PEPTIDE TARGETING GIP AND GLP-2 RECEPTORS FOR TREATING BONE DISORDERS

20220112261 · 2022-04-14

    Inventors

    Cpc classification

    International classification

    Abstract

    Disclosed is an isolated peptide including the consensus amino acid sequence SEQ ID NO: 1:

    TABLE-US-00001 (SEQ ID NO: 1) HGEGSFX7SDX10 SX12X13LDKLAARDFVNWLLQTK wherein X7 is any amino acid residue, X10 is any amino acid residue, X12 is any amino acid residue and X13 is any amino acid residue. Also disclosed are methods of using such peptide in the treatment of bone disorders.

    Claims

    1. Isolated peptide comprising the consensus amino acid sequence SEQ ID NO: 1: TABLE-US-00022 (SEQ ID NO: 1) HGEGSFX.sub.7SDX.sub.10 SX.sub.12X.sub.13LDKLAARDFVNWLLQTK wherein X.sub.7 is any amino acid residue, X.sub.10 is any amino acid residue, X.sub.12 is any amino acid residue and X.sub.13 is any amino acid residue.

    2. The peptide according to claim 1, wherein: X.sub.7 is an amino acid selected from the group consisting in glycine, valine, threonine and serine; and/or X.sub.10 is an amino acid selected from the group consisting in methionine, leucine and phenylalanine; and/or X.sub.12 is an amino acid selected from the group consisting in isoleucine, valine and threonine; and/or X.sub.13 is a non polar amino acid, preferably an amino acid selected from the group consisting in alanine, valine and isoleucine.

    3-5. (canceled)

    6. The peptide according to claim 1, wherein the C-terminal lysine is amidated.

    7. The peptide according to claim 1, comprising the consensus amino acid sequence SEQ ID NO: 2: TABLE-US-00023 (SEQ ID NO: 2) HGEGSFX.sub.7SDX.sub.10 SX.sub.12X.sub.13LDKLAARDFVNWLLQTKITD

    8. The peptide according to claim 7, further comprising a peptide tag at its C-terminal end.

    9. The peptide according to claim 1, wherein said peptide is selected from the group consisting in the peptides: TABLE-US-00024 GL-0001 of sequence (SEQ ID NO: 3) HGEGSFGSDMSIALDKLAARDFVNWLLQTKITD GL-0007 of sequence (SEQ ID NO: 4) HGEGSFGSDFSIALDKLAARDFVNWLLQTK-NH.sub.2 GL-0001-Tag of sequence (SEQ ID NO: 5) HGEGSFGSDMSIALDKLAARDFVNWLLQTKITDGAADDDDDD GL-0002 of sequence (SEQ ID NO: 6) HGEGSFVSDMSIVLDKLAARDFVNWLLQTK-NH.sub.2 GL-0003 of sequence (SEQ ID NO; 7) HGEGSFVSEMSIVLDKLAARDFVNWLLQTK-NH.sub.2 GL-0004 of sequence (SEQ ID NO: 8) HGEGSFVSDMSVVLDKLAARDFVNWLLQTK-NH.sub.2 GL-0005 of sequence (SEQ ID NO: 9) HGEGSFVSDLSVVLDKLAARDFVNWLLQTK-NH.sub.2 GL-0006 of sequence (SEQ ID NO: 10) HGEGSFVSDFSVVLDKLAARDFVNWLLQTK-NH.sub.2 GL-0008 of sequence (SEQ ID NO: 11) HGEGSFTSDFSIALDKLAARDFVNWLLQTK-NH.sub.2, and GL-0009 of sequence (SEQ ID NO: 12) HGEGSFVSDFSIALDKLAARDFVNWLLQTK-NH.sub.2.

    10. (canceled)

    11. Pharmaceutical composition comprising a peptide as defined in claim 1.

    12. Implantable medical device comprising a peptide as defined in claim 1.

    13. A method for treating and/or preventing a bone disorder in a subject, comprising administering to a subject in need thereof a therapeutically effective amount of a peptide as defined in claim 1.

    14. The method according to claim 13, wherein said bone disorder is selected from primary or secondary osteoporosis, (including post-menopausal, glucocorticoid-induced, immobilization-induced and senile osteoporosis), osteopenia, diabetic bone disease, osteomalacia and rickets, bone dystrophies such as Paget's disease of bone, hypercalcemia of malignancy, osteopenia due to bone metastasis, osteosarcomia, Ewing tumour of bone, osteochondroma, bone abnormalities caused by cancer treatment, osteogenesis imperfecta, osteomyelitis, achondroplasia, avascular necrosis, osteopetrosis, myositis ossificans, periodontal disease, hyperparathyroidism, periarticular erosions in rheumatoid arthritis, bone erosions in ankylosing spondylitis and bone loss in anorexia nervosa.

    15. The method according to claim 13, wherein said bone disorder is osteogenesis imperfecta.

    16. The method according to claim 13, wherein said bone disorder is a manifestation, in bones, of a metabolic or hormonal disorder.

    17. Bone filling biomaterial comprising a peptide as defined in claim 1.

    18. A method of bone regeneration, comprising providing the bone filling material of claim 17, and administering the bone filling material to a subject in need thereof.

    19. A method for treating and/or preventing a bone disorder in a subject, comprising administering to a subject in need thereof a therapeutically effective amount of a pharmaceutical composition as defined in claim 7.

    20. The method according to claim 19, wherein said bone disorder is selected from primary or secondary osteoporosis, (including post-menopausal, glucocorticoid-induced, immobilization-induced and senile osteoporosis), osteopenia, diabetic bone disease, osteomalacia and rickets, bone dystrophies such as Paget's disease of bone, hypercalcemia of malignancy, osteopenia due to bone metastasis, osteosarcomia, Ewing tumour of bone, osteochondroma, bone abnormalities caused by cancer treatment, osteogenesis imperfecta, osteomyelitis, achondroplasia, avascular necrosis, osteopetrosis, myositis ossificans, periodontal disease, hyperparathyroidism, periarticular erosions in rheumatoid arthritis, bone erosions in ankylosing spondylitis and bone loss in anorexia nervosa.

    21. The method according to claim 19, wherein said bone disorder is osteogenesis imperfecta.

    22. The method according to claim 19, wherein said bone disorder is a manifestation, in bones, of a metabolic or hormonal disorder.

    23. Peptide according to claim 2, wherein the C-terminal lysine is amidated.

    24. Peptide according to claim 3, wherein the C-terminal lysine is amidated.

    Description

    BRIEF DESCRIPTION OF THE FIGURES

    [0090] FIG. 1: In silico strategy for the design of double GIP/GLP-2 analogues. The final goal was to obtain a consensus sequence with at least 50% homology between the sequence and human GIP.sub.1-30 or human GLP-2. Lower case letters at step 3 represent n: negatively charged amino acid, p: polar amino acid and a: aliphatic amino acid.

    [0091] FIGS. 2-3: Effects of joint administration of GIP and GLP-2 on collagen maturity and number of osteoclasts.

    [0092] FIG. 2: Collagen maturity was evaluated in MC3T3-E1 cultures in the presence of vehicle (CTRL), or 200 nM [D-Ala.sup.2]-GIP.sub.1-30NH2 (GIP), [Gly.sup.2]-GLP-2 (GLP-2) or both molecules (GIP+GLP-2). *: p<0.05 and ***: p<0.001 vs. vehicle-treated-cultures; $$: p<0.01 vs. [D-Ala.sup.2]GIP.sub.1-30NH2-treated cultures, and #: p<0.05 vs. [Gly.sup.2]-GLP-2-treated-cultures.

    [0093] FIG. 3: The number of newly-generated osteoclasts per well (N.Oc/well) was evaluated in human peripheral blood mononuclear cells isolated from healthy individuals and cultured in the presence of 25 ng/ml human M-CSF and 50 ng/ml human soluble RANKL (MR). This parameter was also evaluated in MR-treated cultures supplemented with 1 nM [D-Ala.sup.2]-GIP.sub.1-30NH2 (GIP), [Gly.sup.2]-GLP-2 (GLP-2) or both molecules (GIP+GLP-2). ***: p<0.001 vs. MR; $: p<0.05 and $$$: p<0.001 vs. [D-Ala.sup.2]GIP.sub.1-30NH2-treated cultures, and ###: p<0.001 vs. [Gly.sup.2]-GLP-2-treated-cultures.

    [0094] FIG. 4: Effects of GL-0001 on osteoblast cell death. Murine MC3T3-E1 cells were cultured for 24 hrs in the presence of saline, various concentrations of GL-0001 or 10.sup.−6 M rosiglitazone. *: p<0.05 vs. saline-treated cultures.

    [0095] FIGS. 5-7: Effects of double analogue on collagen maturity in vitro. The dotted line corresponds to basal level of collagen maturity.

    [0096] FIG. 8: Effects of GL-0001 or GL-0007 on body mass. Body mass of ovariectomized animals treated with either vehicle (OVX+Veh), 25 nmoles/kg/day GL-0001 (OVX+GL-0001), 25 nmoles/kg/day GL-0007 (OVX+GL-0007_25), 100 nmoles/kg/day GL-0007 (OVX+GL-0007_100) or once 100 μg/kg zoledronic acid (OVX+Zol) are presented at the end of the 8 week treatment. *: p<0.05 and **: p<0.01 vs. OVX+Veh.

    [0097] FIG. 9: Effects of GL-0001 or GL-0007 on cortical bone strength. Cortical bone strength was evaluated by 3-point bending assay at the midshaft femur in ovariectomized animals treated with either vehicle (OVX+Veh), 25 nmoles/kg/day GL-0001 (OVX+GL-0001), 25 nmoles/kg/day GL-0007 (OVX+GL-0007_25), 100 nmoles/kg/day GL-0007 (OVX+GL-0007_100) or once 100 μg/kg zoledronic acid (OVX+Zol). *: p<0.05 and **: p<0.01 vs. OVX+Veh.

    [0098] FIGS. 10-11: Effects of GL-0001 or GL-0007 on cortical bone microarchitecture. Cortical bone microarchitecture was evaluated by microcomputed X-ray tomography 4 mm above the distal femur growth plate (white rectangle on 3D model). Animals were either treated with vehicle (OVX+Veh), 25 nmoles/kg/day GL-0001 (OVX+GL-0001), 25 nmoles/kg/day GL-0007 (OVX+GL-0007_25), 100 nmoles/kg/day GL-0007 (OVX+GL-0007_100) or once 100 μg/kg zoledronic acid (OVX+Zol). The studied features were as follows: Tt.Ar: Total cross-sectional area, Ct.Th: cortical thickness, Ma.Ar: medullary area, J: Polar moment of inertia, Ct.Ar: cortical bone area, Ct.Ar/Tt.At: cortical area fraction, lap: cross-sectional moment of inertia about the antero-posterior axis, Iml: cross-sectional moment of inertia about the medio-lateral axis. *: p<0.05 and **: p<0.01 vs. OVX+Veh.

    [0099] FIGS. 12-13: Effects of GL-0001 or GL-0007 on trabecular bone strength and microarchitecture.

    [0100] FIG. 12: Trabecular bone strength was evaluated by compression test of vertebral bodies of the second lumbar vertebra.

    [0101] FIG. 13: Trabecular bone microarchitecture was evaluated in vertebral bodies of the fifth lumbar vertebra. Animals were either treated with vehicle (OVX+Veh), 25 nmoles/kg/day GL-0001 (OVX+GL-0001), 25 nmoles/kg/day GL-0007 (OVX+GL-0007_25), 100 nmoles/kg/day GL-0007 (OVX+GL-0007_100) or once 100 μg/kg zoledronic acid (OVX+Zol). The studied features were as follows: BV/TV: Bone volume fraction, Tb.N :trabecular number, Tb.Th:trabecular thickness, Tb.Sp: trabecular separation. *: p<0.05 and **: p<0.01 vs. OVX+Veh.

    [0102] FIGS. 14-15: Effects of GL-0001 or GL-0007 on bone matrix composition. Tissue material properties were evaluated by Fourier transform infrared imaging (FTIRI) in the posterior quadrants at the femur midshaft. Animals were either treated with vehicle (OVX+Veh), 25 nmoles/kg/day GL-0001 (OVX+GL-0001), 25 nmoles/kg/day GL-0007 (OVX+GL-0007_25), 100 nmoles/kg/day GL-0007 (OVX+GL-0007_100) or once 100 μg/kg zoledronic acid (OVX+Zol). CCL: collagen maturity, XST: mineral crystallinity, Crystal_size: crystal size index, P/A: phosphate/amide ratio, C/P: carbonate/phosphate ratio and AcP: acid phosphate content. Mean and heterogeneity (width) of each parameter is represented. *: p<0.05 and **: p<0.01 vs. OVX+Veh.

    [0103] FIG. 16-18: Activation of the GIPr and GLP-2r.

    [0104] FIG. 16: HEK-293 cells were transfected with a plasmid encoding the human GIPr. Production of cyclic AMP was recorded by FRET using the H74 probe. An increase in FRET ratio 470/530 nm indicates higher cAMP. [D-Ala.sup.2]GIP.sub.1-30NH2, [Gly.sup.2]GLP-2, GL-0001 or a vehicle were added in the cultures and the levels of cAMP were recorded 30 min after. ***: p<0.001 vs. vehicle; ###: p<0.001 vs. [Gly.sup.2]GLP-2.

    [0105] FIG. 17: HEK-293 cells were transfected with a plasmid encoding the human GLP-2r. Production of cyclic AMP was recorded by FRET using the H74 probe. An increase in FRET ratio 470/530 nm indicates higher cAMP. [D-Ala.sup.2]GIP.sub.1-30NH2, [Gly.sup.2]GLP-2, GL-0001 or a vehicle were added in the cultures and the levels of cAMP were recorded 30 min after. **: p<0.01 and ***: p<0.001 vs. vehicle; $: p<0.05 and $$: p<0.01 vs. [D-Ala.sup.2]GIP.sub.1-30NH2.

    [0106] FIG. 18: HEK-293 cells were transfected with a plasmid encoding the human GIPr and the human GLP-2r. Production of cyclic AMP was recorded by FRET using the H74 probe. An increase in FRET ratio 470/530 nm indicates higher cAMP. [D-Ala.sup.2]GIP.sub.1-30NH2, [Gly.sup.2]GLP-2, GL-0001 or a vehicle were added in the cultures and the levels of cAMP were recorded 30 min after. ***: p<0.001 vs. vehicle; ###: p<0.001 vs. [Gly.sup.2]GLP-2; $$$: p<0.001 vs. [D-Ala.sup.2]GIP.sub.1-30NH2.

    [0107] FIG. 19: Sequence alignment between the peptides of the invention and peptides disclosed in WO2018/069442.

    [0108] FIG. 20: Collagen maturity index as a function of peptide concentration. Dotted line represents the collagen maturity index observed in cultures without any peptide.

    [0109] FIG. 21: Evolution of combination index (CI) over dose range for collagen maturity.

    [0110] FIG. 22: Osteoclastogenesis response of Raw 264.7 cells exposed to several concentrations of double GIP/GLP-2 analogues. The dashed line represents half maximum effects used to compute IC50.

    [0111] FIG. 23: Dose response of inhibitory effects of double GIP/GLP-2 analogues. The dashed line represents half maximum effects (EC50).

    [0112] FIG. 24: Combination index (CI) at EC50 of GIP and GLP-2 for osteoclastogenesis. Grey area between dashed lines represents CI values indicative of additivity. Values above grey area are suggestive of antagonism whilst values below grey area are indicative of synergism.

    EXAMPLES

    Example 1: Design of the Peptides of the Invention

    Materials and Methods

    [0113] A full detail of all steps is provided in FIG. 1. Amino acid sequence of human GIP (accession #: P09681) and human GLP-2 (accession #: P01275.3) were collected from NCBI website (www.ncbi.nlm.nih.gov/protein). Amino acid sequence of known GLP-2 analogues namely Teduglutide (PubChem CID: 16139605), Elsiglutide, ZP1848 and FE 203799 were also collected (Wisniewski et al. (2016) J. Med. Chem. 59:3129-3139). Protein sequences were aligned manually using Word 2013 software. Analyses of homology percentage were conducted in Matlab R2016b with the Needleman-Wunsch algorithm. Threshold in sequence homology for validation was set at >50% homology with either GIP.sub.1. 30 or GLP-2.

    Results

    [0114] FIG. 1 represents the in silico strategy used to design double GIP/GLP-2 analogues.

    [0115] In step 1, a sequence alignment between human GIP.sub.1-30 and human GLP-2 has been conducted manually in Word 2013 and led to the generation of the consensus sequence 1 (CS1) that corresponds to the same amino acid at the same sequence position. CS1 is composed of Ala.sup.2, Gly.sup.4, Phe.sup.6, Asp.sup.15, Asp.sup.21, Phe.sup.22, Asn.sup.24, Trp.sup.25, Leu.sup.26 and Lys.sup.30, respectively.

    [0116] In step 2, the four known GLP-2 analogues, namely teduglutide, elsiglutide, ZP1848 and FE 203799 were also manually sequence aligned in order to establish the consensus sequence 2 (CS2). CS2 is composed of His.sup.1, Gly.sup.2, Gly.sup.4, Phe.sup.6, Ser.sup.7, Glu.sup.9, Thr.sup.12, Ile.sup.13, Leu.sup.14, Asp.sup.15, Leu.sup.17, Ala.sup.18, Ala.sup.19, Arg.sup.20, Asp.sup.21, Phe.sup.22, Ile.sup.23, Trp.sup.25, Leu.sup.26, Ile.sup.27, Thr.sup.29, Lys.sup.30, Ile.sup.31, Thr.sup.32 and Asp.sup.33.

    [0117] In step 3, human GIP.sub.1-30 and human GLP-2 were sequence aligned manually to determine the class of amino acid in missing position of the CS1. When an amino acid from the same class has been encountered in both sequences at the same position, its class was indicated in sequence consensus 3 (CS3). It appeared that in both peptide sequences in position 3, 5, 9, 11, 13, 14, 17, 23, 27 and 29 were found negatively charged, polar, negatively charged, polar, aliphatic, aliphatic, aliphatic, aliphatic, aliphatic and polar amino acids, respectively.

    [0118] In step 4, the inventors compared CS1 and CS2 in order to establish a sequence that could lead to a GLP-2 analogue. From this comparison was built the sequence consensus 4 (CS4) that contains His.sup.1, Gly.sup.4, Phe.sup.6, Ser.sup.7, Glu.sup.9, Thr.sup.12, Ile.sup.13, Leu.sup.14, Asp.sup.15, Leu.sup.17, Ala.sup.18, Ala.sup.19, Arg.sup.20, Asp.sup.21, Phe.sup.22, Ile.sup.23, Asn.sup.24, Trp.sup.25, Leu.sup.26, Ile.sup.27, Thr.sup.29, Lys.sup.30, Ile.sup.31, Thr.sup.32, Asp.sup.33.

    [0119] In step 5, the inventors aligned CS4 with CS3 in order to verify whether amino acids at position 3, 5, 9, 11, 13, 14, 17, 23, 27 and 29 were of the correct class. CS4 was then validated.

    [0120] The inventors next performed in step 6 analyses of sequence homology from one side between human GIP.sub.1-30 and CS4 and on the other side between human GLP-2 and CS4. The inventors evidenced that CS4 had a great sequence homology with human GLP-2 (76%) but a poor homology with human GIP.sub.1-30 (27%).

    [0121] They next adjusted CS4 at positions 2, 3, 5, 8, 10, 11, 16 and 28 resulting in consensus sequence 7 (CS7) as follows, His.sup.1, Gly.sup.2, Glu.sup.3, Gly.sup.4, Thr.sup.5, Phe.sup.6, Ser.sup.7, Ser.sup.8, Glu.sup.9, Ser.sup.11, Thr.sup.12, Ile.sup.13, Leu.sup.14, Asp.sup.15, Lys.sup.16, Leu.sup.17, Ala.sup.18, Ala.sup.19, Arg.sup.20, Asp.sup.21, Phe.sup.22, Ile.sup.23, Asn.sup.24, Trp.sup.25, Leu.sup.26, Ile.sup.27, Ala.sup.28, Thr.sup.29, Lys.sup.30, Ile.sup.31, Thr.sup.32 and Asp.sup.33. It is worth noting that Gly.sup.2 was chosen to confer dipeptidyl-peptidase-4 resistance.

    [0122] Again, the inventors checked the sequence homology with human GIP.sub.1-30 and human GLP-2 and found 45% and 76%, respectively. However, as their goal was to obtain at least 50% homology with both human molecules, they remodified CS7 to incorporate more homology with human GIP.sub.1-30. Modifications were made at positions 5, 7, 9, 12, 13, 23, 27, 28 and 31-33. This led to consensus sequence 9 (CS9) that is His.sup.1, Gly.sup.2, Glu.sup.3, Gly.sup.4, Sers, Phe.sup.6, Ser.sup.8, Asp.sup.9, Ser.sup.11, Leu.sup.14, Asp.sup.15, Lys.sup.16, Leu.sup.17, Ala.sup.18, Ala.sup.19, Arg.sup.20, Asp.sup.21, Phe.sup.22, Val.sup.23, Asn.sup.24, Trp.sup.25, Leu.sup.26, Leu.sup.27, Asn.sup.28, Thr.sup.29 and Lys.sup.30 with a terminal amidation. From the literature, it seemed that Ile.sup.31, Thr.sup.32 and Asp.sup.33 were not necessary if Lys.sup.30 was amidated (Wisniewski et al. (2016) J. Med. Chem. 59:3129-3139). They also decided that at positions 7, 10, 12 and 13 it could be any amino acid in order to play on the receptor binding capacity and biological activity.

    [0123] They next compared CS9 with human GIP.sub.1-30 and human GLP-2 and found more than 50% homology for both molecules, which led to the validation of CS9.

    Example 2: Effect of the Peptides of the Invention on Bone Remodeling

    Materials and Methods

    1. Reagents

    [0124] All analogues were purchased from GeneCust Europe with a purity >95% (Dudelange, Luxembourg). Purity has been verified by high performance liquid chromatography and peptide composition validated by mass spectroscopy. Murine MC3T3-E1 subclone 4, murine Raw 264.7 and human HEK-293 cells were purchased from American type culture collection (ATCC, Teddington, UK). Buffy coat from healthy individuals were obtained from Etablissement frangais du sang (Angers, France). Human and murine receptor activator of nuclear factor kB ligand (RANKL) and human macrophage colony stimulating factor (M-CSF) were purchased from R&D Systems Europe (Abingdon, UK). Human GIP receptor and human GLP-2 receptor cDNAs were purchased from Addgene (plasmid 14942, kindly donated by B. Thorens) and the PlasmlD Repository (plasmid HsCD00346244), respectively. All other chemicals were obtained from Sigma-Aldrich (Lyon, France) unless otherwise stated.

    2. Cell Culture

    [0125] Murine MC3T3-E1 subclone 4 cells were grown and expanded in propagation medium containing alpha minimum essential medium (αMEM) supplemented with 5% fetal bovine serum (FBS), 5% bovine calf serum, 100 U/mL penicillin, and 100 μg/mL streptomycin in a humidified atmosphere enriched with 5% CO.sub.2 at 37° C.

    [0126] Murine Raw 264.7 and human HEK-293 cells were grown and expanded in propagation medium containing Dulbecco's modified Eagle medium (DMEM) supplemented with 10% fetal bovine serum (FBS), 100 U/mL penicillin, and 100 μg/mL streptomycin in a humidified atmosphere enriched with 5% CO.sub.2 at 37° C.

    3. Cell Death Assay

    [0127] Increased plasma membrane permeability that occurs during cell death can be visualised using trypan blue, a dye that is excluded from living cells and is incorporated into the cells when they are undergoing death (Bellido and Plotkin (2008) Methods Mol. Biol. 455:51-75).

    [0128] Briefly, MC3T3-E1 cells were plated in 24 well-plates and cultured in the presence of saline, various concentrations of GL-0001 or 10.sup.−6M rosiglitazone, a drug known to increase bone cell death (Mieczkowska et al. (2012) J. Biol. Chem 287:23517-23526). After 24 h, the cell culture supernatant containing the floating cells was collected and put in previously labelled eppendorf tubes. Each well was washed in PBS before trypsin was added to detach adherent cells. The mixture containing detached adherent cells was collected and pooled in the eppendorf containing the cell culture supernatant. Cells were spun at 1,500 rotation per minute (rpm) for 10 minutes, the supernatant was removed carefully and cells were incubated with trypan blue 0.04% and transferred into a haemocytometer. Living (clear) and dead (blue) cells were counted under light microscope examination and the percentage of dead cells was determined for each condition as follow: % of dead cells=100×(Number of dead cells)/(Number of dead cells+Number of living cells)

    4. Osteoclast Assay

    [0129] Human peripheral blood mononuclear cells were isolated from 3 buffy coats obtained at the Etablissement Francais du Sang (Angers, France) as described in Mabilleau and Sabokbar (2009) PLoS One 4:e4173.

    [0130] Blood was diluted 1:1 in α-minimal essential medium (MEM) (Invitrogen, Paisley, UK), layered over Histopaque and centrifuged (700×g) for 20 min. The interface layer was resuspended in MEM then centrifuged (600×g) for a further 10 min after which the resultant cells were resuspended in media supplemented with 10% heat inactivated foetal calf serum (FCS, Invitrogen, Paisley, UK) and counted in a haemocytometer following lysis of red blood cells using a 5% (v/v) acetic acid solution.

    [0131] To assess the extent of osteoclast formation, isolated human PBMCs were cultured in 24-well plates in MEM containing 100 UI/ml penicillin, 100 μg/ml streptomycin and 10% FCS (osteoclast medium) (Mabilleau et al. (2011) J Biol Chem 286:3242-3249). After 2 h incubation, cultures were vigorously rinsed in medium to remove non-adherent cells, and then maintained in 1 ml MEM/FCS with 25 ng/ml recombinant human M-CSF, 50 ng/ml recombinant human sRANKL (added at day 7) and various concentrations of gut hormone analogues (added at day 7). Cultures were terminated after 14 days to assess the extent of osteoclast formation (TRAcP staining as described below). All factors were replenished every 2-3 days.

    [0132] Murine Raw 264.7 cells were scrapped off the plastic dish, plated at a density of 1.25×10.sup.4 cells/cm.sup.2 and grown in propagation medium enriched with 10 ng/ml soluble murine RANKL. After 110 h, cells were fixed with formalin (10% in PBS buffer) for 10 minutes and rinsed in distilled water prior to TRAcP staining.

    5. TRAcP Staining

    [0133] Tartrate resistant acid phosphatase (TRAcP) was histochemically revealed by a simultaneous coupling reaction using Naphtol AS-BI-phosphate as substrate and Fast violet B as the diazonium salt for 90 minutes at 37° C. in the dark. Cultures were rinsed three times in distilled water and the residual activity was inhibited by 4% NaF for 30 minutes. Cells were then rinsed in distilled water, counterstained with DAPI for 20 minutes and allowed to dry before mounting using an aqueous medium. TRAcP positive cells, with more than three nuclei, were identified as osteoclasts. The number of newly generated were assessed using light microscopic examination.

    6. Collagen Maturity Assay

    [0134] For collagen maturity assay, cells were detached with trypsin-EDTA, plated at a density of 1.5×10.sup.4 cells/cm.sup.2 and grown to confluence in propagation medium. At confluence, the propagation medium was replaced by the differentiation medium containing αMEM supplemented with 5% FBS, 5% bovine calf serum, 100 U/mL penicillin, 100 μg/mL streptomycin, 50 μg/ml ascorbic acid and various concentrations of analogues. This day was considered as day 1. The differentiation medium was replenished every two days.

    [0135] At day 14, osteoblast cultures were decellularized by incubation in 0.2 M sodium cacodylate buffer (pH 7.4) containing 0.1% triton X100 for 4 h on an orbital shaker. Cultures were rinsed at least six times with milliQ water, fixed in absolute ethanol, scrapped off the culture dish and transferred onto BaF2 windows where they were air-dried.

    [0136] Integrity of the collagen extracellular matrix was verified by comparing the obtained Fourier transform infrared spectrum with those of commercial collagen.

    [0137] Spectral analysis was performed using a Bruker Vertex 70 spectrometer (Bruker optics, Ettlingen, Germany) interfaced with a Bruker Hyperion 3000 infrared microscope equipped with a standard single element Mercury Cadmium Telluride (MCT) detector.

    [0138] Infrared spectra were recorded at a resolution of 4 cm.sup.−1, with an average of 32 scans in transmission mode. Background spectral images were collected under identical conditions from the same BaF2 windows at the beginning and end of each experiment to ensure instrument stability. At least 20 spectra were acquired for each condition and analyzed with a lab-made routine script in Matlab R2016b (The Mathworks, Natick, Mass.). The collagen maturity index was determined as the relative ratio of mature pyridinium to immature dehydrodihydroxylysinonorleucine collagen cross-links using their respective subbands located at 1660 cm.sup.−1 and 1690 cm.sup.−1 of the amide I peak.

    7. Binding Assay

    [0139] Human HEK-293 cells were plated at a density of 2×10.sup.5 cells/cm.sup.2 in 10 cm petri dishes. After 24h, cells were transfected with an optimized calcium phosphate method using 15 μg plasmid DNA encoding either the human GIP receptor or the human GLP-2 receptor. Twenty-four hours after transfection, transfected cells were detached and plated at a density of 6×10.sup.4 cells/cm.sup.2 in black 96 well plates with clear bottom (Ibidi GmbH, Martinsried, Germany). After 24h, various concentrations of analogues were added in each well in the presence of either 10.sup.−7M Fam-[D-Ala.sup.2]-GIP.sub.1-30 or 10.sup.−6M Fam-[Gly.sup.2]-GLP-2 in αMEM supplemented with 0.1% bovine serum albumin (BSA). Equilibrium binding was achieved overnight at 37° C. Cells were then washed twice with assay buffer and solubilized in 0.1 M NaOH.

    [0140] Fluorescence was read with an M2 microplate reader (Molecular devices, Wokingham, UK) with excitation wavelength set up at 490 nm and emission wavelength set up at 525 nm.

    Binding at the human GIP receptor or human GLP-2 receptor was achieved by non-linear regression analyses in GraphPad Prism 6.0.

    8. Cyclic AMP Assay

    [0141] Human HEK-293 cells were plated at a density of 2×10.sup.5 cells/cm.sup.2 in 4 well microslides (ibidi GmbH, Martinsried, Germany). After 24 h, cells were transfected with an optimized calcium phosphate method using 10 μg plasmid DNA encoding either the human GIP receptor or the human GLP-2 receptor and 5 μg of plasmid DNA encoding the mTurquoise-EPAC-.sup.cP173Venus-Venus H74 probe, kindly provided by Professor K. Jalink (Netherland Cancer Institute, Amsterdam, Netherland). In co-transfection experiments, cells were transfected with 5 μg plasmid DNA encoding the human GIP receptor, 5 μg plasmid DNA encoding the human GLP-2 receptor and 5 μg of plasmid DNA encoding the H74 probe. Twenty-four hours after transfection, transfected cells were rinsed in phosphate buffer saline and incubated in HEPES buffered saline (containing 140 mM NaCl, 5 mM KCl, 1 mM MgCl.sub.2, 1 mM CaCl.sub.2, 10 mM glucose, 10 mM HEPES) in a chamber containing a Leica imaging system (DMI6000 Inverted microscope fitted with a SP8 confocal head) and a controlled atmosphere (37° C., 5% CO.sub.2). The image acquisition was performed with a 63 X, 1.4 N.A. oil immersion objective and a Hybrid® detector (Leica) and images were collected after 30 minutes. Donor excitation was made with a 458 nm Ar laser, donor emission was collected between 460-505 nm and acceptor emission between 520-600 nm by setting the SP8 spectrometer accordingly. FRET was expressed as the ratio between donor and acceptor signals. The FRET value was set at 1 at the onset of the experiment. Vehicle, 10.sup.−9 M [D-Ala.sup.2]-GIP.sub.1-30, 10.sup.−9M [Gly.sup.2]-GLP-2 or 10-9 M GL-0001 were added in the assay medium and the FRET signal was measured as above.

    9. Animals

    [0142] BALB/c (BALB/cJRj) mice were obtained from Janvier Labs (Saint-Berthevin, France). All animal experiments were approved by the French ministry of higher education, research and innovation under the license 6154-201607211130415v1.

    [0143] Mice were housed 4 animals per cage in the institutional animal lab (Agreement E49007002) at 24° C.+/−2° C. with a 12-hour light/dark cycle, and were provided with tap water and normal diet (Diet A04, Safe, Augy, France) ad libitum until sacrifice by cervical dislocation. All procedures were conducted according to the French Animal Scientific Procedures Act 2013-118.

    [0144] Bilateral ovariectomy (OVX) was performed in 40 BALB/c mice at 12 weeks of age under general anesthesia supplemented with a p2 adrenergic receptor agonist. At 16 weeks of age, ALZET osmotic pumps (model number 2006, Durect Corp., Cupertino, Calif.) filled with the below saline or peptide were implanted subcutaneously between the two scapula under general anesthesia in 32 mice. Successful filling of pumps was verified by weighting the pump before and after filling. At 20 weeks of age, ALZET osmotic pumps were replaced by similar pumps to ensure delivery for four new weeks. Mice were randomly allocated into four groups: [0145] (i) vehicle daily (OVX+Veh, n=8), [0146] (ii) 25 nmoles/kg/day GL-0001 (OVX+GL-0001, n=8), [0147] (iii) 25 nmoles/kg/day GL-0007 (OVX+GL-0007_25, n=8), [0148] (iv) 100 nmoles/kg/day GL-0007 (OVX+GL-0007_100, n=8).

    [0149] These doses of analogues were based on the inventors' extensive knowledge on gut hormone analogues (Mabilleau et al. (2014) Bone 63:61-68; Mansur et al. (2015) J Cell Physiol 230:3009-3018; Mieczkowska et al. (2015) Bone 74:29-36; Mabilleau et al. (2016) Bone 91:102-112; Mansur et al. (2016) Bone 87:102-113; Pereira et al. (2017) Front Endocrinol (Lausanne) 8:327; Mabilleau et al. (2018) J Endocrinol.). Unfortunately, a mouse from the 25 nmoles/kg/day died during osmotic pump replacement.

    [0150] Eight additional OVX mice were used as positive controls (OVX+Zol) and were administered a single 100 μg/kg zoledronic acid (Reference number 6111, batch number 1A/203523, Tocris Bioscience, Bristol, UK) by intravenous injection in the tail vein. This dose and regimen of zoledronic acid was equivalent to the 5 mg infusion approved for the treatment of post-menopausal osteoporosis in humans.

    [0151] Body weight was monitored once a week with a precision scale (Adventurer™ Pro, Ohaus, Nanikon, Switzerland). All mice were also administered with calcein (10 mg/kg; ip) 12 and 2 days before being culled at 24 weeks of age. After necropsy, femurs, second and fifth lumbar vertebra, liver and pancreas were collected and processed as detailed below.

    10. Biomechanical Testings

    [0152] At necropsy, femurs and second lumbar vertebras (L2) were cleaned of soft tissue and immediately frozen in a saline-soaked gauze at −20° C. Three-point-bending experiments were performed on femurs after thawing bones at 4° C. overnight.

    [0153] Femur length was measured with a digital caliper (Mitutoyo, Roissy en France, France). No significant differences in femur length was observed between the groups.

    [0154] Femurs were loaded to failure in 3-point bending at 2 mm/min using a servohydraulic materials testing system (Instron 5942, Instron, Elancourt, France). The lower span length was of 10 mm. Femurs were oriented so the anterior quadrant was facing down and subjected to tensile loads. Load and displacement of the upper crosshead, which were digitally recorded at a sampling rate of 100 Hz, were measured using a 500 N load cell (Instron). Stiffness, ultimate load, yield load, post-yield displacement (PYD), and work-to-fracture were calculated from the load-displacement curves. PYD was defined as the displacement at failure minus the displacement at yield. Yield was defined as the point where the regression representing a 0.2% reduction in stiffness intersected the load-displacement curve.

    [0155] Compression experiments were performed on L2. Briefly, vertebral bodies were carefully dissected and glued with cyanoacrylate glue on a Plexiglas plate and then incubated in saline at 4° C. until use the next day. L2 vertebral bodies were compressed to failure at a displacement rate of 1 mm/min using an Instron 5942 device. Load and displacement of the upper plateau were recorded at a sampling rate of 100 Hz. Maximum load and stiffness were computerized from load-displacement curves.

    11. Microcomputed/Nanocomputed X-Ray Tomography (MicroCT)

    [0156] MicroCT analyses at the femur midshaft were performed with a Skyscan 1076 microtomograph (Bruker MicroCT, Kontich, Belgium) operated at 50 kV, 200 μA, 2000 ms integration time. The isotropic pixel size was fixed at 9 μm, the rotation step at 0.5° and exposure was done with a 0.5-mm aluminum filter. Each 3D reconstruction image dataset was binarized using global thresholding. Cortical volume of interest (VOI) was located 4 mm above the distal growth plate and extended 1 mm further up.

    [0157] Analyses of vertebral bodies of the fifth lumbar vertebra (L5) were performed with a Nanotom nanotomograph (Phoenix, GE, USA) operated at 85 kV, 220 μA, 1000 ms integration time. The isotropic pixel size was fixed at 4 μm, the rotation step at 0.25° and exposure was done with a 0.1 mm copper filter. Each 3D reconstruction image dataset was binarized using global thresholding. Trabecular volume of interest was computerized on coronal sections of the L5 vertebral body. Trabecular VOI was spread over the entire vertebral body excluding the first and last 80 μm from the anterior and posterior cortical wall. All microCT/NanoCT parameters were determined according to guidelines and nomenclature proposed by the American Society for Bone and Mineral Research (Bouxsein et al., 2010).

    12. Bone Composition Assessment

    [0158] After three-point bending experiments, femurs were embedded undecalcified in pMMA at 4° C. One-micrometer cross-sectional sections of the midshaft femur were sandwiched between BaF2 optical windows and Fourier transform infrared imaging (FTIRI) assessment was performed in the posterior quadrant. FTIRI was performed with a vertex 70 spectrometer (Bruker, Ettlingen, Germany) interfaced with a Hyperion 3000 microscope and a focal plane array detector (64×64 pixels) covering a field of view of 180×180 μm. Nine field-of-view were stitched together to allow sufficient bone to be analyzed. Sections were scanned with a spectral resolution of 8 cm.sup.−1 (spectral region 900-2000 cm.sup.−1). Each spectrum was corrected for Mie scattering with the RMieS-EMSC_v5 algorithm (kind gift of Prof Peter Gardner, University of Manchester, UK) prior to be subjected to pMMA subtraction.

    [0159] Evaluation of spectral images was done with a lab-made routine script in Matlab R2016b (The Mathworks, Natick, Mass.) as described in Aguado et al. (2017) Calcif Tissue Int 100:332-340.

    [0160] FTIR bone parameters (Paschalis (2012) Methods Mol Biol 816:517-525) calculated were: (1) phosphate/amide ratio (area of v1, v3 phosphate/area amide1); (2) acid phosphate content (intensity ratio 1127 cm.sup.−1/1096 cm.sup.−1) (Spevak et al. (2013) Calcif Tissue Int 92:418-428); (3) mineral crystallinity (intensity ratio 1030 cm.sup.−1/1020 cm.sup.−1), reflecting crystal size and perfection; (4) crystal size index (intensity ratio 1075 cm.sup.−1/1055 cm.sup.−1), representing the crystal size in 002, 211, 200 and 202 directions (Gadaleta et al. (1996) Calcif Tissue Int 58:9-16) and (5) collagen maturity (intensity ratio 1660 cm.sup.−1/1690 cm.sup.−1).

    [0161] The carbonate/phosphate ratio (intensity v3 carbonate located at ˜1415 cm.sup.−1/1030 cm.sup.−1) was computed after subtracting the organic matrix spectrum (Ou-Yang et al. (2001) J Bone Miner Res 16:893-900). For each of the compositional parameters, the mean and full width at half maximum of the pixel distribution (excluding the zero background values) were computed and represented as mean and heterogeneity.

    13. Histology

    [0162] Liver and pancreas were collected at necropsy and immediately fixed in formalin. After paraffin embedding, 4-μm thick section were cut and stained with hematoxylin/phloxin staining. Histological observations have been made by a trained histologist in order to assess the presence of tissue abnormalities.

    14. Statistical Analysis

    [0163] One-way analyses of variance with Holm-Sidak's multiple comparisons test, with a single pooled variance were used to compare differences in collagen maturity and number of osteoclast in FIGS. 2-3 as well as cAMP levels in FIGS. 16-18.

    [0164] One-way analyses of variance with Dunnett multiple comparison test were employed to test for significance between OVX+Veh, OVX+GL-0001, OVX+GL-0007_25 and OVX+GL-0007_100 groups.

    [0165] Differences at p equal to or less than 0.05 were considered significant.

    Results

    [0166] Based on the consensus sequence obtained as disclosed in Example 1, the following peptides were tested by the inventors.

    TABLE-US-00008 TABLE 1 Double analogues peptides Homology Homology Peptide Sequence GIP GLP-2 GL-0001 HGEGSFGSDMSIALDKLAARDFVNWLLQTKITD 55% 67% (SEQ ID NO: 3) GL-0001-Tag HGEGSFGSDMSIALDKLAARDFVNWLLQTKITDGA 43% 52% ADDDDDD (SEQ ID NO: 5) GL-0002 HGEGSFVSDMSIVLDKLAARDFVNWLLQTK.sub.-NH2 57% 58% (SEQ ID NO: 6) GL-0003 HGEGSFVSEMSIVLDKLAARDFVNWLLQTK.sub.-NH2 53% 61% (SEQ ID NO: 7) GL-0004 HGEGSFVSDMSVVLDKLAARDFVNWLLQTK.sub.-NH2 53% 58% (SEQ ID NO: 8) GL-0005 HGEGSFVSDLSVVLDKLAARDFVNWLLQTK.sub.-NH2 53% 55% (SEQ ID NO: 9) GL-0006 HGEGSFVSDFSVVLDKLAARDFVNWLLQTK.sub.-NH2 53% 55% (SEQ ID NO: 10) GL-0007 HGEGSFGSDFSIALDKLAARDFVNWLLQTK.sub.-NH2 60% 55% (SEQ ID NO: 4) GL-0008 HGEGSFTSDFSIALDKLAARDFVNWLLQTK.sub.-NH2 60% 55% (SEQ ID NO: 11) GL-0009 HGEGSFVSDFSIALDKLAARDFVNWLLQTK.sub.-NH2 60% 55% (SEQ ID NO: 12)

    1. Effects OfJoint Administration of GIP and GLP-2 on Collagen Maturity and Number of Osteoclasts

    [0167] FIG. 2 presents the effects of vehicle (CTRL), [D-Ala.sup.2]-GIP.sub.1-30NH2, [Gly.sup.2]-GLP-2 or joint administration of [D-Ala.sup.2]-GIP.sub.1-30NH2 and [Gly.sup.2]-GLP-2 on collagen maturity.

    [0168] [D-Ala.sup.2]-GIP.sub.1-30NH2 or [Gly.sup.2]-GLP-2 were capable of increasing collagen maturity to approximately 82% (p=0.074) or 111% (p=0.0246), respectively. The joint administration of [D-Ala.sup.2]-GIP.sub.1-30NH2 and [Gly.sup.2]-GLP-2 resulted in a significant increase (255%, p<0.001) in this parameter. This increase was also significantly greater than observed with [D-Ala.sup.2]GIP.sub.1-30NH2 or [Gly.sup.2]-GLP-2 alone.

    [0169] FIG. 3 presents the effects of vehicle (CTRL), [D-Ala.sup.2]-GIP.sub.1-30NH2, [Gly.sup.2]-GLP-2 or joint administration of [D-Ala.sup.2]-GIP.sub.1-30NH2 and [Gly.sup.2]-GLP-2 on human osteoclast formation in vitro. Here again, [D-Ala.sup.2]-GIP.sub.1-30NH2 and [Gly.sup.2]-GLP-2 were potent to significantly reduced osteoclast formation by 16% (p<0.001) and 34% (p<0.001), respectively. Joint administration of these molecules led to a significant 66% reduction (p<0.001) in osteoclast formation.

    2. Effects of GL-0001 on Osteoblast Cell Death.

    [0170] FIG. 4 presents the results on MC3T3-E1 cell death in the presence of vehicle, GL-0001 or rosiglitazone. The inventors previously shown that rosiglitazone administration results in increase cell death and as such was used in this assay as a positive inductor of cell death.

    [0171] This figure shows that GL-0001 at concentration as high as 10.sup.−6 M does not induce cell death, in opposition to rosiglitazone.

    3. Binding Affinity of Double Analogues at the Human GIP Receptor and their Respective IC50.

    [0172] The inventors determined the binding affinities of [D-Ala.sup.2]GIP.sub.1-30NH2 or the double analogues peptides disclosed in Table 1 above at the human GIP receptors. The corresponding IC50 determined for each compound was as follows:

    TABLE-US-00009 TABLE 2 IC50 towards GIP receptor IC50 (nM) [D-Ala.sup.2]GIP.sub.1-30NH2  0.97 ± 0.29 GL-0001  1.19 ± 0.53 GL-0002  2.78 ± 0.82 GL-0003  0.72 ± 0.15 GL-0004 37.85 ± 14.8 GL-0005  0.14 ± 0.04 GL-0006  4.60 ± 1.25 GL-0007  1.05 ± 0.41 GL-0008  0.91 ± 0.25 GL-0009 13.05 ± 3.14

    [0173] From IC50 values, the potency of the different analogues tested appeared as GL-0005>GL-0003>GL-0008>[D-Ala.sup.2]GIP.sub.1-30NH2>GL-0007>GL-0001>GL-0002>GL-0006>GL-0009>GL-0004.

    4. Binding Affinity of Double Analogues at the Human GLP-2 Receptor and their Respective IC50.

    [0174] The inventors determined the binding affinities of [Gly.sup.2]GLP-2 or the double analogues peptides disclosed in Table 1 above at the human GLP-2 receptors. The corresponding IC50 determined for each compound was as follows:

    TABLE-US-00010 TABLE 3 IC50 towards GLP-2 receptor IC50 (nM) [Gly.sup.2]GLP-2  0.19 ± 0.04 GL-0001  0.44 ± 0.12 GL-0002 15.16 ± 3.00 GL-0003 22.86 ± 3.67 GL-0004  0.07 ± 0.02 GL-0005 15.05 ± 4.93 GL-0006  1.04 ± 0.20 GL-0007  0.57 ± 0.17 GL-0008 14.74 ± 5.69 GL-0009 53.01 ± 11.9

    [0175] From IC50 values, the potency of the different analogues tested appeared as GL-0004>[Gly.sup.2]GLP-2>GL-0001>GL-0007>GL-0006>GL-0008>GL-0005>GL-0002>GL-0003>GL-0009.

    5. Effects of Double Analogue on Osteoclast Formation In Vitro and their Respective IC50.

    [0176] The inventors determined the effects of [D-Ala.sup.2]-GIP.sub.1-30NH2, [Gly.sup.2]-GLP-2 or the double analogues peptides disclosed in Table 1 on Raw264.7 cell-mediated osteoclast formation in vitro.

    [0177] The corresponding IC50 determined for each compound was as follows:

    TABLE-US-00011 TABLE 4 IC50 on osteoclast formation IC50 (pM) [D-Ala.sup.2]-GIP.sub.1-30NH2  40.1 ± 10.6 [Gly.sup.2]GLP-2  32.2 ± 15.1 GL-0001  18.2 ± 5.6 GL-0001-Tag  2144 ± 25670 GL-0002  1520 ± 3288 GL-0003  4631 ± 12784 GL-0004  11.6 ± 6.1 GL-0005  10.7 ± 9.7 GL-0006   9.6 ± 4.3 GL-0007  36.0 ± 11.2 GL-0008  16.8 ± 4.2 GL-0009 180.5 ± 307.1

    [0178] From IC50 values, the potency of the different analogues tested appeared as GL-0006>GL-0005>GL-0004>GL-0008>GL-0001>[Gly.sup.2]GLP-2>GL-0007>[D-Ala.sup.2]GIP.sub.1-30NH2>GL-0009>GL-0002>GL-0001-Tag>GL-0003.

    6. Effects of Double Analogue on Collagen Maturity In Vitro.

    [0179] FIGS. 5-7 present the effects of [D-Ala.sup.2]-GIP.sub.1-30NH2, [Gly.sup.2]-GLP-2 or the double analogues peptides disclosed in Table 1 on collagen maturity in MC3T3-E1 cultures in vitro. The dotted line corresponds to basal collagen maturity.

    [0180] Some of the analogues presented with a biphasic profile, namely GL-0001-Tag, GL-0002, GL-0004.

    [0181] The inventors previously showed that the maximum collagen maturity was obtained at a concentration of 100-200 pM [D-Ala.sup.2]GIP.sub.1-42 (Mieczkowska et al. (2015) Bone 74:29-36). As such, the mean collagen maturity between concentrations of 100-200 pM was determined for each analogues and the potency of all these molecules was GL-0007>GL-0001>[Gly.sup.2]GLP-2>GL-0008>GL-0006 and GL-0009>[D-Ala.sup.2]GIP.sub.1-30NH2>GL-0001-Tag>GL-0002>GL-0004 and GL-0005>GL-0003.

    [0182] Although a positive effect was observed with each tested peptide, the inventors identified peptides GL-0001 and GL-0007 as particularly interesting peptides. Based on osteoclast formation in vitro and collagen maturity in vitro, GL-0001 and GL-0007 were the only two peptides with better potency than each native peptide and were thus selected for the following experiments.

    7. Effects of GL-0001 or GL-0007 on Body Mass

    [0183] FIG. 8 represents the body mass of animals at the end of the 8-week period of treatment. It is worth noting that zoledronic acid-injected animals did not receive any ALZET pump implantation that weight approximately 1.3-1.5 g. As compared with vehicle, none of the treatment led to significant modifications of body weight.

    8. Effects of GL-0001 or GL-0007 on Cortical Bone Strength

    [0184] FIG. 9 presents data on cortical bone strength in the appendicular skeleton in ovariectomy-induced bone loss in mice as a model of post-menopausal osteoporosis. Ovariectomized animals were treated with vehicle, 25 nmoles/kg/day GL-0001, 25 nmoles/kg/day GL-0007 or 100 nmoles/kg/day GL-0007. Zoledronic acid, that represents one of the most used molecules to treat post-menopausal osteoporosis, was used as a positive comparator after a single intravenous administration (100 μg/kg).

    [0185] Although none of the double analogue or zoledronic acid was potent in modifying ultimate load, yield load or stiffness, GL-0001 was capable of significantly increasing ultimate displacement (34%, p=0.047), post-yield displacement (70%, p=0.038) and work-to-fracture (37%, p=0.022), the latter representing the energy required to break the bone. A higher work-to-fracture means a more resistant bone. GL-0007 at 100 nmoles/kg/day increased ultimate displacement (33%, p=0.054) and post-yield displacement (62%, p=0.074) that ultimately led to a significant augmentation in work-to-fracture (33%, p=0.049).

    9. Effects of GL-0001 or GL-0007 on Cortical Bone Microarchitecture.

    [0186] FIGS. 10-11 show data on cortical bone microarchitecture in the appendicular skeleton in ovariectomized mice. Animals were treated with vehicle, 25 nmoles/kg/day GL-0001, 25 nmoles/kg/day GL-0007, 100 nmoles/kg/day GL-0007 or zoledronic acid (once 100 μg/kg iv). Cortical bone microarchitecture was investigated in the femur 4 mm above the distal growth plate. None of the vehicle, double analogues or zoledronic acid were capable of affecting cortical bone microarchitecture.

    10. Effects of GL-0001 or GL-0007 on Trabecular Bone Strength and Microarchitecture

    [0187] FIGS. 12-13 report data on trabecular bone features in the axial skeleton and more precisely in lumbar spine. Trabecular bone strength was assessed in the second lumbar vertebra by compression test (FIG. 12). As compared to vehicle-treated animals, GL-0001, GL-0007 at both concentrations and zoledronic acid significantly reduced bone stiffness. As compression test is destructive, trabecular microarchitecture was studied in the fifth lumbar vertebra (FIG. 13). As expected, zoledronic acid was capable of increasing trabecular bone mass (BV/TV) by 15% (p=0.013) and trabecular number by 12% (p=0.036). GL-0007 at a concentration of 25 nmoles/kg/day led to a modest but significant (p=0.009) reduction in trabecular spacing by 17%.

    11. Effects of GL-0001 or GL-0007 on Bone Matrix Composition

    [0188] FIGS. 14-15 investigated the effects of double analogue administration on tissue material properties in cortical bone of the appendicular skeleton. As compared with vehicle, GL-0001 significantly increased mean collagen maturity (10%, p=0.017), collagen maturity heterogeneity (28%, p=0.008), acid phosphate content heterogeneity (21%, p=0.016) and reduced mean phosphate/amide ratio (6%, p=0.016). GL-0007 at 100 nmoles/kg/day significantly decreased mean phosphate/amide ratio (5%, p=0.031) and augmented acid phosphate content heterogeneity (18%, p=0.044). Zoledronic acid had modest effects as only mineral crystallinity heterogeneity was significantly augmented (21%, p=0.002).

    12. Histological Investigations of Liver and Pancreas Architecture

    [0189] The inventors performed histological analysis in the liver and the pancreas. Liver and pancreas were processed, embedded, sectioned, stained and examined for any sign of edema, inflammation or necrosis in the presence of vehicle, 25 nmoles/kg/day GL-0001 or 25 nmoles/kg/day GL-0007. No sign of morphological alteration or necrosis were observed between the three groups.

    13. Activation of the GIPr and GLP-2r

    [0190] The inventors studied the rise in cAMP levels in response to vehicle, [D-Ala.sup.2]GIP.sub.1-30NH2, [Gly.sup.2]GLP-2 or GL-0001. In HEK 293 cells transfected only with the human GIPr, [D-Ala.sup.2]GIP.sub.1-30NH2 and GL-0001, but not vehicle or [Gly.sup.2]GLP-2, increased intracellular levels of cAMP (FIG. 16). In HEK 293 cells transfected only with the human GLP-2r, [Gly.sup.2]GLP-2 and GL-0001, but not vehicle or [D-Ala.sup.2]GIP.sub.1-30NH2, increased intracellular levels of cAMP (FIG. 17). In HEK 293 cells co-transfected with the human GIPr and the human GLP-2r, [D-Ala.sup.2]GIP.sub.1-30NH2, [Gly.sup.2]GLP-2 and GL-0001, but not vehicle, increased intracellular levels of cAMP (FIG. 18). It is worth noting that the magnitude of cAMP rise in co-transfected cells was greater with GL-0001 than with each native peptide.

    CONCLUSION

    [0191] All these data confirm that the peptides of the present invention increase enzymatic cross-linking of collagen matrix produced by osteoblasts at a higher level than each native peptide in vitro and in vivo, reduced the number of generated osteoclasts in a more important way than each native peptide, increased bone resistance to fracture better than the gold standard zoledronic acid and are accordingly potent agents for treating bone disorders

    Example 3: Comparison of the Peptides of the Invention with the Peptides of the Prior Art

    [0192] The aim of this study was to compare the potential of double GIP/GLP-2 analogues of the invention, in particular GL-0001 and GL-0007, and three peptides from patent application WO2018/069442, namely peptide Co-3 of sequence HADGTFISDYSTILDNLAARDFINWLIQTKITD (SEQ ID NO: 14), peptide Co-7 of sequence HAEGTFISDYSIAMDKLAARDFINWLIQTKITD (SEQ ID NO: 15) and peptide Co-19 of sequence HADGTFISDYSTILDNLAARDFINWLIQTKGKK (SEQ ID NO: 16).

    [0193] Peptides Co-3, Co-7 and Co-19 were cited as double GIP/GLP-2 analogues in WO2018/069442. However, no data were provided for the deposition and maturation of the bone matrix (i.e. collagen maturity) by osteoblasts. This protocol allowed the invention to assess the action of double GIP/GLP-2 analogues as synergic, additive or antagonist.

    Materials and Methods

    1. Peptide Sequences

    [0194] All peptides have been made by Fmoc synthesis by GeneCust, Boynes, France. Purity and peptide composition have been verified by high performance liquid chromatography and mass spectrometry. Peptide sequences, lot number and purity are indicated in the table 5 below.

    TABLE-US-00012 TABLE 5 Peptides used Peptide Sequence SEQ ID Lot number Purity GL-0001 HGEGSFGSDMSIALDKLAARDFVNWLLQTKITD 3 P190228- 95.41% MJ445040 GL-0007 HGEGSFGSDFSIALDKLAARDFVNWLLQTK 4 P170930- 99.40% MJ581686 Co-3 HADGTFISDYSTILDNLAARDFINWLIQTKITD 14 P191021- 95.30% LL755889 Co-7 HAEGTFISDYSIAMDKLAARDFINWLIQTKITD 15 P191021- 96.71% LL755890 Co-19 HADGTFISDYSTILDNLAARDFINWLIQTKGKK 16 P191021- 95.36% LL755891

    2. Sequence Homology

    [0195] In order to determine the percentage of homology between the peptide of the invention and peptides disclosed in WO2018/069442, peptide sequences were aligned with the Needleman-Wunsch algorithm in Matlab R2016b (nwalign function).

    3. Data

    [0196] Briefly, MC3T3-E1 subclone 4 cells have been grown and propagated in α-MEM supplemented with 5% fetal bovine serum (FBS), 5% bovine calf serum (BCS), 100 U/mL penicillin, and 100 μg/mL streptomycin in a humidified atmosphere enriched with 5% CO.sub.2 at 37° C.

    [0197] For collagen maturity assay, cells were detached with 0.05% trypsin-EDTA, plated at a density of 1.5×10.sup.4 cells/cm.sup.2 and grown to confluence in α-MEM supplemented with 5% FBS, 5% BCS, 100 U/mL penicillin, and 100 μg/mL streptomycin. At confluence, the culture medium was replaced by the differentiation medium containing α-MEM supplemented with 5% FBS, 5% BCS, 100 U/mL penicillin, 100 μg/mL streptomycin, 50 μg/ml ascorbic acid and various concentrations of GIP, GLP-2 or double GIP/GLP-2 analogues. This day was considered as day 1. The differentiation medium was replenished every two days. At day 14, osteoblast cultures were decellularized by incubation in 0.2 M sodium cacodylate buffer (pH 7.4) containing 0.1% triton X100 for 4 h on an orbital shaker. Cultures were rinsed at least six times with milliQ water, fixed in absolute ethanol, scrapped off the culture dish and transferred onto BaF2 windows where they were air-dried. Integrity of the collagen extracellular matrix was verified by comparing the obtained Fourier transform infrared spectrum with those of commercial collagen. Spectral analysis was performed using a Bruker Vertex 70 spectrometer (Bruker optics, Ettlingen, Germany) interfaced with a Bruker Hyperion 3000 infrared microscope equipped with a standard single element Mercury Cadmium Telluride (MCT) detector. Calibration of the infrared spectrometer is done once a week with a polystyrene film standard (Bruker optics). Infrared spectra were recorded at a resolution of 4 cm.sup.−1, with an average of 32 scans in transmission mode. Background spectral images were collected under identical conditions from the same BaF2 windows at the beginning and end of each experiment to ensure instrument stability. At least 5 spectra were acquired for each condition and analyzed with a lab-made routine script (version 2.0) in Matlab R2016b (The Mathworks, Natick, Mass.). The collagen maturity index was determined as the relative ratio of mature trivalent and immature divalent collagen cross-links using their respective subbands located at 1660 cm.sup.−1 and 1690 cm.sup.−1 of the amide I peak.

    [0198] For GIP and GLP-2 dataset, the inventors used the collagen maturity data previously acquired and analyzed.

    4. Assessment of Synergism Mode of Action

    [0199] First of all, collagen maturity obtained in control cultures, i.e. in the absence of double GIP/GLP-2 analogues, were averaged and subtracted to the all dataset. In order to determine the effects of administration of double GIP/GLP-2 analogue, transformed dataset was divided by the mean value of untreated cultures. For each concentration of peptide, the mean, SD and number of events were computed. These data were then exported to GraphPad Prism (version 8.0) for further analysis. The GraphPad Prism analysis consisted in: (1) transformation of drug concentration in log(concentration), (2) curve fitting with either Gaussian, stimulated dose-response (four parameters), sum of two Gaussian or 6.sup.th order polynomial function and (3) Estimation of EC50 and E.sub.max for each drug.

    [0200] Furthermore, in order to investigate the synergism effect, the inventors estimated the effects of double GIP/GLP-2 analogues at fixed dose of EC50 encountered with GIP and GLP-2 and of: 0.2, 0.4, 0.8, 0.9, 1.0, 1.2 and 1.5 times EC50 GIP/GLP-2. At each concentration, the combination index was computed using the Chou & Talalay model (Chou & Talalay (1983) Trends Pharmacol Sci 4: 450-454) as follows:


    CI=(E.sub.GIP+E.sub.GLP2−(E.sub.GIP×E.sub.GLP2))/E.sub.DA

    where E.sub.GIP, E.sub.GLP2 and E.sub.DA represents the effects observed with GIP alone, GLP-2 alone or a dual agonist, respectively. The inventors previously observed that although GIP and GLP-2 exhibited different maximum effects on collagen maturity, their respective EC50 were approximately similar.

    5. Statistical Analysis

    [0201] Differences in combination index at EC50 and 1.5×EC50 were compared with additivity, defined as a value of 1.0±0.15, with a two-tailed t-test. P value <0.05 were considered significant. Data are represented as mean±SD.

    Results

    1. Sequence Homology Between Peptides of the Invention and Peptides Disclosed WO2018/069442

    [0202] Percentages of sequence homology have been computerized and presented in Table 6 below. Sequence alignment between GL-0001 and GL-0007, and peptides disclosed in WO2018/069442 are also presented in Table 6 below.

    [0203] Peptide Co-7 from WO2018/069442 displays the maximum sequence homology with both GL-0001 and GL-0007. As data were provided in WO2018/069442 with peptide Co-3 and Co-19 on alkaline phosphatase, the inventors chose also these two peptides for further comparison.

    TABLE-US-00013 TABLE 6 Percentage of sequence homology between peptides of the invention and peptides from WO 2018/069442 Peptides of the invention GL1 GL7 GL2 GL3 GL4 GL5 GL6 GL8 GL9 GL1t Pe Co1 73 64 64 67 64 64 64 64 64 57 Co2 57 50 50 48 50 50 50 50 50 57 Co3 70 61 61 58 61 61 61 61 61 55 Co4 76 67 67 64 67 67 67 67 67 60 Co5 67 58 58 61 58 58 58 58 58 52 Co6 73 61 64 61 64 61 61 61 61 57 Co7 79 70 67 64 64 64 64 70 70 62 Co8 61 52 52 48 52 52 52 52 52 48 Co9 73 67 67 64 67 67 67 67 67 57 Co10 64 64 64 61 64 64 64 64 64 52 Co11 73 64 64 61 64 64 64 64 64 57 Co12 70 61 61 58 61 61 61 61 61 55 Co13 70 61 61 58 61 61 61 61 61 55 Co14 67 58 58 55 58 58 58 58 58 52 Co15 67 58 58 61 58 58 58 58 58 52 Co16 67 61 61 58 61 61 61 61 61 52 Co17 67 61 61 58 61 61 61 61 61 52 Co18 67 61 61 58 61 61 61 61 61 52 Co19 61 61 61 58 61 61 61 61 61 50 Co20 67 58 58 55 58 58 58 58 58 52 Co24 67 61 61 58 61 61 61 61 61 52 Co25 64 58 58 55 58 58 58 58 58 50 Co26 70 64 64 61 64 64 64 64 64 55 Co27 64 58 58 55 58 58 58 58 58 50 Co28 64 58 58 55 58 58 58 58 58 50 Co34 52 48 48 45 48 48 48 48 48 48

    [0204] Differences in amino acid composition (identical or same class) at the same position between the peptides of the invention and the peptides of WO2018/069442 peptide has been summarized in FIG. 19.

    [0205] For GL-0001, major differences with peptide Co-3, Co-7 and Co-19 are at position 7, 12, 13, 31, 32 and 33. For GL-0007, major differences with peptide Co-3, Co-7 and Co-19 are at position 7, 12, 13, 31, 32 and 33.

    2. Collagen Maturity as a Function of Peptide Concentration

    [0206] Collagen maturity index obtained as the ratio of trivalent mature/divalent mature collagen crosslinks were measured in the extracellular matrix. FIG. 20 represents the effects of the peptides of the invention and the peptides of WO2018/069442 on this parameter.

    [0207] As expected, and confirming previous data, GL-0001 and GL-0007 increased collagen maturity above the index observed in the absence of peptide (dotted line). Interestingly, the effects of Peptides Co-3, Co-7 and Co-19 were very modest to raise the collagen maturity index.

    3. Dose-Effect Curves of Double GIP/GLP-2 Analogue on Collagen Maturity

    [0208] Dose-effect curves have been plotted for each double GIP/GLP-2 analogue. The best fit model for each double GIP/GLP-2 analogue is presented in Table 7.

    TABLE-US-00014 TABLE 7 Estimation of the best fit models for dose-response curve Double GIP/GLP-2 analogue Fit model R.sup.2 GL-0001 Gaussian 0.647 GL-0007 Gaussian 0.590 Co-3 6.sup.th order polynomial 0.210 Co-7 6.sup.th order polynomial 0.404 Co-19 Sum of two gaussian 0.248

    4. EC50 of Double GIP/GLP-2 Analogue on Collagen Maturity

    [0209] EC50 of each double GIP/GLP-2 analogues were identified from dose-effect curves. Reciprocal EC50 are represented in Table 8.

    TABLE-US-00015 TABLE 8 Determination of EC50 and E.sub.max for dose-effect curves. Data represents mean ± SD of 5 individual experiments. Compound EC50 (pM) E.sub.max (%) [D-Ala.sup.2]-GIP.sub.1-30   74 ± 13 108.1% [Gly.sup.2]-GLP-2   63 ± 42 119.3% Invention GL-0001 26.2 ± 17.1 207.0% GL-0007 25.9 ± 14.5 232.3% WO2018/069442 Co-3 19.4 ± 124.3 121.8% Co-7  8.6 ± 6.9 115.6% Co-19 22.9 ± 144.3 118.1%

    [0210] As presented earlier, [D-Ala.sup.2]-GIP.sub.1-30 and [Gly.sup.2]-GLP-2 exhibited similar EC50 and hence an average EC50 of 69 pM was used for the determination of combination index. Interestingly, all double GIP/GLP-2 analogues exhibited an EC50 in the same range suggesting that the same concentration can be used to achieve half of the maximum effects. However, clear differences were observed in term of maximum effects (E.sub.max) as GL-0001 and GL-0007 clearly almost double the maximum effects observed with WO2018/069442 peptides.

    5. Combination Index of Double GIP/GLP-2 Analogue on Collagen Maturity

    [0211] Combination index, based on the Chou & Talalay model, were computed at 0.2, 0.4, 0.8, 0.9, 1.0, 1.2 and 1.5 times mean EC50 of GIP and GLP-2, i.e. at 14, 27, 54, 61, 69, 82 and 100 pM. FIG. 21 represents a plotting of combination indexes over concentration to show the evolution of CI over dose.

    [0212] Tables 9 and 10 represent the respective combination index of each double GIP/GLP-2 analogues at EC50 and 1.5×EC50.

    TABLE-US-00016 TABLE 9 Combination index on collagen maturity and their interpretation at EC50 Compound Cl at EC50 p value Interpretation GL-0001  0.16 ± 0.02 <0.0001 Strong synergism GL-0007  0.14 ± 0.02 <0.0001 Strong synergism Co-3  1.29 ± 1.65 0.704 Additive Co-7  1.53 ± 1.10 0.315 Additive Co-19 277.7 ± 617.4 0.346 Additive

    TABLE-US-00017 TABLE 10 Combination index on collagen maturity and their interpretation at 1.5 × EC50 Compound Cl at 1.5 × EC50 p value Interpretation GL-0001  0.20 ± 0.03 <0.0001 Strong synergism GL-0007  0.17 ± 0.02 <0.0001 Strong synergism Co-3  1.79 ± 2.20 0.448 Additive Co-7  2.30 ± 1.01 0.021 Antagonism Co-19 389.0 ± 864 0.345 Additive
    CI>10: very strong antagonism; CI 3.3-10: strong antagonism; CI 1.45-3.3: antagonism; CI 1.15-1.45 moderate antagonism; CI 0.85-1.15: additive; CI 0.85-0.65: moderate synergism; CI 0.3-0.65: synergism; CI 0.1-0.3 strong synergism; CI<0.1: very strong synergism.
    Data are presented as mean±SD of 5-13 experiments. Two-tailed t-test have been used to assess whether CI were significantly different as compared with additivity (1.0±0.15).

    [0213] GL-0001 and GL-0007 displayed, at 69 pM and 100 pM, combination indexes suggesting strong synergism. Previously, the inventors already exhibited similar behavior with combination index for GL-0001 and GL-0007 supporting of synergism. The present study is in adequation with previous obtained data.

    [0214] Interestingly, none of peptides Co-3, Co-7 and Co-19 presented synergism properties but rather additive or antagonism depending on the concentration.

    [0215] Based on combination index at EC50 and 1.5×EC50, only GL-0001 and GL-0007 appears as good candidate for synergism.

    CONCLUSIONS

    [0216] This study compared the effects of double GIP/GLP-2 analogues of the invention and peptides disclosed in the WO2018/069442 patent application.

    [0217] GL-0001 and GL-0007, which are peptides of the invention, were selected as they represent the best compromise in term of action on collagen maturity and osteoclastogenesis. Sequence alignment with WO2018/069442 peptides showed that peptide Co-7 was the closest peptide to GL-0001 and GL-0007. As data on alkaline phosphatase were provided in WO2018/069442 with peptide Co-3 and peptide Co-19, the inventors decided to compare head-to-head the action of GL-0001 and GL-0007 in one hand, to peptides Co-3, Co-7 and Co-19, in the other hand. Although all peptides exhibited a similar EC50, clear differences were evident in the magnitude of the maximum effects. This implies that for the same dose of peptide, the effects on collagen maturity would be greater with the peptides of the invention. Furthermore, the pharmacological mechanisms behind double GIP/GLP-2 analogues were deciphered and whilst the peptides of the invention presented a strong synergism, WO2018/069442 peptides showed additive or antagonism mode of action.

    Example 4: Comparison of the Peptides of the Invention with the Peptides of the Prior Art

    [0218] The aim of this study was to compare the potential of double GIP/GLP-2 analogues of the invention, namely GL-0001 and GL-0007, and three peptides from patent application WO2018/069442, namely peptides Co-3, Co-7 and Co-19 on osteoclastogenesis in vitro.

    Materials and Methods

    1. Peptide Sequences

    [0219] Peptides were as disclosed in Example 3.

    2. Cells and Propagation Method

    [0220] Murine Raw 264.7 cells were grown and expanded in propagation medium containing Dulbecco's modified Eagle medium (DMEM—Gibco) supplemented with 10% fetal bovine serum (FBS—Lonza), 100 U/mL penicillin and 100 μg/mL streptomycin (Gibco) in a humidified atmosphere enriched with 5% CO.sub.2 at 37° C. The first passage after thawing Raw 264.7 cells was considered as passage 1. Cells were used up to passage 8.

    3. Osteoclastogenesis Assay

    [0221] Murine Raw 264.7 cells were scrapped off the plastic dish, plated at a density of 1.25×10.sup.4 cells/cm.sup.2 and grown in propagation medium enriched with 10 ng/ml soluble murine RANKL (Bio-Techne, ref 462-TEC-010). After 110 h, cells were fixed with formalin (10% in PBS buffer) for 10 min and rinsed in distilled water prior to tartrate resistant acid phosphatase (TRAcP) staining.

    [0222] TRAcP was histochemically revealed by a simultaneous coupling reaction using Naphtol AS-BI-phosphate (Sigma Aldrich) as substrate and Fast violet B (Sigma-Aldrich) as the diazonium salt for 90 min at 37° C. in the dark. Cultures were rinsed three times in distilled water and the residual activity was inhibited by 4% NaF (Sigma-Aldrich) for 30 min. Cells were then rinsed in distilled water and allowed to dry. TRAcP positive cells, with more than three nuclei, were identified as osteoclasts. The number of newly generated osteoclasts was assessed using light microscopic examination by a histologist that was blinded to the treatment intervention. Dataset acquired previously with (D-Ala.sup.2)GIP.sub.1-30 and (Gly.sup.2)GLP-2 were used in the present example for comparison and combination index computation.

    4. Evaluation of Data

    [0223] Osteoclast numbers obtained with double GIP/GLP-2 analogues were first reported as percentage of osteoclast numbers observed in the absence of peptides (RANKL alone). For each concentration of peptide, the mean, SD and number of events were computed. These data were then exported to GraphPad Prism (version 8.0) for further analysis. The GraphPad Prism analysis consisted in: (1) transformation of drug concentration in log(concentration), (2) curve fitting with 3 parameter Log(inhibitor) vs. response model (top constrain to 100) and (3) Estimation of IC50 for each drug.

    [0224] Furthermore, in order to investigate the synergism effect, the inventors converted the osteoclastogenesis data into the inhibitory effect by subtracting each osteoclastogenesis percentage to 100. These data were then exported to GraphPad Prism were the analysis consisted in (1) transformation of drug concentration in log(concentration), (2) curve fitting with 3 parameter Log(agonist) vs. response model (bottom constrain to 0) and (3) estimation of EC50 and E.sub.max for each drug. The effects of double GIP/GLP-2 analogues at EC50 encountered with GIP and GLP-2 (36.8 pM) was used from previous conducted experiments and combination indexes were computed according to Chou & Talalay (Chou & Talalay (1983) Trends Pharmacol Sci 4: 450-454) as follows:


    CI=(E.sub.GIP+E.sub.GLP2−(E.sub.GIP×E.sub.GLP2))/E.sub.DA

    where E.sub.GIP, E.sub.GLP2 and E.sub.DA represents the effects observed with GIP alone, GLP-2 alone or a dual agonist, respectively.

    Results

    1. Osteoclastogenesis

    [0225] All peptides reduced the amount of newly generated osteoclasts at the highest concentration. Curve fitting of osteoclast response is presented in FIG. 22 for all peptides. IC50 was deduced from curve fitting and presented in Table 11.

    TABLE-US-00018 TABLE 11 IC50 computed from curve fitting of osteoclastogenesis vs. peptide concentration. Peptide IC50 (D-Ala.sup.2)GIP.sub.1-30 41.4* (Gly.sup.2)GLP-2 32.2* Invention GL-0001 14.2 GL-0007 6.2 WO2018/069442 Co-3 ND Co-7 1475 Co-19 32.4 ND: Not determined as the maximum effects did not reach 50% inhibition. *determined from previous experiments.

    [0226] Interestingly, (D-Ala.sup.2)GIP.sub.1-30 and (Gly.sup.2)GLP-2 presented similar IC50. A two-tailed t-test confirmed this finding. As such, an intermediate IC50 of 36.8 pM was used to investigate the “synergism” properties of double GIP/GLP-2 analogues.

    2. Dose-Response Inhibitory Effect of Double GIP/GLP-2 Analogue on Osteoclastogenesis and Pharmacological Mechanism

    [0227] In order to evaluate the response of each double GIP/GLP-2 analogues, the inventors transformed the data as a percentage of inhibition of osteoclastogenesis. Data were then curve fitted and R.sup.2 value of each curve fitting is presented in table 12.

    TABLE-US-00019 TABLE 12 Estimation of the best fit models for dose-response curve Peptide R.sup.2 (D-Ala.sup.2)GIP.sub.1-30 0.835 (Gly.sup.2)GLP-2 0.541 Invention GL-0001 0.781 GL-0007 0.363 WO2018/069442 Co-3 0.173 Co-7 0.185 Co-19 0.552
    Dose-effect curves have been plotted for each double GIP/GLP-2 analogue and are presented FIG. 23. EC50 and maximum inhibitory effect (E.sub.max) have been computed for each double GIP/GLP-2 analogues and are represented in Table 13.

    TABLE-US-00020 TABLE 13 Determination of EC50 and E.sub.max for dose-effect curves. Compound EC.sub.50 (pM) E.sub.max (%) (D-Ala.sup.2)GIP.sub.1-30 41.4* 99.51* (Gly.sup.2)GLP-2 32.2* 68.12* Invention GL-0001 14.2 83.96 GL-0007 6.2 98.64 WO2018/069442 Co-3 ND 37.88 Co-7 1475 58.05 Co-19 32.4 62.36 Data represents mean ± SD of 5 individual experiments. *data obtained in previous experiments.

    [0228] It appeared interesting to determine whether the osteoclast response observed with double GIP/GLP-2 analogues is equal, higher or lower than the joint administration of both (D-Ala.sup.2)GIP.sub.1-30 and (Gly.sup.2)GLP-2. To answer this question, combination index, according to Chou & Talalay, have been computed and are reported in Table 14. Furthermore, Combination index at EC.sub.50 of (D-Ala.sup.2)GIP.sub.1-30 and (Gly.sup.2)GLP-2 have been plotted in FIG. 24.

    TABLE-US-00021 TABLE 14 Combination index at EC50 of GIP and GLP-2 and pharmacological interpretation Compound Cl at EC50 Interpretation GL-0001 1.10 Additive GL-0007 0.82 Moderate synergism Co-3 48.00 Very strong antagonism Co-7 271.28 Very strong antagonism Co-19 1.94 Antagonism
    CI>10: very strong antagonism; CI 3.3-10: strong antagonism; CI 1.45-3.3: antagonism; CI 1.15-1.45 moderate antagonism; CI 0.85-1.15: additive; CI 0.85-0.65: moderate synergism; CI 0.3-0.65: synergism; CI 0.1-0.3 strong synergism; CI<0.1: very strong synergism.

    [0229] Two-tailed t-test have been used to assess whether CI were significantly different as compared with additivity (1.0±0.15).

    CONCLUSIONS

    [0230] This study shows that peptides of the invention, in particular GL-0001 and GL-0007, presented an EC50 lower than peptides of the prior art. This suggest that lower doses of GL-0001 and GL-0007 can be used to achieve 50% inhibition in osteoclast formation. Furthermore, E.sub.max values for GL-0001 and GL-0007 indicated that both peptides achieved more than 85% inhibition of osteoclast formation, which is higher than (Gly.sup.2)GLP-2 alone. The pharmacological mechanisms behind GL-0001 and GL-0007 effects range from moderate synergism to additive. Interestingly, peptides disclosed in WO2018/069442, namely peptides Co-3, Co-7 and Co-19, presented equal or higher EC50, as compared with (D-Ala.sup.2)GIP.sub.1-30 or (Gly.sup.2)GLP-2 alone, suggesting that the same dose or even higher doses are required to inhibit 50% of osteoclast formation. Furthermore, the highest inhibitory effects encountered with these three peptides was at best ˜62.4%, which is lower than effects observed with (Gly.sup.2)GLP-2 or (D-Ala.sup.2)GIP.sub.1-30 alone. Furthermore, the pharmacological mode of action of these three peptides ranged from antagonism to very strong antagonism.