Compositions for adjustable ribosome translation speed and methods of use
11293028 · 2022-04-05
Assignee
Inventors
Cpc classification
C12N15/74
CHEMISTRY; METALLURGY
C12N15/70
CHEMISTRY; METALLURGY
C07K11/00
CHEMISTRY; METALLURGY
C12N15/67
CHEMISTRY; METALLURGY
International classification
C12N15/00
CHEMISTRY; METALLURGY
C12N15/74
CHEMISTRY; METALLURGY
Abstract
The present invention relates to the effects of codon context and synonymous codon changes on mRNA translation and methods of increasing protein production.
Claims
1. A recombinant nucleic acid molecule comprising a mutant triacontanucleotide sequence having at least ten codons, wherein at least one of the sixth, seventh, eighth, ninth and tenth codons, in the 5′ to 3′ direction, are synonymous codons, and wherein the mutant triacontanucleotide sequence is selected from SEQ ID NOs: 8-15.
2. The recombinant molecule of claim 1, wherein the mutant triacontanucleotide sequence is operably linked to a heterologous polynucleotide sequence that encodes a polypeptide of interest.
3. The recombinant molecule of claim 2, wherein the polypeptide of interest is insulin.
4. A vector comprising the recombinant molecule of claim 1.
5. An isolated host cell comprising the recombinant molecule of claim 1.
6. A vector comprising the recombinant molecule of claim 2.
7. An isolated host cell comprising the recombinant molecule of claim 2.
8. A method of modulating protein production within a host cell, comprising culturing a host cell under conditions sufficient for protein expression, wherein the recombinant molecule of claim 4 has been stably introduced into the host cell.
9. A method of increasing the translation speed of a polynucleotide sequence, comprising providing to a host cell a polynucleotide sequence that encodes a protein and is operably linked to a wild type triacontanucleotide sequence comprising ten codons and encoding SEQ ID NO:1, and mutating the triacontanucleotide sequence so that the mutant triacontanucleotide sequence is selected from SEQ ID NOs: 8-15, and culturing the host cell under conditions to express the polynucleotide sequence.
10. A method for increasing specific cellular productivity of a polypeptide of interest in a host cell comprising: (a) providing a polynucleotide sequence that encodes the polypeptide of interest and is operably linked to a wild type triacontanucleotide sequence comprising ten codons and encoding SEQ ID NO:1, (b) mutating the triacontanucleotide sequence so that the mutant triacontanucleotide sequence is selected from SEQ ID NOs: 8-15; (c) introducing the polynucleotide sequence into the host cell; (d) incubating the cell under conditions wherein the introduced polynucleotide is expressed; and (e) isolating the polypeptide of interest.
Description
BRIEF DESCRIPTION OF THE DRAWINGS/FIGURES
(1)
(2)
(3)
(4)
DETAILED DESCRIPTION OF THE INVENTION
Definitions
(5) To facilitate an understanding of the present invention, a number of terms and phrases are defined below. Art-recognized synonyms or alternatives of the following terms and phrases, even if not specifically described, are contemplated.
(6) As used in the present disclosure and claims, the singular forms “a,” “an,” and “the” include plural forms unless the context clearly dictates otherwise; i.e., “a” means “one or more” unless indicated otherwise.
(7) The terms “about” or “approximately” mean roughly, around, or in the regions of. The terms “about” or “approximately” further mean within an acceptable contextual error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e. the limitations of the measurement system or the degree of precision required for a particular purpose, e.g. the amount of a nutrient within a feeding formulation. When the terms “about” or “approximately” are used in conjunction with a numerical range, it modifies that range by extending the boundaries above and below the numerical values set forth. For example “between about 5.5 to 6.5 g/l” means the boundaries of the numerical range extend below 5.5 and above 6.5 so that the particular value in question achieves the same functional result as within the range. For example, “about” and “approximately” can mean within one or more than one standard deviation as per the practice in the art. Alternatively, “about” and “approximately” can mean a range of up to 20%, preferably up to 10%, more preferably up to 5%, and more preferably up to 1% of a given value.
(8) The term “and/or” as used in a phrase such as “A and/or B” is intended to include “A and B,” “A or B,” “A,” and “B.” Likewise, the term “and/or” as used in a phrase such as “A, B, and/or C” is intended to encompass each of the following embodiments: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone); B (alone); and C (alone).
(9) Unless specified otherwise, all of the designations “A %-B %,” “A-B %,” “A % to B %,” “A to B %,” “A %-B,” “A % to B” are given their ordinary and customary meaning. In some embodiments, these designations are synonyms.
(10) The terms “substantially” or “substantial” mean that the condition described or claimed functions in all important aspects as the standard described. Thus, “substantially free” is meant to encompass conditions that function in all important aspects as free conditions, even if the numerical values indicate the presence of some impurities or substances. “Substantial” generally means a value greater than 90%, preferably greater than 95%, most preferably greater than 99%. Where particular values are used in the specification and in the claims, unless otherwise stated, the term “substantially” means with an acceptable error range for the particular value.
(11) “Optional” or “optionally” means that the subsequently described event, circumstance, or material may or may not occur or be present, and that the description includes instances where the event, circumstance, or material occurs or is present and instances where it does not occur or is not present.
(12) The terms “transformation” and “transfection” mean the introduction of a nucleic acid molecule (e.g., an expression vector) into a recipient cell. Transformation or transfection techniques are well known by the art. It may be specified that a nucleic acid sequence (e.g., a coding sequence carried by an expression vector) is introduced (integrated) into the genomic (chromosomal DNA) of said recipient (host) cell.
(13) “FlgM” and “flgM” refers to the protein and polynucleotide sequence, respectively, that negatively regulates flagellin synthesis in Type III Secretion Systems (Gillen and Hughes, Molecular Characterization of flgM, a Gene Encoding a Negative Regulator of Flagellin Synthesis in Salmonella typhimurium, J. Bacteriology 173(20): 6453-6459 (1991)).
(14) The term “recombinant” or “mutant” means that the referenced product has been altered with respect to its naturally occurring counterpart.
(15) The term “triacontanucleotide sequence” means a nucleotide sequence that is at least thirty nucleotides long. For example, a triacontanucleotide sequence of the present invention may consist of thirty nucleotides or may be a part of a larger sequence, encoding for example, a full-length FlgM protein.
(16) The term “codon” refers to the three consecutive nucleotides that together encode one amino acid.
(17) The term “decacodon” means a nucleotide sequence comprising at least five codons (i.e., at least fifteen nucleotides). For example, a decacodon sequence of the present invention may consist of 10 codons or may comprise about 97 codons and encode a full-length FlgM peptide.
(18) The term “synonymous codon” means a codon that is altered as compared to wild-type but that encodes the same amino acid as does the wild-type codon.
(19) The terms “nucleic acid,” “polynucleotide,” and “nucleotide” are used synonymously herein. The term “polynucleotide,” when used in singular or plural, generally refers to any a polyribonucleotide or polydeoxyribonucleotide, which can be unmodified RNA or DNA or modified RNA or DNA. Thus, for instance, polynucleotides as defined herein include, without limitation, single- and double-stranded DNA, DNA including single- and double-stranded regions, single- and double-stranded RNA, and RNA including single- and double-stranded regions, hybrid molecules comprising DNA and RNA that may be single-stranded or, more typically, double-stranded or include single- and double-stranded regions. Thus, DNAs or RNAs with backbones modified for stability or for other reasons are “polynucleotides” as that term is intended herein. Moreover, DNAs or RNAs comprising unusual bases, such as inosine, or modified bases, such as tritiated bases, are included within the term “polynucleotides” as defined herein. In general, the term “polynucleotide” embraces all chemically, enzymatically and/or metabolically modified forms of unmodified polynucleotides. Polynucleotides can be made by a variety of methods, including in vitro recombinant DNA-mediated techniques and by expression of DNAs in cells and organisms
(20) The terms “protein,” “polypeptide,” and “peptide” are used synonymously herein. As used herein, the term “polypeptide” is intended to encompass a singular “polypeptide” as well as plural “polypeptides,” and refers to a molecule composed of monomers (amino acids) linearly linked by amide bonds (also known as peptide bonds). The term “polypeptide” refers to any chain or chains of two or more amino acids, and does not refer to a specific length of the product. Thus, peptides, dipeptides, tripeptides, oligopeptides, “protein,” “amino acid chain,” or any other term used to refer to a chain or chains of two or more amino acids, are included within the definition of “polypeptide,” and the term “polypeptide” can be used instead of, or interchangeably with any of these terms. The term “polypeptide” is also intended to refer to the products of post-expression modifications of the polypeptide, including without limitation glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, or modification by non-naturally occurring amino acids. A polypeptide can be derived from a natural biological source or produced by recombinant technology, but is not necessarily translated from a designated nucleic acid sequence. It can be generated in any manner, including by chemical synthesis. Certain embodiments of the present invention comprise a fusion peptide comprising at least a FlgM peptide and a polypeptide wherein the polypeptide and FlgM peptide do not naturally associate with each other (i.e., the polypeptide is heterologous to the FlgM peptide). Such a polypeptide may be referred to as a “heterologous polypeptide,” a “target polypeptide,” a “desired polypeptide” or a “polypeptides of interest.”
(21) An “isolated” biological component (such as a nucleic acid molecule or protein) has been substantially separated or purified away from other biological components in the cell of the organism in which the component naturally occurs, i.e., other chromosomal and extra-chromosomal DNA and RNA, proteins and organelles. Nucleic acids and proteins that have been “isolated” include nucleic acids and proteins purified by standard purification methods. The term also embraces nucleic acids and proteins prepared by recombinant expression in a host cell as well as chemically synthesized nucleic acids.
(22) The term “heterologous,” “foreign” or “non-native” refers to two structures, for example, that are not naturally associated with each other. For example, wherein a nucleotide sequence is operably linked to a heterologous promoter, the nucleotide sequence is not naturally associated with the promoter even though the nucleotide sequence and the promoter sequence may originate from the same organism.
(23) The terms “ribonucleic acid” and “RNA” are used herein synonymously.
(24) The terms “deoxyribonucleic acid” and “DNA” are used herein synonymously.
(25) A “vector” as used herein may be a cloning vector, an expression vector, a plasmid including a BAC or a YAC vector, or other nucleic acid molecule capable of transporting a polynucleotide sequence into a cell. A vector may be designed for storage of the polynucleotide sequence, cloning, and/or designed for expression of the polynucleotide sequence. “Plasmid” and “vector” may be used interchangeably, as a plasmid is a commonly used form of a vector. The term “expression vector” includes any vector, (e.g., a plasmid, cosmid or phage chromosome) containing a gene construct in a form suitable for expression by a cell (e.g., linked to a transcriptional control element). “Construct” or “gene construct” as used herein does not include an entire chromosomal and/or mitochondrial genome. Expression vectors suitable for use within a specified host cell are known and readily identified using routine experimentation and known techniques (see, e.g., U.S. Pat. Nos. 7,785,830; 8,663,980; 8,628,954, incorporated herein by reference in their entireties).
(26) A “host cell” as used herein refers to a cell into which a molecule is or has been introduced. Generally, a host cell herein refers to a cell into which a foreign (heterologous, non-native) molecule is or has been introduced. In certain embodiments, the host cell herein is a bacterial cell. In certain embodiments, the host cell is a gram-negative bacterial cell. In certain embodiments, the host cell is a bacterial cell comprising a secretion system such as a Type III Secretion (T3S) System (T3SS). In certain embodiments, a host cell herein is selected from the group consisting of a Salmonella, Shigella, Chlamydia, Yersinia, Pseudomonas, and Escherichia cell. In certain embodiments, a host cell herein is selected from the group consisting of a Salmonella enterica serovar Typhimurium, Shigella flexneri, Chlamydia trachomatis, Yersinia pseudotuberculosis, Pseudomonas aeruginosa, and Escherichia coli cell.
(27) A “purification tag” as used herein refers to a ligand that aids protein purification with, for example, size exclusion chromatography, ion exchange chromatography, and/or affinity chromatography. Purification tags and their use are well known to the art (see, e.g., Thermo Scientific Protein Purification Handbook 2010) and may be, for example, poly-histidine, glutathione S-transferase (GST), Myc, HA, FLAG, or maltose binding protein (MBP). A step of purifying, collecting, obtaining, or isolating a protein may therefore include size exclusion chromatography, ion exchange chromatography, or affinity chromatography. In certain embodiments, a step of purifying a FlgM peptide, or a fusion (chimeric) protein comprising FlgM, utilizes affinity chromatography and, for example, a σ.sup.28 affinity column or an affinity column comprising an antibody that binds FlgM or another member of the fusion protein. In one embodiment, a step of purifying a fusion protein comprising at least a FlgM peptide and a purification tag utilizes affinity chromatography and, for example, an affinity column that binds the purification tag.
(28) “Cleavage site” as used herein refers to a sequence that is recognized and/or cut by a chemical or protein (a restriction enzyme or protease, for example). Cleavage sites are well known by the art (see, e.g., US PG PUB NO. 2015/0037868, incorporated herein by reference in its entirety). Because cleavage sites may be polynucleotide sequences (e.g., restriction enzyme sites) or amino acid sequences (e.g., peptidase sites), a person with ordinary skill in the art will recognize, based on the context within which it is recited, whether “cleavage site” refers to a polynucleotide sequence or an amino acid sequence. Exemplary cleavage sites include those recognized by a protease selected from the group consisting of an alanine carboxypeptidase, Armillaria mellea astacin, bacterial leucyl aminopeptidase, cancer procoagulant, cathepsin B, clostripain, cytosol alanyl aminopeptidase, elastase, endoproteinase Arg-C, enterokinase, gastricsin, gelatinase, Gly-X carboxypeptidase, glycyl endopeptidase, human rhinovirus 3C protease, hypodermin C, Iga-specific serine endopeptidase, leucyl aminopeptidase, leucyl endopeptidase, lysC, lysosomal pro-X carboxypeptidase, lysyl aminopeptidase, methionyl aminopeptidase, myxobacter, nardilysin, pancreatic endopeptidase E, picornain 2A, picornain 3C, proendopeptidase, prolyl aminopeptidase, proprotein convertase I, proprotein convertase II, russellysin, saccharopepsin, semenogelase, T-plasminogen activator, thrombin, tissue kallikrein, tobacco etch virus (TEV), togavirin, tryptophanyl aminopeptidase, U-plasminogen activator, V8, venombin A, venombin AB, and Xaa-pro aminopeptidase. See US PG PUB NO. 2015/0037868, incorporated herein by reference in its entirety. In some embodiments, the cleavage site is a protease cleave site. In some embodiments, the cleavage site is a Tobacco Etch Virus (TEV) protease or Enterokinase (ETK) cleavage site. The components of a fusion (chimeric) peptide may be separated (released) via cutting at a cleavage site before, during, or after a step of fusion peptide purification. For example, wherein a fusion peptide comprises a FlgM protein fused to a heterologous polypeptide and a cleavage site, and the fusion peptide has been secreted into culture media, the FlgM protein and the polypeptide may be separated by the application of a protease to the culture media before a step of purification from culture media or the fusion peptide may be purified from the culture media and then a protease may be applied to the fusion peptide to release the FlgM protein from the polypeptide. In certain embodiments, a step of fusion peptide decomposition (cleavage) is concurrent with a step of purification. For example, a fusion peptide may be passed over an affinity column, the heterologous polypeptide or the purification tag may bind the affinity column and, while bound, a cutting agent may be applied such that the cleavage site is cut and the fusion peptide decomposes.
(29) As is conventional, the designation “NH.sub.2” or “N—” refers to the N-terminus of an amino acid sequence and the designation “COOH” or “C—” refers to the C-terminus of an amino acid sequence.
(30) The term “naturally-occurring”, “native” or “wild-type” as used herein as applied to an object refers to the fact that an object can be found in nature. For example, a polypeptide or polynucleotide sequence that is present in an organism (including viruses) that can be isolated from a source in nature and which has not been intentionally modified by man in the laboratory or otherwise is wild-type.
(31) A “mutation” as used herein refers to a variation in a nucleotide or amino acid sequence as compared to the wild type sequence. A mutation or “alteration” herein is usually a manufactured nucleic acid change within a coding polynucleotide sequence that results in an alternate but synonymous codon (i.e., the encoded amino acid residue does not change as a result of the mutation). The production and identification of such mutant, synonymous codon optimized, sequences are as further described herein.
(32) The term “control sequence” as used herein refers to polynucleotide sequences which are necessary to effect the expression and processing of coding sequences to which they are ligated. The term “control sequences” is intended to include, at a minimum, all components whose presence is essential for expression and processing, and can also include additional components whose presence is advantageous, for example, leader sequences and fusion partner sequences. A control sequence may be a “Transcription Control Element (TCE)”, the nature of which differs depending upon the host organism. A person with ordinary skill in the art will recognize that in prokaryotes, such TCEs generally include promoter, ribosomal binding site, and transcription termination sequences while in eukaryotes, generally, such TCEs include promoters and transcription termination sequences. Control sequences may be regulatable (inducible, for example) or constitutive.
(33) According to the invention any promoter may be used. Promoter usually refers to the nucleotide sequence upstream (5′) to the coding sequence and controls the expression of the coding sequence by providing the recognition of the RNA polymerase and other factors which are necessary for the correct transcription. The promoter used according to the invention may comprise a minimal promoter which specify the transcription start site to which regulator elements are attached for expression control.
(34) The term “operably linked” or “operatively linked” as used herein refers to the positioning of components such that they are in a relationship permitting them to function in their intended manner. A person with ordinary skill in the art will recognize that under certain circumstances and depending on the nature of the components (e.g., a cleavage site or purification tag), two or more components “operably linked” together are not necessarily contiguously linked or contiguously associated. A control sequence “operably linked” to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under conditions compatible with the control sequences. If two polynucleotide sequences are said to be operably linked to a control sequence such as a transcription control element (TCE) (or more than one transcription control element), a person with ordinary skill in the art will recognize that a variety of configurations are functional and encompassed. For example, a person with ordinary skill in the art will recognize that at least all the following configurations are encompassed: NH2-the transcription control element-the first polynucleotide sequence-the second polynucleotide sequence-COOH; NH2-the transcription control element-the second polynucleotide sequence-the first polynucleotide sequence-COOH; NH2-the first transcription control element-the first polynucleotide sequence-the second transcription control element-the second polynucleotide sequence-COOH; NH2-the second transcription control element-the second polynucleotide sequence-the first transcription control element-the first polynucleotide sequence-COOH; NH2-the first transcription control element-the second polynucleotide sequence-the second transcription control element-the first polynucleotide sequence-COOH; NH2-the second transcription control element-the first polynucleotide sequence-the first transcription control element-the second polynucleotide sequence-COOH; and combinations thereof. Further, for example, if a mutant triacontanucleotide sequence is said to be operatively linked to a polynucleotide sequence encoding a polypeptide, a nucleic acid sequence encoding a purification tag, and a cleavage site, a person with ordinary skill in the art will recognize that a variety of configurations are functional and encompassed. For example, such a person will recognize that at least the following configurations are encompassed (from the 5′ to the 3′ end): 5′-(the mutant triacontanucleotide sequence)-(the cleavage site)-(the polynucleotide sequence encoding a polypeptide)-3′; 5′-(the nucleic acid sequence encoding a purification tag)-(the mutant triacontanucleotide sequence)-(the cleavage site)-(the polynucleotide sequence encoding a polypeptide)-3; 5′-(the mutant triacontanucleotide sequence)-(the cleavage site)-(the polynucleotide sequence encoding a polypeptide)-(the nucleic acid sequence encoding a purification tag)-3′; and combinations thereof.
(35) The similarity between two nucleic acid sequences, or two amino acid sequences, is referred to as “sequence identity.” Sequence identity is frequently measured in terms of percentage identity (or similarity); the higher the percentage, the more similar the two sequences are. Homologs or orthologs of human polypeptides, and the corresponding cDNA or gene sequence(s), will possess a relatively high degree of sequence identity when aligned using standard methods. This sequence identity will be more significant when the orthologous proteins or genes or cDNAs are derived from species that are more closely related (e.g., human and chimpanzee sequences), compared to species more distantly related (e.g., human and C. elegans sequences).
(36) Methods of alignment of sequences for comparison are well known in the art. Various programs and alignment algorithms are described in: Smith & Waterman Adv. Appl. Math. 2: 482, 1981; Needleman & Wunsch J. Mol. Biol. 48: 443, 1970; Pearson & Lipman Proc. Natl. Acad. Sci. USA 85: 2444, 1988; Higgins & Sharp Gene, 73: 237-244, 1988; Higgins & Sharp CABIOS 5: 151-153, 1989; Corpet et al. Nuc. Acids Res. 16, 10881-90, 1988; Huang et al. Computer Appls. in the Biosciences 8:155-65, 1992; and Pearson et al. Meth. Mol. Bio. 24:307-31, 1994. Altschul et al. J. Mol. Biol. 215:403-410, 1990, presents a detailed consideration of sequence alignment methods and homology calculations.
(37) The NCBI Basic Local Alignment Search Tool (BLAST) (Altschul et al. J. Mol. Biol. 215:403-410, 1990) is available from several sources, including the National Center for Biotechnology Information (NCBI, Bethesda, Md.) and on the Internet, for use in connection with the sequence analysis programs blastp, blastn, blastx, tblastn and tblastx. By way of example, for comparisons of amino acid sequences of greater than about 30 amino acids, the Blast 2 sequences function is employed using the default BLOSUM62 matrix set to default parameters, (gap existence cost of 11, and a per residue gap cost of 1). When aligning short peptides (fewer than around 30 amino acids), the alignment is performed using the Blast 2 sequences function, employing the PAM30 matrix set to default parameters (open gap 9, extension gap 1 penalties).
(38) An alternative indication that two nucleic acid molecules are closely related is that the two molecules hybridize to each other under stringent conditions. Stringent conditions are sequence-dependent and are different under different environmental parameters. Generally, stringent conditions are selected to be about 5° C. to 20° C. lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH. The Tm is the temperature (under defined ionic strength and pH) at which 50% of the target sequence remains hybridized to a perfectly matched probe or complementary strand. Conditions for nucleic acid hybridization and calculation of stringencies can be found in Sambrook et al. (In Molecular Cloning: A Laboratory Manual, CSHL, New York, 1989) and Tijssen (Laboratory Techniques in Biochemistry and Molecular Biology—Hybridization with Nucleic Acid Probes Part I, Chapter 2, Elsevier, New York, 1993).
(39) Nucleic acid sequences that do not show a high degree of sequence identity may nevertheless encode similar amino acid sequences, due to the degeneracy of the genetic code. It is understood that changes in nucleic acid sequence can be made using this degeneracy to produce multiple nucleic acid molecules that all encode substantially the same protein.
(40) The phrase “synonymous codon and codon context effects on translation” may b e referred to using the acronym CEOT (codon effects on translation).
(41) The phrase “synonymous codon mutant” (SCM) herein refers to a coding sequence that has been mutagenized so as to comprise one or more synonymous codons as compared to the wild type coding sequence. The phrase “SCM flgM” refers to a flgM coding sequence that has been mutagenized and comprises one or more synonymous codons as a result of that mutagenesis (i.e., “SCM flgM” refers to a mutant flgM coding sequence). As used herein, “synonymous codon mutagenesis/alteration” (SCA) refers to the step of mutating (i.e., altering) a coding sequence such that the resulting mutant/altered sequence comprises one or more synonymous codons as compared to a corresponding control sequence.
(42) Methods of Assaying Translation Speed
(43) The present invention relates to an assay for determining translation speed that takes advantage of the characterization of the regulatory mechanism called transcriptional attenuation in the histidine biosynthetic (his) operon of Salmonella (see Chevance et al., PLOS Genetics 10(6):1-14 (2014)). The transcription of the his structural genes is dependent on levels of charged histidyl-tRNA in the cell and independent of mRNA or leader peptide stability. The 5′-region of the his operon has a 16 amino acid open reading frame with seven consecutive His codons. When charged His-tRNA levels are high, attenuation occurs and RNA polymerase ceases transcription of the his operon. If charged His-tRNA is low the ribosome stalls within the stretch of seven His codons and the attenuation mechanism is thwarted so that RNA polymerase continues into the his structural genes in response to limiting His-tRNA. A system was developed to measure the rate of translation through individual codons, pairs of codons, triplets, etc., and measure in vivo how fast the ribosome can translate through different codons for the same amino acid (so-called silent codons or synonymous codons). In this way, an assay was developed for translation speed and determining how one or more synonymous codons effect translation speed.
(44) An exemplary system was produced by replacing the his structural genes with the lac operon as a reporter for His attenuation. With the his attenuation system controlling lac operon transcription, this system may take advantage of color indicator media to provide simple, qualitative color-readouts of attenuation. Based on colony-color phenotypes, the levels of his-lac constructs that are either attenuated or non-attenuated are determined. Using the lac operon reporter system, the His5 position of the leader peptide is substituted with all 63 codons and the effect of individual codons on the degree of ribosomal stalling in the leader peptide region was measured (Id.). Levels of de-attenuation that resulted from the stalling of the ribosome due to the codon change at His5 was measured. Stop cod on s (UAA, UAG and UGA) exhibited the highest levels of de-attenuation while the arginine codons AGA and AGG showed high levels of de-attenuation (Id.). Comparing third positions NNU versus NNC that are read by a single tRNA species, translation of NNU showed a higher level of de-attenuation compared to NNC (Id.). This is consistent with in vitro studies showing that NNG is translated faster than the cognate NNU by a single tRNA species.
(45) The use of this translation speedometer assay for measuring the effects of codon context on translation speed was further demonstrated by measuring the effects of each codon in both 5′ and 3′ context with the UCA codon. The UCA codon is particularly useful because it is translates by only one essential tRNA species, the SerT tRNA. his-lac expression on Mac-Lac indicator media for all UCA-NNN and NNN-UCA codon pairs placed at His4-His5 in the his operon leader peptide was determined. 22 of the 64 codons exhibited codon context effects. In other words, translation speeds were different for the UCA-NNN and NNN-UCA codon pair for 22 of the 64 codons. The most dramatic context effects were obtained with tyrosine codons. The UCA-UAU and UCA-UAC constructs exhibited levels of de-attenuation comparable to those that were produced by stop codons. However, in the reverse orientation, UAU-UCA and UAC-UCA, de-attenuation is low. The UCA-UAU and UCA-UAC codon pairs are translated at a slow rate whereas the reverse orientations UAU-UCA and UAC-UCA are translated at fast rates. The codon context effect with the CGU codon is also dramatic. Both UCA-CGU and CGU-UCA exhibits a fast translation rate, yet CAU(His)-CGU at the His4-His-5 positions is translated at a very slow rate.
(46) Methods of Modulating Translation Speed
(47) Bacteria comprise a variety of secretion systems with varying structures and functions. Gram-negative bacteria, for example, comprise at least six different secretion systems (Types I-VI) spanning one or both of the outer and inner membranes and playing roles in environmental response, adhesion, or pathogenicity processes (see, e.g., Costa et al., Secretion systems in Gram-negative bacteria: structural and mechanistic insights, Nature Reviews, Microbiology 13:343-359 (2015)). For flagella assembly, for example, bacteria may utilize a secretion system (T3SS, e.g.,) by which proteins that are required for flagellum structure and assembly are exported from the cytoplasm, pass the outer membrane, and through the growing flagellar structure.
(48) The Salmonella enterica flagellum contains a complex motor structure, known as the hook-basal body (HBB) complex, that is embedded in the cell wall and membranes. The HBB is connected to a long, external filament that extends about 10 microns from the cell surface. The external filament, comprising up to 10,000 FliC subunits, extends from the HBB. Each filament represents about 1% of the total cell protein. The proton motive force powers the rotation of the motor-filament to propel the bacterium through liquid environments and across surfaces. The HBB also contains a type III secretion system that directs the secretion of substrates through a central channel of the structure. Subunits travel to the tip of the growing organelle where they self-assemble into place.
(49) There are over 60 genes in the flagellar regulon, which includes the genes of the chemosensory system. The transcription of these genes is coupled to flagellum assembly as shown in
(50) During HBB assembly, the flagellar type III secretion (T3S) system is specific for rod-hook secretion substrates. Upon HBB completion, the FlhB component of the T3S apparatus undergoes a conformational change and the secretion specificity switches to Late or Filament-type secretion. Prior to HBB completion, FlgM inhibits σ.sup.28-dependent transcription from flagellar Class 3 promoters. FlgM is a late secretion substrate and upon HBB completion and the secretion specificity switch, FlgM is secreted from the cell, releasing σ28 to transcribe from Class 3 promoters.
(51) The FlgM protein comprises a secretion signal at its N-terminus that is not cleaved during the secretion process. Substrate secretion through the T3SS is often facilitated by chaperone-assisted delivery of substrates to the secretion apparatus. In this way, FlgM secretion is greatly enhanced by the binding of the secretion chaperone σ.sup.28 to the C-terminal half of FlgM.
(52) Because FlgM is a small T3S substrate and not part of the final flagellar structure, it can be used as a vehicle to direct secretion of foreign proteins into the periplasm or into the extracellular milieu. The inventors have shown that FlgM polynucleotide sequences operably linked to a heterologous coding sequence may be expressed in various organisms and secreted by the flagellar T3S system (see U.S. PG PUB NO. 2015/0225466, incorporated herein by reference in its entirety). Specifically, a chimeric protein comprising a FlgM peptide fused to a heterologous protein is expressed and secreted through the flagellar T3SS structures and into culture media (see U.S. PG PUB NO. 2015/0225466, incorporated herein by reference in its entirety). The inventors have further shown that expression of a FlgM fusion peptide may be controlled using inducible and/or overexpression control sequences, it may be manipulated by the salt concentration (e.g., NaCl and KCl) within media, and the fusion peptide or its components may be isolated from media using a variety of means (Id.).
(53) The examples herein further demonstrate the use of a T3SS for the modulated production and secretion of chimeric proteins into culture media. In one embodiment, the polypeptide is insulin.
(54) As used herein, the term “insulin” means the active principle of the pancreas that affects the metabolism of carbohydrates in the animal body and which is of value in the treatment of diabetes mellitus. The term includes synthetic and biotechnologically derived products that are the same as, or similar to, naturally occurring insulins in structure, use, and intended effect and are of value in the treatment of diabetes mellitus.
(55) The term “insulin” or “insulin molecule” is a generic term that designates the 51 amino acid heterodimer comprising the A-chain peptide having the amino acid sequence shown in SEQ ID NO: 1 and the B-chain peptide having the amino acid sequence shown in SEQ ID NO: 2, wherein the cysteine residues a positions 6 and 11 of the A chain are linked in a disulfide bond, the cysteine residues at position 7 of the A chain and position 7 of the B chain are linked in a disulfide bond, and the cysteine residues at position 20 of the A chain and 19 of the B chain are linked in a disulfide bond. The term “insulin” also includes precursors of insulin molecules.
(56) The term “insulin analog” as used herein includes any heterodimer analog that comprises one or more modification(s) of the native A-chain peptide and/or B-chain peptide. Modifications include but are not limited to substituting an amino acid for the native amino acid at a position selected from A4, A5, A8, A9, A10, A12, A13, A14, A15, A16, A17, A18, A19, A21, B1, B2, B3, B4, B5, B9, B10, B13, B14, B15, B16, B17, B18, B20, B21, B22, B23, B26, B27, B28, B29, and B30; and/or deleting any or all of positions B1-4 and B26-30. Insulin analogs include molecules having one to 10 amino acids at the N or C terminus of the A-chain peptide and/or B-chain peptide. Insulin analogs further include molecules amidated at the C-terminus of the A-chain peptide and/or B-chain peptide. Examples of insulin analogs include but are not limited to the heterodimer analogs disclosed in published international application WO20100080606, WO2009/099763, and WO2010080609, the disclosures of which are incorporated herein by reference. Insulin glargine (Gly(A21), Arg(B31), Arg(B32)-human insulin), insulin lispro (Lys(B28), Pro(B29)-human insulin, insulin glusiline (Lys(B3), Glu(B29)-human insulin), and insulin detemir (Lys-myristic acid(B29)-human insulin) are examples of commercially available insulin analogs.
(57) The term “insulin analogs” further includes heterodimer polypeptide molecules that have little or no detectable activity at the insulin receptor but which have been modified to include one or more amino acid modifications or substitutions to have an activity at the insulin receptor that has at least 1%, 10%, 50%, 75%, or 90% of the activity at the insulin receptor as compared to native insulin. In particular aspects, the insulin analog is a partial agonist that has from 2× to 100× less activity at the insulin receptor as does native insulin. In other aspects, the insulin analog has enhanced activity at the insulin receptor.
(58) Further described herein are expression systems utilizing synonymous codon mutants within a flagellar secretion system gene and methods of modulating heterologous polynucleotide translation when operably appended to such mutants. The synonymous codon mutagenesis of the present invention differs from traditional, codon optimization that relies on the codon usage (bias) of the host cell (organism). Codon usage bias relies on the relative amount that a particular codon is used by a particular organism. The art has long recognized that, between organisms, one synonymous codon for an amino acid is more prevalent (used with higher frequency) as compared to other synonymous codons for that same amino acid (i.e., an organism “prefers” or has a “bias” toward the use of a particular synonymous codon). Divergent organisms may prefer different synonymous codons and therefore have a different codon usage bias.
(59) A table of codon usage frequency in Escherichia coli and Salmonella enterica is shown below. Therein, a higher usage frequency value corresponds to a greater bias (preference) toward that synonymous codon (available at WorldWideWeb.sci.sdsu.edu/˜smaloy/MicrobialGenetics/topics/rev-sup/wobble.html, last visited Nov. 15, 2015). See also The Codon Bias Database (WorldWideWeb.homepages.luc.edu/˜cputonti/cbdb/genera/shigella.html) and Hilterbrand, et al. (CBDB: The codon bias database, BMC Bioinformatics 13(62):1-7 (2012)).
(60) TABLE-US-00002 Codon preference in E. coli and S. typhimurium genes..sup.1 U C A G U UUU Phe 19 UCU Ser 9 UAU Tyr 15 UGU Cys 4 U UUC Phe 17 UCC Ser 10 UAC Tyr 12 UGC Cys 6 C UUA Leu 11 UCA Ser 6 UAA STOP 2 UGA STOP 0.8 A UUG Leu 12 UCG Ser 8 UAG STOP 0.2 UGG Trp 12 G C CUU Leu 10 CCU Pro 7 CAU His 11 CGU Arg 23 U CUC Leu 10 CCC Pro 5 CAC His 10 CGC Arg 23 C CUA Leu 4 CCA Pro 7 CAA Gln 13 CGA Arg 3 A CUG Leu 55 CCG Pro 15 CAG Gln 31 CGG Arg 5 G A AUU Ile 27 ACU Thr 9 AAU Asn 17 AGU Ser 7 U AUC Ile 27 ACC Thr 25 AAC Asn 24 AGC Ser 16 C AUA Ile 4 ACA Thr 6 AAA Lys 36 AGA Arg 2 A AUG Met 2 ACG Thr 15 AAG Lys 12 AGG Arg 1 G G GUU Val 17 GCU Ala 16 GAU Asp 33 GGU Gly 24 U GUC Val 16 GCC Ala 25 GAC Asp 22 GGC Gly 33 C GUA Val 12 GCA Ala 16 GAA Glu 43 GGA Gly 6 A GUG Val 26 GCG Ala 27 GAG Glu 20 GGG Gly 10 G .sup.1The numbers represent the average frequency of codon usage per 1000 codons based upon the DNA sequence of about 450,000 genes in E. coli and S. typhimurium. Some additional codon frequencies can be found in Miller (1992).
(61) Generally, the presence of a host cell's preferred synonymous codons for, for example, the expression of a heterologous polynucleotide sequence within that host cell results in increased translation efficiency. Traditional codon optimization techniques utilize codon usage bias by mutagenizing a coding sequence such that the host cell's preferred codons are present to increase translation efficiency or absent to decrease translation efficiency.
(62) Synonymous codon mutations in the fliA,fliC and flgM genes of the Salmonella Type III Secretion System have been isolated that either increase or decrease gene expression. For fliA, a synonymous codon 13 (Asp) change from GAU to GAC resulted in a 2-fold increase in σ.sup.28 protein produced (Barker, C. S., et al., Assembling Flagella in Salmonella Mutant Strains Producing a Type III Export Apparatus without FliO, J. Bacteriol. 196(23):4001-4011 (2014)). Similarly, for the fliC gene of the Salmonella T3SS, a synonymous codon 13 (Leu) change from UUG to CUG produced ˜2- fold more FliC protein, whereas synonymous codon changes at codon 14 (Thr) from ACC to either ACA or ACG produced ˜2-fold and ˜1.5- fold more FliC protein, respectively (Rosu, V., et al., Translation Inhibition of the Salmonella fliC Gene by the FliC 5′ Untranslated Region, fliC Coding Sequences, and FlgM, J. Bacteriol. 188(12):4497-4507 (2006)).
(63) Based on codon usage bias as depicted within the table above, for example, the preference of Salmonella for the Asp GAU codon (33) over GAC (22) renders the at least about 2-fold increase in protein production using the GAC codon surprising (Barker et al., supra). Likewise, the preference for the Thr ACC codon (25) over the ACA (6) and ACG (15) codons renders the at least about 2-fold and 1.5-fold increase in protein production using the ACA and ACG codons, respectively, surprising (Rosu et al., supra).
EXAMPLES
(64) Bacterial Strains and Media
(65) The commonly used non-pathogenic strain of Salmonella enterica serovar Typhimurium LT2 was used for all experiments. LT2 harbors mutations in the ropS and mviA genes that render it avirulent (Yams, Rates of aminoacyl-tRNA selection at 29 sense codons in vivo, J. Mol. Biol. 209: 65-77 (1989); Hughes & Roth, Transitory cis complementation: a method for providing transposition functions to defective transposons, Genetics 119: 9-12 (1988); Johnston & Roth, Genetic analysis of the histidine operon control region of Salmonella typhimurium, J. Mol. Biol. 145: 713-734 (1981)). The mviA gene encodes for the regulator of a two-component system involved in Salmonella virulence. The rpoS gene product (stationary-phase sigma transcription factor) is required for the expression of multiple virulence factors. The two mutations within the virulence pathway of Salmonella result in attenuation of virulence.
(66) Cells were cultured in Luria-Bertani (LB) medium and, when necessary, supplemented with ampicillin (100 μg/milliliter) or tetracycline (15 μg/milliliter). The generalized transducing phage of S. Typhimurium P22 HT105/1 int-201 was used in all transductional crosses (Johnston & Roth, DNA sequence changes of mutations altering attenuation control of the histidine operon of Salmonella typhimurium, J. Mol. Biol. 145: 735-756 (1981)).
(67) Strain Construction
(68) Targeted chromosomal mutagenesis was carried out via the tetRA insertion and replacement with the L-Red recombinase system as described in Datsenko and Wanner (One-step inactivation of chromosomal genes in Escherichia coli K-12 using PCR products, PNAS 97: 6640-6645 (2000)).
(69) All Primers were synthesized by Integrated DNA Technologies (Coralville, Iowa). All PCR reactions were performed using a proof reading polymerase (Accuprime Pfx, Invitrogen or Phusion, Fermenta). Recombinant products mediated by L-Red were PCR-checked using Taq DNA polymerase and further sequenced.
(70) Screen for Translation-Slowest Codon Pairs
(71) Strains containing slow pair or fast pairs were constructed using by L-Red recombination as described above. After electroporation and plating on anhydrotetracyline plates, the plates were replica printed onto MacConkey-lactose and tetrazolium-lactose indicator plates. White colonies on tetrazolium plates (Lac+) were isolated and sent for DNA sequence analysis. The T-N-N codons were specifically avoided to prevent isolation of stop codons. Tz-Lac screening was used to identify translation-slow and translation-fast codon pairs in the His Leader system.
(72) b-Galactosidase Assays
(73) Thirty microliters of an overnight culture were subcultured into 3 ml of fresh LB medium. Tubes were incubated with shaking at 37° C. until the contents reached a mid-log-phase density of OD 0.4. Cultures were put on ice, spun down, and resuspended in 3 ml of cold-buffered saline. Culture samples of 0.5 ml (diluted if necessary) were added to 0.55 ml of complete Z-buffer (Z-buffer plus 5 ml of 10% sodium dodecyl sulfate and 100 ml of chloroform) (Stanley R. Maloy, E
(74) Identification of Synonymous Codon Pairs in a Coding Sequence Associated with a Disease or Condition
(75) A search for synonymous codon mutations within a polynucleotide sequence (e.g., a coding sequence) associated with a disease or condition is performed using, for example, a database. The synonymous mutations are independent of any additional mutations (including insertions and deletions). Synonymous mutations are parsed based on the 15 base pair sequences flanking either side. The effect a synonymous codon mutation has on the expression of the polynucleotide sequence (expression of an encoded protein, for example) is validated by introducing the synonymous codon mutagenized/altered (SCA) polynucleotide sequence into a host cell and culturing the host cell in conditions sufficient for polynucleotide expression. Any effect is determined by comparison to wild-type polynucleotide expression within a comparable control cell. Resulting protein production is determined by SDS-PAGE and Western blotting.
(76) SDS-PAGE and Western Blotting
(77) Expressed chimeric proteins comprising FlgM (and optionally a poly-Histidine purification tag) or polypeptides expressed from a synonymous codon mutagenized polynucleotide sequence are retrieved from whole-cell lysate or cultural supernatant and subjected to SDS polyacrylamide gel electrophoresis and then analyzed by immunoblotting using polyclonal anti-FlgM antibodies, monoclonal anti-6×His (rabbit) antibodies, or anti-polypeptide antibodies for detection. Antigen-antibody complexes are visualized by chemiluminescent or infrared detection using the LI-COR Odyssey or Bio-Rad ChemiDoc imaging system. For chemiluminescent development, secondary goat anti-rabbit antibodies (Bio-Rad) conjugated with horseradish peroxidase (HRP) and an ECL detection kit (Amersham Biosciences) are used. For infrared detection, secondary anti-rabbit IRDye690 (LI-COR) are used. Densiometric measurements of protein bands are performed using ImageJ 1.45 s for Mac OS X (Abramoff et al., Image processing with ImageJ, Biophotonics Int. 11:36-42(2004)).
(78) Recombinant Expression and Purification of Protein Fusions
(79) Cells expressing optimized fusion proteins are picked from a fresh single colony and grown in 10 ml LB overnight. The overnight cultures are diluted 1:100 into 1 liter of fresh medium in a baffled flask and grown in a shaking incubator at 200 rpm for 6-12 hours. If appropriate, expression is induced after the first 2 hours by the addition of 0.2% arabinose or Na-Salicylate. Cells are pelleted by centrifugation (7,000 rpm), and the supernatant containing the recombinant polypeptide of interest is passed through a 0.22-μm polyethersulfone filter (Corning, N.Y.), a low-protein-binding membrane for removal of residual bacteria. For further purification, a gravity flow column (Bio-Rad) packed with 3 g Ni-IDA resin (Protino Ni-IDA; Machery-Nagel) is used, and affinity-tagged proteins are eluted under native conditions at pH 7.5 with a buffer containing 250 mM imidazole.
(80) Secretion Assay
(81) Overnight cultures are diluted 1:100 in LB and grown for 2 h at 37° C. before inducing the expression of the respective FlgM fusions by adding 0.2% L-arabinose. Cells are kept at 37° C. for an additional 4-12 hours, while the fusion proteins are expressed. Afterwards, the optical density at 600 nm (OD.sub.600) is determined for all strains.
(82) Two-milliliter aliquots of the resulting cell culture are centrifuged for 10 min at 4° C. and 7,000 rpm to obtain, for each aliquot, a pellet and supernatant. The supernatant is filtered through a low-protein-binding filter with a 0.2-μm pore size (Acrodisk syringe filter; Pall Life Sciences) to remove the remaining cells. Alternatively, aliquots are centrifuged twice at maximum speed to remove residual cells. Secreted proteins in the filtered or twice-centrifuged supernatant are precipitated by the addition of TCA (10% final concentration). The supernatant samples are resuspended in 24, SDS sample buffer (100 mM Tris [pH 6.8], 4% SDS, 10% glycerol, 2% B-mercaptoethanol, 25 mM EDTA, 0.04% bromophenol blue) and adjusted to 20 OD.sub.600 units/μ. The cellular pellet fraction is suspended in 2% SDS sample buffer, whose volume is adjusted to yield 20 OD.sub.600 units/μL.
Example 1: Effects of Synonymous Codon Mutants on Translation
(83) An allele of the SerT tRNA that is defective in translating the UCA for amino acid Ser7 of the flagellar anti-σ.sup.28 gene, flgM was isolated (Chevance, F. F., et al., J Bacteriol 188:297-304 (2006)). Despite there being many genes with UCA codons for serine in the Salmonella flagellar system, the serT tRNA mutant allele only effected flgM translation. Without being bound by theory, it is believed that the effect of the serT mutant allele on translation of the UCA (Ser7) codon of flgM is a codon-context effect.
(84) Transcription from a σ.sup.28-dependent promoter is inhibited by FlgM. Using the bacterial luciferase operon (lux) as a reporter, the anti-σ.sup.28 activity of FlgM was measured. When FlgM activity is high, σ.sup.28-dependent transcription of P.sub.motA-lux is low. Synonymous mutations were introduced adjacent to position Ser7 and the effects of flanking synonymous mutations on flgM mRNA translation was determined.
(85) All 16 combinations of synonymous changes of the Thr6 and Pro8 codons flanking the UCA Ser7 codon of flgM were made. The FlgM inhibition of σ.sup.28-dependent P.sub.motA-lux transcription was measured. Results were as shown at
(86) The synonymous changes at Thr6 to ACU, ACA or ACG produce an about 11- to 13-fold increase in FlgM inhibitory activity. The synonymous Pro8 codon change CCU to CCG results in an about 20-fold reduction in FlgM inhibitory activity. The combination of a ACC to ACU change at Thr6 with a CCU to CCG change at Pro8 results in an about 34-fold increase in FlgM inhibitory activity. These results demonstrate that the efficiency of codon translation is influenced by up to two adjacent codons (see
Example 2: Modulation of Polynucleotide Translation Using Synonymous Mutagenesis of FlgM
(87) Starting with a flgM sequence comprising the CCU to CCG change at Pro8, the region of the flgM gene that encodes amino acids 2 through 25 was modified using doped oligonucleotide mutagenesis designed so that, on average, each oligonucleotide had a synonymous codon change for amino acids 2 through 25. Results were as shown in
(88) Only synonymous changes in the two codons preceding Pro8 and the Leu9 codon following Pro8 CCG resulted in restoration to wild-type FlgM inhibitory activity. These results demonstrate that efficiency of translation of a specific codon is dependent on the flanking two codons.
(89) Synonymous variations coding for amino acids Thr6-Ser7-Pro8-Leu9 of FlgM result in an about ˜2-fold range in FlgM protein levels. However, since FlgM is a regulatory protein that inhibits σ.sup.28-dependent fliC transcription, the about 2-fold range in FlgM protein levels produces more than an about 1000-fold range in fliC transcription activity. For example, a synonymous codon change at codon 8 of flgM from CCU to CCG (encoding Proline) resulted in an about 2-fold lower FlgM protein level. The about 2-fold reduction in FlgM protein levels resulted in an about 20-fold increase in transcription of the σ28-dependent fliC promoter.
Example 3: Modulation of Heterologous Polynucleotide Translation Using Synonymous Mutagenesis of FlgM
(90) The first ten codons of lacZ were replaced with the first ten codons of flgM, and the flgM sequence was mutated to comprise a CCU to CCG synonymous codon change at Pro8 (codon number 8, in the 5′ to 3′ direction, of flgM that encodes proline). Consistent with the results above, expression of the heterologous lacZ sequence under the control of the context-codon-optimized flgM sequence resulted in reduced β-galactosidase activity. β-galactosidase activity was reduced about 210 to 150 units.
(91) These results demonstrate that synonymous changes in one or more of Thr6-Ser7-Pro8-Leu9 of FlgM effect heterologous protein production (here LacZ) levels when a polynucleotide sequence encoding that polypeptide (here lacz) is operably linked to the context-codon-optimized FlgM sequence (SCM FlgM) and expressed and secreted through a bacterial secretion system (here an engineered T3SS).
(92) Exemplary polypeptides that may be recombinantly produced using a secretion system of the present invention are listed in Table 1 below.
(93) TABLE-US-00003 TABLE 1 Protein Exemplary sequence information Insulin A chain: GIVEQCCTSICSLYQLENYCN (human) (SEQ ID NO: 17) B chain: FVNQHLCGSHLVEALYLVCGE RGFFYTPKT (SEQ ID NO: 18) Insulin A chain: GIVEQCCTSICSLYQLENYCG glargine (SEQ ID NO: 19) (human) B chain: FVNQHLCGSHLVEALYLVCGE RGFFYTPKTRR (SEQ ID NO: 20) Insulin pre- See UniProtKB Accession No. P01308 proinsulin and GenBank Accession No. CAA49913 (human) (Chekhranova et al., Mol. Biol. 26(3): 596-600 (1992)): MALWMRLLPLLALLALTA7GPDPAAAFVNQHLCG SHLVEALYLVCGERGFFYIPKTRREAEDLQVGQV ELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSIC SLYQLENYCN (SEQ ID NO: 21) An exemplary mRNA sequence is available at GenBank Accession No. X70508 (Chekhranova et al., Mol. Biol. 26(3): 596-600 (1992)). Insulin A chain: GIVEQCCTSICSLYQLENYCN lisopro (SEQ ID NO: 22) B chain: FVNQHLCGSHLVEALYLVCGE RGFFYTKPT (SEQ ID NO: 23) MaSp1 See Gaines and Marcotte, Insect Mol. (Major Biol. 17(5): 465-474 (2008); U.S. Pat. Ampullate No. 8,642,734 (incorporated herein Spidroin 1; by reference in its entirety); U.S. spider silk Pat. No. 7,521,228 (incorporated protein) herein by reference in its entirety); (including, US PG PUB NO. 2014/0093965 e.g., MaSp1A (incorporated herein by reference or MaSp1B in its entirety). from Nephila spiders) MaSp2 U.S. Pat. No. 8,642,734 (incorporated (Major herein by reference in its entirety); Ampullate U.S. Pat. No. 7,521,228 (incorporated Spidroin 2; herein by reference in its entirety); spider silk US PG PUB NO. 2014/0093965 protein) (incorporated herein by reference in its entirety)incorporated herein by reference in.
Example 4: Modulation of Heterologous Protein Production Using a T3SS
(94) A nucleic acid molecule comprising a full-length, wild type FlgM polynucleotide sequence operably linked to a human insulin glargine nucleic acid sequence, a poly-histidine nucleotide sequence, an enterokinase cleavage site, and a ParaBAD promoter was introduced into and expressed within a Salmonella enterica serovar Typhimurium cell. The Salmonella cell was modified within several T3S genes as previously described by the inventors (see U.S. PG PUB NO. 2015/0225466, incorporated herein by reference in its entirety) and specifically comprised: ParaBAD1::flgM-His6-ETK-insulin glargine ΔflgMN7753 ΔflgKL7770 PflhDC7793 fliA*5225 ΔfliB-T7771 fljB.sub.enx vh2 (referred to as Strain TS1). A FlgM::Insulin chimeric protein was secreted by the cell and detected via Western blot using anti-6×His antibodies. Results are shown in
Example 5: Modulation of Heterologous Protein Production Using a T3SS and Synonymous Mutagenesis
(95) Secretion of human insulin from an engineered Salmonella T3SS may be further optimized by introducing and expressing within a Salmonella cell a FlgM nucleotide sequence (either a wild type or a synonymous codon mutated FlgM sequence) that is operably linked to a poly-hisitidine purification tag nucleic acid sequence, a cleavage site (e.g., an enterokinase cleave site), and polynucleotide sequences encoding the A and B chains of human insulin wherein the human insulin B chain sequence comprises a synonymous codon mutation. For example, the two adjacent arginine residues within the human insulin B chain may be context codon optimized to increase insulin expression and secretion through the T3SS. In particular, wild type adjacent arginine codons CGC and CGG (in the 5′ to 3′ direction) may be mutated to CGU and CGU; CGU and CGC; CGC and CGU; CGC and CGC; or CGG and CGC. An exemplary construct comprising nucleic acid sequences encoding, in the N-terminal to C-terminal direction, a poly-histidine purification tag, a cleavage site, and human insulin is provided by SEQ ID NO: 16. The sequence provided by SEQ ID NO: 16 may be appended to a FlgM sequence as described elsewhere herein and by the inventors at U.S. PG PUB NO. 2015/0225466 (incorporated herein by reference in its entirety). It is expected that the resulting pair of synonymous codon optimized arginine codons will cause increased human insulin expression and secretion. A chimeric protein comprising FlgM, a poly-histidine purification tag, a cleavage site, and insulin may be detected and purified as described above. The insulin protein may be isolated from the chimeric protein as described above.
(96) TABLE-US-00004 TABLE 2 Sequence (written in the 5′ to 3′ Sequence direction or N-terminus Identifier Description of sequence to C-terminus direction) 1 The first ten amino acid residues of MSIDRTSPLK wild-type FlgM protein (corresponds to the first 10 residues of SEQ ID NO: 3). 2 The first ten codons (i.e., 30 ATGAGCATTGACCGTACCTCACCTTTGAAA nucleotides) of the wild-type FlgM mRNA sequence. 3 The full-length, 97 residue wild-type MSIDRTSPLKPVSTVQTRETSDTPVQKTRQE FlgM amino acid sequence (Gillen and KTSAATSASVTLSDAQAKLMQPGVSDINMER Hughes, J. Bacteriology 173(20): VEALKTAIRNGELKMDTGKIADSLIREAQSY 6453-6459 (1991); publically available LQSK at, e.g., GenBank Accession No. AAA27075 and UniProtKB Accession No. P26477). The first ten residues (i.e., SEQ ID NO: 1) underlined. 4 Wild type FlgM gene sequence (Gillen AATATTCTTATTAACCTATAATTGTGTAAAGATT and Hughes, J. Bacteriology 173(20): TTGTCGCGGCTGCCGATGAGATATTCAACCATGA 6453-6459 (1991); publically available TG at, e.g., GenBank Accession No. GTAGCTGGCCGCTACAACGTAACCCTCGATGAGG M74222). Coding region (i.e., SEQ ID ATAAATAAATGAGCATTGACCGTACCTCACCTTT NO: 5) underlned. First ten codons GA thereof (i.e., SEQ ID NO: 2) in bold. AACCCGTTAGCACTGTCCAGACGCGCGAAACCAG CGACACGCCGGTACAAAAAACGCGTCAGGAAAAA AC GTCCGCCGCGACGAGCGCCAGCGTAACGTTAAGC GACGCGCAAGCGAAGCTCATGCAGCCAGGCGTCA GC GACATTAATATGGAACGCGTCGAAGCATTAAAAA CGGCTATCCGTAACGGTGAGTTAAAAATGGATAC GG GAAAAATAGCAGACTCGCTCATTCGCGAGGCGCA GAGCTACTTACAGAGTAAATAAGCGTATGACTCG TT TGTCAGAAATACTTGACCAGATGACCACCGTCCT GAATGACCTGAAGACGGTGATGGACGCCGAGCAA CA ACAGCTTTCCGTAGGCCAGATTAACGGCAGCCAG CTACAGCGTATTACAGAAGAAAAAAGCTCGTTGC TG GCGACGCTGGATTATCTGGAACAACAGCGCCGTC TGGAGCAGAATGC 5 Full-length, wild type flgM coding ATGAGCATTGACCGTACCTCACCTTTGAAAC region and stop codon (corresponds to CCGTTAGCACTGTCCAGACGCGCGAAACCAG nucleotides 113 to 406 of SEQ ID NO: CGACACGCCGGTACAAAAAACGCGTCAGGAA 4, stop codon underlined). AAAACGTCCGCCGCGACGAGCGCCAGCGTAA CGTTAAGCGACGCGCAAGCGAAGCTCATGCA GCCAGGCGTCAGCGACATTAATATGGAACGC GTCGAAGCATTAAAAACGGCTATCCGTAACG GTGAGTTAAAAATGGATACGGGAAAAATAGC AGACTCGCTCATTCGCGAGGCGCAGAGCTAC TTACAGAGTAAATAA 6 Full-length, wild type flgM mRNA AUGAGCAUUGACCGUACCUCACCUUUGAAAC (first ten codons (i.e., mRNA sequence CCGUUAGCACUGUCCAGACGCGCGAAACCAG corresponding to SEQ ID NO: 2) in CGACACGCCGGUACAAAAAACGCGUCAGGAA bold, stop codon underlined). AAAACGUCCGCCGCGACGAGCGCCAGCGUAA CGUUAAGCGACGCGCAAGCGAAGCUCAUGCA GCCAGGCGUCAGCGACAUUAAUAUGGAACGC GUCGAAGCAUUAAAAACGGCUAUCCGUAACG GUGAGUUAAAAAUGGAUACGGGAAAAAUAGC AGACUCGCUCAUUCGCGAGGCGCAGAGCUAC UUACAGAGUAAAUAA 7 AGCSer2AGT synonymous codon ATGAGTATTGACCGTACCTCACCTTTGAAA mutant triacontanucleotide flgM sequence. Mutation underlined. 8 ACCThr6ACA synonymous codon ATGAGCATTGACCGTACATCACCTTTGAAA mutant triacontanucleotide flgM sequence. Mutation underlined. 9 ACCThr6ACG synonymous codon ATGAGCATTGACCGTACGTCACCTTTGAAA mutant triacontanucleotide flgM sequence. Mutation underlined. 10 ACCThr6ACT synonymous codon ATGAGCATTGACCGTACTTCACCTTTGAAA mutant triacontanucleotide flgM sequence. Mutation underlined. 11 TCASer7TCG synonymous codon ATGAGCATTGACCGTACCTCGCCTTTGAAA mutant triacontanucleotide flgM sequence. Mutation underlined. 12 TCASer7TCC synonymous codon ATGAGCATTGACCGTACCTCCCCTTTGAAA mutant triacontanucleotide flgM sequence. Mutation underlined. 13 TCASer7TCT synonymous codon ATGAGCATTGACCGTACCTCTCCTTTGAAA mutant triacontanucleotide flgM sequence. Mutation underlined. 14 CCTPro8CCG synonymous codon ATGAGCATTGACCGTACCTCACCGTTGAAA mutant triacontanucleotide flgM sequence. Mutation underlined. 15 TTGLeu9TTA synonymous codon ATGAGCATTGACCGTACCTCACCTTTAAAA mutant triacontanucleotide flgM sequence. Mutation underlined. 16 Human insulin glargine construct ATG CAT CAT CAT CAT CAT CAT GGT GGC CGC comprising a poly-histidine TTT GTG AAC CAA CAC CTG TGC GGC TCA CAC purification tag sequence (in bold), a CTG GTG GAA GCT CTC TAC CTA GTG TGC GGG cleavage site (in underline), and pre- GAA CGA GGC TTC TTC TAC ACA CCC AAG pro insulin sequence (B chain in bold ACC CGC CGG GAG GCA GAG GAC CTG CAG GTG and underline, A chain in bold and GGG CAG GTG GAG CTG GGC GGG GGC CCT GGT double underline). GCA GGC AGC CTG CAG CCC TTG GCC CTG GAG GGG TCT CTG CAG GCG CGT GGC ATT GTG GAA CAA TGC TGT ACC AGC ATC TGC TCC CTC TAC CAG CTG GAG AAC TAC TGC GGC TAG
(97) It is to be appreciated that the Detailed Description section, and not the Summary and Abstract sections, is intended to be used to interpret the claims. The Summary and Abstract sections sets forth one or more, but not all, exemplary embodiments of the present invention as contemplated by the inventor(s), and thus, are not intended to limit the present invention and the appended claims in any way. All of the patents, patent applications and references cited herein are incorporated by reference in their entirety.
(98) The present invention has been described above with the aid of functional building blocks illustrating the implementation of specified functions and relationships thereof. The boundaries of these functional building blocks have been arbitrarily defined herein for the convenience of the description. Alternate boundaries can be defined so long as the specified functions and relationships thereof are appropriately performed.