 and Xaa20 are an independently selected apolar amino acid; Xaa.sub.4, Xaa.sub.8, Xaa.sub.11 and Xaa.sub.15 are a cross-linked amino-acid; Xaa12 are independently selected from a polar amino acid; Xaa13 is Serine; wherein the peptide contains a total of two cross-linking bridges, each between two cross-linked amino acids spaced by 2 or three amino-acids (i, i+3 and/or i, i+4 staples).
(219) TABLE-US-00008 (4bb specific varied on staples) SEQ ID No: 3 EKI Xaa.sub.4 QSL Xaa.sub.8 FI Xaa.sub.11 KSD Xaa.sub.15 LLHNV
wherein Xaa.sub.4, Xaa.sub.8, Xaa.sub.11 and Xaa.sub.15 are a cross-linked amino-acid.
(220) TABLE-US-00009 (4bb varied with E1/A1) V4bb497 SEQ ID No: 4 AKI Xaa.sub.4 QSL Xaa.sub.8 FI Xaa.sub.11 KSD Xaa.sub.15 LLHNV
wherein Xaa.sub.4, Xaa.sub.8, Xaa.sub.11 and Xaa.sub.15 are (S)-2-(4-pentenyl)alanine.
(221) TABLE-US-00010 (4bb varied with K2/A2) V4bb498 SEQ ID No: 5 EAI Xaa.sub.4 QSL Xaa.sub.8 FI Xaa.sub.11 KSD Xaa.sub.15 LLHNV
wherein Xaa.sub.4, Xaa.sub.8, Xaa.sub.11 and Xaa.sub.15 are (S)-2-(4-pentenyl)alanine.
(222) TABLE-US-00011 (4bb varied with I3/A3) V4bb499 SEQ ID No: 6 EKA Xaa.sub.4 QSL Xaa.sub.8 FI Xaa.sub.11 KSD Xaa.sub.15 LLHNV
wherein Xaa.sub.4, Xaa.sub.8, Xaa.sub.11 and Xaa.sub.15 are (S)-2-(4-pentenyl)alanine.
(223) TABLE-US-00012 (4a varied with N4/A4) V4a500 SEQ ID No: 7 EKI A QSL Xaa.sub.8 F I R Xaa.sub.12 SD Xaa.sub.15 LLH Xaa.sub.19 V
(224) TABLE-US-00013 (4bb varied with Q5/A5) V4bb501 SEQ ID No: 8 EKI Xaa.sub.4 A SL Xaa.sub.8 FI Xaa.sub.11 KSD Xaa.sub.15 LLHNV
wherein Xaa.sub.4, Xaa.sub.8, Xaa.sub.11 and Xaa.sub.15 are (S)-2-(4-pentenyl)alanine.
(225) TABLE-US-00014 (4bb varied with S6/A6) V4bb502 SEQ ID No: 9 EKI Xaa.sub.4 Q A L Xaa.sub.8 FI Xaa.sub.11 KSD Xaa.sub.15 LLHNV
wherein Xaa.sub.4, Xaa.sub.8, Xaa.sub.11 and Xaa.sub.15 are (S)-2-(4-pentenyl)alanine.
(226) TABLE-US-00015 (4bb varied with L7/A7) V4bb503 SEQ ID No: 10 EKI Xaa.sub.4 QS A Xaa.sub.8 FI Xaa.sub.11 KSD Xaa.sub.15 LLHNV
wherein Xaa.sub.4, Xaa.sub.8, Xaa.sub.11 and Xaa.sub.15 are (S)-2-(4-pentenyl).
(227) TABLE-US-00016 (4bb varied with F9/A9) V4bb505 SEQ ID No: 11 EKI Xaa.sub.4 QSL Xaa.sub.8 A I Xaa.sub.11 KSD Xaa.sub.15 LLHNV
wherein Xaa.sub.4, Xaa.sub.8, Xaa.sub.11 and Xaa.sub.15 are (S)-2-(4-pentenyl)alanine.
(228) TABLE-US-00017 (4bb varied with D14/A14) V4bb510 SEQ ID No: 12 EKI Xaa.sub.4 QSL Xaa.sub.8 FI Xaa.sub.11 KS A Xaa.sub.15 LLHNV
wherein Xaa.sub.4, Xaa.sub.8, Xaa.sub.11 and Xaa.sub.15 are (S)-2-(4-pentenyl)alanine.
(229) TABLE-US-00018 (4bb varied with L16/A16) V4bb512 SEQ ID No: 13 EKI Xaa.sub.4 QSL Xaa.sub.8 FI Xaa.sub.11 KSD Xaa.sub.15 A LHNV
wherein Xaa.sub.4, Xaa.sub.8, Xaa.sub.11 and Xaa.sub.15 are (S)-2-(4-pentenyl)alanine.
(230) TABLE-US-00019 (4bb varied with H18/A18) V4bb514 SEQ ID No: 14 EKI Xaa.sub.4 QSL Xaa.sub.8 FI Xaa.sub.11 KSD Xaa.sub.15 LL A NV
wherein Xaa.sub.4, Xaa.sub.8, Xaa.sub.11 and Xaa.sub.15 are (S)-2-(4-pentenyl)alanine.
(231) TABLE-US-00020 (4bb varied with N19/A19) V4bb515 SEQ ID No: 15 EKI Xaa.sub.4 QSL Xaa.sub.8 FI Xaa.sub.11 KSD Xaa.sub.15 LLH A V
wherein Xaa.sub.4, Xaa.sub.8, Xaa.sub.11 and Xaa.sub.15 are (S)-2-(4-pentenyl)alanine.
(232) TABLE-US-00021 (4bb varied with V20/A20) V4bb516 SEQ ID No: 16 EKI Xaa.sub.4 QSL Xaa.sub.8 FI Xaa.sub.11 KSD Xaa.sub.15 LLHN A
wherein Xaa.sub.4, Xaa.sub.8, Xaa.sub.11 and Xaa.sub.15 are (S)-2-(4-pentenyl)alanine.
(233) TABLE-US-00022 (Consensus for 4ca) SEQ ID No: 17 Xaa.sub.1 Xaa.sub.2 Xaa.sub.3 Xaa.sub.4 Xaa.sub.5 Xaa.sub.6 Xaa.sub.7 Xaa.sub.8 Xaa.sub.9 Xaa.sub.10 Xaa.sub.11 Xaa.sub.12 Xaa.sub.13 Xaa.sub.14 Xaa.sub.15 Xaa.sub.16 Xaa.sub.17 Xaa.sub.18 Xaa.sub.19 Xaa.sub.20
wherein Xaa1, Xaa4, Xaa6, Xaa14, Xaa18 and Xaa19 are independently selected from any amino acid; Xaa3, Xaa7, Xaa9, Xaa10, Xaa16, Xaa17 and Xaa20 are an independently selected apolar amino acid; Xaa.sub.2, Xaa.sub.5, Xaa.sub.8 and Xaa.sub.12 are independently selected from a cross-linked amino-acid; Xaa11 and Xaa15 are independently selected from a polar amino acid; Xaa13 is Serine; wherein the peptide contains a total of two cross-linking bridges, each between two cross-linked amino acids spaced by 2 or three amino-acids (i, i+3 and/or i, i+4 staples).
(234) TABLE-US-00023 (4ca specific varied on staples) SEQ ID No: 18 E Xaa.sub.2 IN Xaa.sub.5 SL Xaa.sub.8 FIR Xaa.sub.12 SDELLHNV
wherein Xaa.sub.2, Xaa.sub.5, Xaa.sub.8 and Xaa.sub.12 are independently selected from a cross-linked amino-acid.
(235) TABLE-US-00024 (4a) SEQ ID No: 19 EKINQSL Xaa.sub.8 FIR Xaa.sub.12 SD Xaa.sub.15 LLH Xaa.sub.19 V
wherein Xaa.sub.8, Xaa.sub.12, Xaa.sub.15 and Xaa.sub.19 are (S)-2-(4-pentenyl)alanine.
(236) TABLE-US-00025 (3ac) SEQ ID No: 20 EQSL X.sub.504FIR X.sub.508 SD X.sub.511 LLH X.sub.515 V
wherein X.sub.504, X.sub.508, X.sub.511 and X.sub.515 are (S)-2-(4-pentenyl)alanine.
(237) TABLE-US-00026 (comparative peptide (4bf)) SEQ ID No: 21 EKI X.sub.500 QSL X.sub.504 FIR 8.sub.508 SDELLH X.sub.515V
wherein X.sub.500 X.sub.504 and X.sub.515 are (S)-2-(4-pentenyl)alanine, 8.sub.508 is (R)-2-(7-octenyl)alanine.
(238) TABLE-US-00027 (comparative peptide (4)) SEQ ID No: 22 EKINQSLAFIRKSDELLHNV (comparative peptide (4e)) SEQ ID No: 23 EKINQSL 8.sub.504 FIRKSD X.sub.511 LLHNV 8.sub.504 is (R)-2-(7-octenyl)alanine, X.sub.511 is (S)-2-(4-pentenyl)alanine. (HR2-fragment 476-524) SEQ ID No: 24 NFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTN (X-ray of fragment 480-516) SEQ ID No: 25 PLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNV (T108 fragment 478-512) SEQ ID No: 26 YDPLVFPSDEFDASISQVNEKINQSLAFIRKSDEL (T118 fragment 488-522) SEQ ID No: 27 FDASISQVNEKINQSLAFIRKSDELLHNVNAGKST (SAH-RSVFBD) SEQ ID No: 28 FD 8.sub.490 SISQVN X.sub.497 KINQSLAFI 8.sub.507 KSDELLX.sub.514 NVNAGKST
wherein 8.sub.490 and 8.sub.507 are is (R)-2-(7-octenyl)alanine, X.sub.497 and X.sub.514 are (S)-2-(4-pentenyl)alanine.
(239) TABLE-US-00028 (comparative peptide (leg)) SEQ ID No: 29 EFPS X.sub.486 EFD X.sub.490 SI X.sub.493 QVN X.sub.497 KIN
wherein X.sub.486, X.sub.490, X.sub.493 and X.sub.497 are (S)-2-(4-pentenyl)alanine.
(240) TABLE-US-00029 (comparative peptide (4ef)) SEQ ID No: 30 8.sub.497 KINQSL X.sub.504 FIR 8.sub.508 SDELLH X.sub.515 V
wherein 8.sub.497 and 8.sub.508 are (R)-2-(7-octenyl)alanine, X.sub.504 and X.sub.515 are (S)-2-(4-pentenyl)alanine.
(241) TABLE-US-00030 (comparative peptide (3)) SEQ ID No: 31 EQSLAFIRKSDELLHNV (comparative peptide (3a)) SEQ ID No: 32 EQSL X.sub.504 FIR X.sub.508 SDELLHNV
wherein X.sub.504 and X.sub.508 are (S)-2-(4-pentenyl)alanine.
(242) TABLE-US-00031 (Consensus for 4a) SEQ ID No: 33 Xaa.sub.1 Xaa.sub.2 Xaa.sub.3 Xaa.sub.4 Xaa.sub.5 Xaa.sub.6 Xaa.sub.7 Xaa.sub.8 Xaa.sub.9 Xaa.sub.10 Xaa.sub.11 Xaa.sub.12 Xaa.sub.13 Xaa.sub.14 Xaa.sub.15 Xaa.sub.16 Xaa.sub.17 Xaa.sub.18 Xaa.sub.19 Xaa.sub.20
wherein Xaa1, Xaa2, Xaa4, Xaa5, Xaa6, Xaa14 and Xaa18 are independently selected from any amino acid;
(243) Xaa8, Xaa12, Xaa15, and Xaa19 are each independently a cross-linked amino-acid.
(244) Xaa3, Xaa7, Xaa9, Xaa10, Xaa16, Xaa17 and Xaa20 are an independently selected apolar amino acid; Xaa11 is a polar amino acid; Xaa13 is Serine; wherein the peptide contains a total of two cross-linking bridges, each between two cross-linked amino acids spaced by 2 or three amino-acids (i, i+3 and/or i, i+4 staples).
(245) TABLE-US-00032 (4a specific varied on staples) SEQ ID No: 34 EKINQSL X.sub.aa8 FIR Xaa.sub.12 SD Xaa.sub.15 LLH Xaa.sub.19 V
wherein Xaa8, Xaa12, Xaa15 and Xaa19 are a cross-linked amino-acid.
(246) TABLE-US-00033 (4bb) SEQ ID No: 35 EKI Xaa.sub.4 QSL Xaa.sub.8 FI Xaa.sub.11 KSD Xaa.sub.15 LLHNV
wherein Xaa.sub.4, Xaa.sub.8, Xaa.sub.11 and Xaa.sub.15 are (S)-2-(4-pentenyl)alanine.
(247) TABLE-US-00034 (4ca) SEQ ID No: 36 E Xaa.sub.2 IN Xaa.sub.5 SL Xaa.sub.8 FIR Xaa.sub.12 SDELLHNV
wherein Xaa.sub.2 is (R)-2-(4-pentenyl)alanine and Xaa.sub.5, Xaa.sub.8 and Xaa.sub.12 are (S)-2-(4-pentenyl)alanine.
(248) TABLE-US-00035 (4ca varied with E15/A15) V4ca511 SEQ ID No: 37 E Xaa.sub.2 IN Xaa.sub.5 SL Xaa.sub.8 FIR Xaa.sub.12 SDALLHNV
wherein Xaa.sub.2 is (R)-2-(4-pentenyl)alanine and Xaa.sub.5, Xaa.sub.8 and Xaa.sub.12 are (S)-2-(4-pentenyl)alanine.
(249) Peptides of SEQ ID NO: 4-16, 19-21, 23, 28-30, 32, 35, 36 and 37 have their N-terminus acetylated and their C-terminus amidated.
(250) TABLE-US-00036 (4ca18) SEQ ID No: 38 E Xaa.sub.2 IN Xaa.sub.5 SL Xaa.sub.8 FIR Xaa.sub.12 SDELLH
wherein Xaa.sub.2 is (R)-2-(4-pentenyl)alanine and Xaa.sub.5, Xaa.sub.8 and Xaa.sub.12 are (S)-2-(4-pentenyl)alanine.
(251) TABLE-US-00037 (4ca16) SEQ ID No: 39 X.sub.498 IN X.sub.501 SL X.sub.504 FIR X.sub.508 SDELL
wherein X.sub.498 is (R)-2-(4-pentenyl)alanine and X.sub.501, X.sub.504 and X.sub.508 are (S)-2-(4-pentenyl)alanine.
(252) TABLE-US-00038 (4ca-var1) SEQ ID No: 40 E Xaa.sub.2 IN Xaa.sub.5 S Xaa.sub.7 Xaa.sub.8 FIR Xaa.sub.12 SDELLHNV
wherein Xaa.sub.2 is (R)-2-(4-pentenyl)alanine, Xaa.sub.5, Xaa.sub.8 and Xaa.sub.12 are (S)-2-(4-pentenyl)alanine and Xaa.sub.7 is tBa.
(253) TABLE-US-00039 (4ca-var2) SEQ ID No: 41 E Xaa.sub.2 IN Xaa.sub.5 S Xaa.sub.7 Xaa.sub.8 FIR Xaa.sub.12 SDELLHNV
wherein Xaa.sub.2 is (R)-2-(4-pentenyl)alanine, Xaa.sub.5, Xaa.sub.8 and Xaa.sub.12 are (S)-2-(4-pentenyl)alanine and Xaa.sub.7 is Cpg.
(254) TABLE-US-00040 (4ca-var3) SEQ ID No: 42 E Xaa.sub.2 IN Xaa.sub.5 S Xaa.sub.7 Xaa.sub.8 FIR Xaa.sub.12 SDELLHNV
wherein Xaa.sub.2 is (R)-2-(4-pentenyl)alanine, Xaa.sub.5, Xaa.sub.8 and Xaa.sub.12 are (S)-2-(4-pentenyl)alanine and Xaa.sub.7 is Chg.
(255) TABLE-US-00041 (4ca-var4) SEQ ID No: 43 E Xaa.sub.2 IN Xaa.sub.5 SL Xaa.sub.8 FIR Xaa.sub.12 SDE Xaa.sub.16LHNV
wherein Xaa.sub.2 is (R)-2-(4-pentenyl)alanine, Xaa.sub.5, Xaa.sub.8 and Xaa.sub.12 are (S)-2-(4-pentenyl)alanine and Xaa.sub.16 is tBa.
(256) TABLE-US-00042 (4ca-var5) SEQ ID No: 44 E Xaa.sub.2 IK Xaa.sub.5 SL Xaa.sub.8 FIR Xaa.sub.12 SDE Xaa.sub.16LHNV
wherein Xaa.sub.2 is (R)-2-(4-pentenyl)alanine, Xaa.sub.5, Xaa.sub.8 and Xaa.sub.12 are (S)-2-(4-pentenyl)alanine and Xaa.sub.16 is tBa.
(257) TABLE-US-00043 (4ca-var6) SEQ ID No: 45 E Xaa.sub.2 IR Xaa.sub.5 SL Xaa.sub.8 FIR Xaa.sub.12 SDE Xaa.sub.16LHNV
wherein Xaa.sub.2 is (R)-2-(4-pentenyl)alanine, Xaa.sub.5, Xaa.sub.8 and Xaa.sub.12 are (S)-2-(4-pentenyl)alanine and Xaa.sub.16 is tBa.
(258) TABLE-US-00044 (4ca-var7) SEQ ID No: 46 E Xaa.sub.2 IN Xaa.sub.5 SL Xaa.sub.8 FIR Xaa.sub.12 SDE Xaa.sub.16LHNV
wherein Xaa.sub.2 is (R)-2-(4-pentenyl)alanine, Xaa.sub.5, Xaa.sub.8 and Xaa.sub.12 are (S)-2-(4-pentenyl)alanine and Xaa.sub.16 is Cha.
(259) TABLE-US-00045 (4ca-var8) SEQ ID No: 47 E Xaa.sub.2 IN Xaa.sub.5 SL Xaa.sub.8 FIR Xaa.sub.12 SDE Xaa.sub.16LH
wherein Xaa.sub.2 is (R)-2-(4-pentenyl)alanine, Xaa.sub.5, Xaa.sub.8 and Xaa.sub.12 are (S)-2-(4-pentenyl)alanine and Xaa.sub.16 is tBa.
(260) TABLE-US-00046 (4ca-var9) SEQ ID No: 48 E Xaa.sub.2 IN Xaa.sub.5 SL Xaa.sub.8 FIR Xaa.sub.12 SDE Xaa.sub.16 Xaa.sub.17HNV
wherein Xaa.sub.2 is (R)-2-(4-pentenyl)alanine, Xaa.sub.5, Xaa.sub.8 and Xaa.sub.12 are (S)-2-(4-pentenyl)alanine and Xaa.sub.16 and Xaa.sub.17 are tBa.
(261) TABLE-US-00047 (4ca2) SEQ ID No: 49 E Xaa.sub.2 IN Xaa.sub.5 SL Xaa.sub.8 FIR Xaa.sub.12 SDELLHNV
wherein Xaa.sub.2 is (R)-2-(4-pentenyl)alanine and Xaa.sub.5, Xaa.sub.8 and Xaa.sub.12 are (S)-2-(4-pentenyl)glycine.
(262) TABLE-US-00048 (4a2) SEQ ID No: 50 EKINQSL Xaa.sub.8 FIR Xaa.sub.12 SD Xaa.sub.15 LLH Xaa.sub.19 V
wherein Xaa.sub.8, Xaa.sub.12, Xaa.sub.15 and Xaa.sub.19 are (S)-2-(4-pentenyl)glycine.
(263) Peptides of SEQ ID NO: 38-50 have their N-terminus acetylated and their C-terminus amidated.