Method for fabricating two-dimensional protein crystals
11286277 · 2022-03-29
Assignee
Inventors
Cpc classification
C12N15/1031
CHEMISTRY; METALLURGY
C07K2319/60
CHEMISTRY; METALLURGY
C07K2/00
CHEMISTRY; METALLURGY
C07K2319/735
CHEMISTRY; METALLURGY
International classification
C07K2/00
CHEMISTRY; METALLURGY
C12N15/10
CHEMISTRY; METALLURGY
Abstract
Polypeptide assemblies and building blocks and methods for making them are provided.
Claims
1. A non-naturally occurring symmetrical polypeptide building block comprising two or more RhuA proteins, wherein each subunit of the RhuA protein comprises a cysteine residue at position 98, and wherein the RhuA proteins of the polypeptide building block are coupled by formation of disulfide-bonds between some or all of said plurality of cysteine residues of different RhuA proteins to facilitate formation of 2D crystals.
2. The polypeptide building block of claim 1, wherein at least one of said cysteine residues has been introduced into said polypeptide building block through genetic engineering.
3. The polypeptide building block of claim 1, wherein said polypeptide building block is generated via solid phase synthesis.
4. The polypeptide building block claim 1, further comprising an additional polypeptide modification selected from the group consisting of functional groups, tags, other polypeptides, peptide tags, detectable labels, fluorophores, and nanoparticles.
5. The polypeptide building block of claim 4, wherein the peptide tag comprises a His tag comprising a sequence set forth in SEQ ID NO: 22.
6. The polypeptide building block of claim 4, wherein the peptide tag comprises a Pd4 peptide comprising a sequence set forth in SEQ ID NO: 23.
7. The polypeptide building block of claim 4, wherein the peptide tag comprises a ACP protein comprising a sequence set forth in SEQ ID NO: 24.
8. The polypeptide building block of claim 1, wherein the polypeptide building block is chemically modified with inorganic nanoparticles or one or more organic functional groups including a fluorophore, a metal chelating group or a host complex.
9. A 2D crystalline material comprising two or more RhuA proteins, wherein each subunit of each RhuA protein comprises a cysteine residue at position 98, wherein disulfide bonds are formed between some or all of said cysteine residues.
10. The 2D crystalline material of claim 9, wherein said 2D crystalline material is auxetic.
11. The 2D crystalline material of claim 9, wherein the 2D crystalline material comprises a Poisson's ratio of at least −1.
12. The 2D crystalline material of claim 9, wherein the 2D crystalline material is chemically modified with inorganic nanoparticles or one or more organic functional groups including a fluorophore, a metal chelating group or a host complex.
13. The 2D crystalline material of claim 9, wherein the 2D crystalline material can be genetically modified/fused with functional proteins and peptides.
14. The 2D crystalline material of claim 9, wherein the 2D crystalline material is free of defects.
15. The 2D crystalline material of claim 9, wherein the 2D crystalline material allows dynamic interconversion between an open conformational state and a closed conformational state.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7) covalent fusion of homooligomeric proteins or self-assembling protein monomers.
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
(36)
(37)
(38)
(39)
(40)
(41)
(42)
(43)
(44)
(45)
(46)
(47)
(48)
(49)
(50)
(51)
(52)
(53)
(54)
(55)
(56)
(57)
(58)
(59)
(60)
(61)
(62)
(63)
(64)
(65)
DEFINITIONS
(66) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the invention pertains.
(67) “About” as used herein when referring to a measurable value is meant to encompass variations of ±20% or ±10%, more preferably ±5%, even more preferably ±1%, and still more preferably ±0.1% from the specified value.
(68) As described herein, a linear chain of amino acid residues is called a “polypeptide.” A protein contains at least one long polypeptide. Short polypeptides, can have less than 20-30 residues, although they can be considered to be proteins, they are commonly called peptides, or sometimes oligopeptides. The individual amino acid residues are bonded together by peptide bonds and adjacent amino acid residues. The sequence of amino acid residues in a protein is defined by the sequence of a gene, which is encoded in the genetic code. In general, the genetic code specifies 20 standard amino acids, such as alanine, arginine, asparagine, aspartic acid, cysteine, glutamic acid, glutamine, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine and valine. Shortly after or even during synthesis, the residues in a protein can also be chemically modified by posttranslational modification, which can alter the physical and chemical properties, folding, stability, activity, and ultimately, the function of the proteins. Sometimes proteins have non-peptide groups attached, which can be called prosthetic groups or cofactors. Proteins can also work together to achieve a particular function, and they can often associate to form stable protein complexes.
(69) “Proteins” as described herein, are large biomolecules, or macromolecules, that can consist of one or more long chains of amino acid residues. Proteins can perform a vast array of functions within living organisms, including catalyzing metabolic reactions, DNA replication, responding to stimuli, and transporting molecules from one location to another. Proteins differ from one another primarily in their sequence of amino acids, which is dictated by the nucleotide sequence of their genes, and which usually results in protein folding into a specific three-dimensional structure that determines its activity. As described herein “enzymes” are proteins that can accelerate, or catalyze, chemical reactions. The molecules at the beginning of the process are called substrates and the enzyme converts these into different molecules, called products. In some embodiments described herein, a stabilized polypeptide formulation comprising the 2D crystalline material of any one of the embodiments described herein is provided. In some embodiments, the stabilized polypeptide comprises an enzyme or protein.
(70) “Disulfide bonds” can also be called an S—S bond, or disulfide bridge, and is a covalent bond derived from two thiol groups. In some embodiments described herein, cysteine residues can be positioned such that formation of disulfide bonds between two cysteine residues can occur.
(71) “Protein crystallization,” as described herein, is a process or method of forming a protein crystal. Protein crystals can been observed in nature, however the protein crystallization method can also be used for scientific or industrial purposes, such as, for example, study by X-ray crystallography. Proteins can be prompted to form crystals when the solution in which they are dissolved becomes supersaturated. Under these conditions, individual protein molecules can pack in a repeating array, held together by noncovalent interactions. These crystals can then be used in structural biology to study the molecular structure of the protein, or for various industrial or biotechnological purposes. Some embodiments described herein relate to a non-naturally occurring symmetrical polypeptide building block comprising a plurality of cysteine residues positioned such that formation of disulfide bonds between some or all of said plurality of cysteine residues facilitates formation of 2D crystals. In some embodiments described herein, a 2D crystalline material comprising a polypeptide building block of any one of the embodiments described herein is provided. The 2D crystalline material can reside on a lab-on-a-chip, a molecular membrane, a molecular template, stabilized polypeptide formulation, molecular scaffold, protective armor, smart textile, piezo electronic component, controlled drug release formulation or a run-flat tire.
(72) Proteins are biological macromolecules and function in an aqueous environment. As such protein crystallization, for example, can be carried out in water. However, protein crystallization is challenging due to restrictions of the aqueous environment, difficulties in obtaining high-quality protein samples, as well as sensitivity of protein samples to temperature, pH, ionic strength, and other factors. Proteins can greatly in their physicochemical characteristics, and so crystallization of a particular protein is rarely predictable. Determination of appropriate crystallization conditions for a given protein often requires empirical testing of many conditions before a successful crystallization condition is found.
(73) In crystallography, a crystallographic point group is a set of symmetry operations, like rotations or reflections that leave a central point fixed while moving other directions and faces of the crystal to the positions of features of the same kind. This symmetry can be described as C.sub.n (for cyclic) which indicates that the group has an n-fold rotation axis. C.sub.nh is C.sub.n with the addition of a mirror (reflection) plane perpendicular to the axis of rotation. C.sub.nv is Cn with the addition of n mirror planes parallel to the axis of rotation.
(74) S.sub.2n (for Spiegel, German for mirror) denotes a group that contains only a 2n-fold rotation-reflection axis.
(75) D.sub.n (for dihedral, or two-sided) indicates that the group has an n-fold rotation axis plus n twofold axes perpendicular to that axis. D.sub.nh has, in addition, a mirror plane perpendicular to the n-fold axis. Dnd has, in addition to the elements of D.sub.n, mirror planes parallel to the n-fold axis.
(76) The letter T (for tetrahedron) indicates that the group has the symmetry of a tetrahedron. T.sub.d includes improper rotation operations, T excludes improper rotation operations, and T.sub.h is T with the addition of an inversion.
(77) The letter O (for octahedron) indicates that the group has the symmetry of an octahedron (or cube), with (O.sub.h) or without (O) improper operations (those that change handedness). Due to the crystallographic restriction theorem, n=1, 2, 3, 4, or 6 in 2- or 3-dimensional space. In some embodiments described herein, a polypeptide is provided wherein the polypeptide has inherent C3, C4, C6, D3, D4 or D6 symmetry.
(78) “Genetic engineering,” as described herein, is the direct manipulation of an organism's genome using biotechnology. One skilled in the art would appreciate the variety of technologies that can be used to change the genetic makeup of nucleic acid in order to make mutations, insertions or deletions. Without being limiting, this can also include transfer of genes within and across species boundaries to produce improved or novel organisms. New DNA may be inserted in the host genome by first isolating and copying the genetic material of interest using molecular cloning methods to generate a DNA sequence, or by synthesizing the DNA, and then inserting this construct into the host organism. Genes can also be mutated at certain points in order to make introduction of polypeptide segments into a protein, create a deletion mutant or make protein mutants with point mutations, for example. In some embodiments described herein, the polypeptide described comprises at least one cysteine residue that has been introduced into said polypeptide building block through genetic engineering. In some embodiments, polypeptide is genetically engineered.
(79) “Solid phase synthesis” as described herein refers to a method in which molecules are bound on a bead and synthesized step-by-step in a reactant solution. In this method, building blocks can be protected at all reactive functional groups. The two functional groups that are able to participate in the desired reaction between building blocks in the solution and on the bead can be controlled by the order of deprotection. This method can be used, for example, for the synthesis of peptides, deoxyribonucleic acid (DNA), and other molecules that need to be synthesized in a certain alignment. In some embodiments described herein, polypeptide is generated via solid phase synthesis.
(80) “Chemical Modification,” as described herein, refers to addition or removal, through chemical reaction, of any of a variety of macromolecules, without being limiting, this can include proteins, polypeptides and nucleic acids, and are known to those skilled in the art.
(81) “Modification by enzymatic reaction,” refers to modification of macromolecules, without being limiting, this can include proteins, polypeptides and nucleic acids, in which the macromolecule is modified in a reaction using an enzyme. As there are a variety of commercially available enzymes for modification, techniques for enzymatic modification can be appreciated by those skilled in the art.
(82) “Peptide tags” as described herein, are known to those skilled in the art and can be used as an affinity tag or can be a small organic molecule, such as biotin or a short peptide sequence. Tags can be attached at the N-terminus, or C terminus, but in principle can be positioned anywhere in a molecule and can be separated from the molecule by a spacer. There are a variety of spacers of varying length and polarity. Additionally, peptide tags can be attached by a cleavable linker. In some embodiments, a polypeptide building block is provided, wherein the polypeptide building block comprises a peptide tag.
(83) “Functional groups” as described herein are specific moieties within a molecule that are responsible for a chemical reaction or a characteristic of a molecule. Common functional groups can include but are not limited to alkyls, alkenyl, alkynyl, phenyls, haloalkanes, fluoroalkanes, chloroalkanes, bromoalkanes, iodoalkanes, alcohols (hydroxyl), ketones (cabonyls), aldehydes, Acyl halides, carbonates (carbonate ester), carboxylate, carboyxlic acids (carboxyl), esters, methoxy, hydroperoxide (hydroperoxy), peroxide (peroxy), ethers, hemiacetals, hemiketals, acetals, ketals, orthoester, heterocycles (methylenedioxy), orthocarbonate esters, amides (carboxyamides), primary amines, secondary amines, tertiary amines, quaternary amines, primary ketimines, secondary ketimines, primary aldimine, secondary almidine, imides, axides, azo compounds, cyanate, isocyanta, nitrate, nitriles, isonitriles, nitosooxy, nitro compounds, nitroso compounds, oxime, pyridines, sulfhydril, sulfides, disulfides, sulfinyls, sulfonyl, sulfino, sulfo, tiocyanate, isothiocyanate, carbonotyioyl, carbonothioyl, phosphine, phosphonic acids, phosphate, boronic acids, boronic esters borinic acids and borinic esters. In some embodiments, a polypeptide building block is provided, wherein the polypeptide building block comprises a functional group.
(84) “Fluorophores” as described herein are fluorescent chemical compound that can re-emit light upon light excitation. Without being limiting, fluorophores can include, for example, Xanthene derivatives (fluorescein, rhodamine, Oregon green, eosin, and Texas red), Cyanine derivatives (cyanine, indocarbocyanine, oxacarbocyanine, thiacarbocyanine, and merocyanine), Squaraine derivatives and ring-substituted squaraines (Seta, SeTau, and Square dyes), Naphthalene derivatives (dansyl and prodan derivatives) Coumarin derivatives, oxadiazole derivatives (pyridyloxazole, nitrobenzoxadiazole and benzoxadiazole), Anthracene derivatives (anthraquinones, including DRAQ5, DRAQ7 and CyTRAK Orange), Pyrene derivatives (cascade blue), Oxazine derivatives (Nile red, Nile blue, cresyl violet, oxazine 170), Acridine derivatives (proflavin, acridine orange, acridine yellow), Arylmethine derivatives (auramine, crystal violet, malachite green, and Tetrapyrrole derivatives (porphin, phthalocyanine, bilirubin). In some embodiments, a polypeptide building block is provided, wherein the polypeptide building block comprises a fluorophore.
(85) “Nanoparticles” as described herein, refers to particles between 1 and 100 nanometers in size. In nanotechnology, a particle is defined as a small object that behaves as a whole unit with respect to its transport and properties. In some embodiments, a polypeptide building block is provided, wherein the polypeptide building block comprises a nanoparticle.
(86) As used herein, “nucleic acid” or “nucleic acid molecule” refers to polynucleotides or oligonucleotides such as deoxyribonucleic acid (DNA) or ribonucleic acid (RNA), oligonucleotides, fragments generated by the polymerase chain reaction (PCR), and fragments generated by any of ligation, scission, endonuclease action, exonuclease action, and by synthetic generation. Nucleic acid molecules can be composed of monomers that are naturally-occurring nucleotides (such as DNA and RNA), or analogs of naturally-occurring nucleotides (e.g., enantiomeric forms of naturally-occurring nucleotides), or a combination of both. Modified nucleotides can have alterations in sugar moieties and/or in pyrimidine or purine base moieties. Sugar modifications include, for example, replacement of one or more hydroxyl groups with halogens, alkyl groups, amines, and azido groups, or sugars can be functionalized as ethers or esters. Moreover, the entire sugar moiety can be replaced with sterically and electronically similar structures, such as aza-sugars and carbocyclic sugar analogs. Examples of modifications in a base moiety include alkylated purines and pyrimidines, acylated purines or pyrimidines, or other well-known heterocyclic substitutes. Nucleic acid monomers can be linked by phosphodiester bonds or analogs of such linkages. Analogs of phosphodiester linkages include phosphorothioate, phosphorodithioate, phosphoroselenoate, phosphorodiselenoate, phosphoroanilothioate, phosphoranilidate, phosphoramidate, and the like. The term “nucleic acid molecule” also includes so-called “peptide nucleic acids,” which comprise naturally-occurring or modified nucleic acid bases attached to a polyamide backbone. Nucleic acids can be either single stranded or double stranded.”
(87) “Rhamnulose-1-phosphate aldolase,” or RhuA, is an enzyme belonging to the lyase family. In some embodiments described herein, a polypeptide building block is provided. In some embodiments, the polypeptide comprises the RhuA protein.
(88) A “2D crystalline material” as described herein are atoms or molecules are arranged in a regular, periodic manner, in which they are in two dimensions. In some embodiments, the 2D crystalline material is auxetic.
(89) “Auxetic” as described herein, refers to structures or materials that have a negative “Poisson's ratio.” When a material that is auxetic is stretched, it becomes thicker perpendicular to the applied force. This occurs due to their particular internal structure and the way this deforms when the sample is uniaxially loaded. Auxetics can be single molecules, crystals, or a particular structure of macroscopic matter. Such materials and structures are expected to have mechanical properties such as high energy absorption and fracture resistance. In some embodiments described herein, a 2D crystalline material is provided, wherein the 2D crystalline material is auxetic.
(90) A lab-on-a-chip (LOC), as described herein, can be a device that integrates one or several laboratory functions on a single chip of only millimeters to a few square centimeters to achieve automation and high-throughput screening, for example. Lab-on-a-chip are used for the handling of extremely small fluid volumes down to less than pico liters. Lab-on-a-chip devices are can also be a subset of Micro-electro-mechanical systems (MEMS) devices, for example and can be indicated by “Micro Total Analysis Systems” (μTAS) as well. Lab-on-a-chip is closely related to, and overlaps with, microfluidics which describes primarily the physics, the manipulation and study of minute amounts of fluids. Lab-on-a-Chip can also indicate the scaling of single or multiple lab processes down to chip-format, whereas “μTAS” is dedicated to the integration of the total sequence of lab processes to perform chemical analysis.
(91) “Molecular membrane” can refer to the two dimensional membrane comprising molecules with polar and nonpolar regions, such as for example, a lipid, polypeptides and/or proteins.
(92) A “molecular template” as described herein, can comprise a molecule, such as, for example, DNA that serves as a pattern for the synthesis of a macromolecule. In some embodiments described herein, a molecular template is provided, wherein the molecular template comprises a 2D crystalline material of any one of the embodiments described herein.
(93) “Protective armor” as described herein is refers to armor that can protect a body from high heat, cold temperature, strong force or impact. Without being limiting, protective armor can be a scuba suit, a lab coat, work boots material, motorcycle vest, motorcycle pants, motorcycle protective clothing, race protective gear, bullet proof vest, bulletproof gear, cryoprotecting gloves, cryoprotecting material and heat resistant clothing or gear.
(94) “Smart textile” as described herein is a passive textile structure capable of responding to external stimulation i.e. from pressure, temperature, light, low voltage current etc. The definition generally means that SMART textiles is a form of textiles that utilizes materials which aids it purpose, and can ‘sense’ what is around it. For example, a textiles company explains it as: Smart materials respond to differences in temperature or light and change in some way. They are called smart because they sense conditions in their environment and respond to those conditions. Smart materials appear to ‘think’ and some have a ‘memory’ as they revert back to their original state. In some embodiments, a smart textile comprising any one of the 2D crystalline material of any one of the embodiments described herein is provided.
(95) “Piezo electronic component” as described herein can be a material that can convert mechanical signals, such as force, pressure, strain or acceleration, into electrical voltage, or, vice versa, an electrical voltage into mechanical motion or oscillations. In some embodiments, a Piezoelectronic component comprising any one of the 2D crystalline material of any one of the embodiments described herein is provided.
(96) “Adaptive membrane or sieve” as described herein, can be a filter made of the materials described herein for preventing the passage of certain molecules, particles or substances. In some embodiments, the adaptive membrane or sieve is a passive and kinetic system that allows expansion of geometry in response to heat, temperature and other changes in its environment. In some embodiments, an adaptive membrane or sieve comprising any one of the 2D crystalline material of any one of the embodiments described herein is provided.
(97) A “controlled drug release formulation” as described herein, refers to a drug which can be gradually released at a constant set dosage for a specific amount of time. In some embodiments herein, the polypeptide building block is attached to a drug for delivery. In some embodiments herein the polypeptide building block attached to a drug for delivery
(98) A “run-flat tire” as described herein is pneumatic vehicle tire that is designed to resist the effects of deflation when punctured, and to enable the vehicle to continue to be driven at reduced speeds (under 55 mph (89 km/h)), and for limited distances (up to 10 mi (16 km), depending on the type of tire). In some embodiments described herein, a run-flat tire comprising the 2D crystalline material of any one of the embodiments described herein is provided. The run-flat tire can resist the effects of deflation when punctured. In some embodiments the tire can be used in a vehicle wherein the vehicle is driven at a speed of 30, 35, 40, 45, 50 or 55 mph or any speed in between any two aforementioned values, when the tire is punctured. In some embodiments, a run flat tire comprising any one of the 2D crystalline material of any one of the embodiments described herein is provided.
(99) “Poisson's ratio” as described herein, is the coefficient of expansion on the transverse axial, and is the negative ratio of transverse to axial strain. When a material is compressed in one direction, it can tend to expand in the other two directions perpendicular to the direction of compression. This phenomenon is called the Poisson effect. Poisson's ratio, ν (nu) is a measure of this effect. The Poisson ratio is the fraction (or percent) of expansion divided by the fraction (or percent) of compression, for small values of these changes. The Poisson's ratio of a stable, isotropic, linear elastic material cannot be less than −1.0 or greater than 0.5 because of the requirement for Young's modulus, the shear modulus and bulk modulus to have positive values. In some embodiments described herein, the 2D crystalline material of any of the embodiments herein comprises a Poisson's ratio of −1.
DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENT
(100) A majority of biological machines and materials are self-assembled, dynamic/responsive multiprotein architectures. For example, biological machines such as Photosystem II, nitrogenase and hydrogenase involve discrete oligomers (
(101) Some protein materials are assembled hierarchically. For example, going from the macro scale to the nano scale, a spider web may comprise a silk fibril, which can further comprise a hetero-nano-composite, which can further comprise beta-sheet nano-crystal, which can also further comprise H-bonded beta-strands. Via supramolecular assembly, weakly held, unstable building blocks may give rise to strong, functional, dynamic, stimuli-responsive materials. (See
(102) 2D crystalline materials exhibit unique mechanical and electronic attributes, possess high surface area-to-volume ratios, offer a uniform display of atomic/molecular entities as well as pores, and provide structural access to materials with all other dimensionalities: to 0- and 1D materials through folding and to 3D materials through stacking. These properties have rendered synthetic 2D materials immensely attractive in applications including electronics, sensing, coating, filtration and catalysis. Nevertheless, the rational design of self-assembling 2D crystals remains a considerable challenge and a very active area of development.
(103) Currently, the fabrication of non-biological 2-D crystalline materials is not generalizable and scalable. Other protein design strategies require extensive computational work and protein engineering, have low success rates, contain large defects, are not single-layered, and often require the presence of lipids for supported assembly. Some embodiments of the 2D crystalline materials described herein are essentially defect-free and self-assemble in an unsupported fashion in solution. They also offer a better strategy because of their simplicity, low cost nature, effectiveness, and potential generalizability. These new 2D crystalline materials as described herein led to a surprising effect of providing a mechanism for making these 2D crystalline materials that had a higher success rate, no large defects and little to no need for the presence of lipids for supported assembly.
(104) Proteins provide certain advantages as building blocks for functional nanomaterials. For example, they involve 20 distinct components (i.e., amino acids) which allow nearly infinite structural and functional diversity. They are inherently nanoscale. In addition, they are genetically encoded and are producible and evolvable in living systems. However, their utilization of 20 distinct components may render their structure, self-assembly and function difficult to program (See
(105) Fabrication of 2D supramolecular protein assemblies may provide one or more of the following advantageous features: 1) high surface area/volume ratio; 2) dense display of a diverse set of chemical functionalities in a highly ordered, yet dynamic fashion; 3) innately functional building blocks (e.g., functional enzymes); and 4) potential for smart materials, lab-on-a-chip technologies, heterogeneous catalyst platforms (
(106) However, some existing approaches for designed protein assembly may be too design-intensive and involve sophisticated, but not sure-fire computational methods or protein fusion strategies that do not always give the desired product, and the desired products are not scalable and do not always possess superior materials properties (e.g, perfect structural order, stimuli-responsiveness, etc.) (
(107) Other approaches are also too design-intensive, involve sophisticated and but not sure-fire computational methods or protein fusion strategies that do not always give the desired product and the desired products are not scalable, and do not always possess superior materials properties (e.g, perfect structural order, stimuli-responsiveness, etc.) (
(108) Other approaches have been described in Colson, J. W.; Dichtel, W. R. Rationally synthesized two-dimensional polymers. Nat. Chem. 2013, 5, 453-465″ and Butler, S. Z.; Hollen, S. M.; Cao, L.; Cui, Y.; Gupta, J. A.; Gutiérrez, H. R.; Heinz, T. F.; Hong, S. S.; Huang, J.; Ismach, A. F.; Johnston-Halperin, E.; Kuno, M.; Plashnitsa, V. V.; Robinson, R. D.; Ruoff, R. S.; Salahuddin, S.; Shan, J.; Shi, L.; Spencer, M. G.; Terrones, M.; Windl, W.; Goldberger, J. E. Progress, Challenges, and Opportunities in Two-Dimensional Materials Beyond Graphene. ACS Nano 2013, 7, 2898-2926; Sinclair, J. C.; Davies, K. M.; Venien-Bryan, C.; Noble, M. E. M. Generation of protein lattices by fusing proteins with matching rotational symmetry. Nat. Nanotechnol. 2011, 6, 558-562; Lanci, C. J.; MacDermaid, C. M.; Kang, S.-g.; Acharya, R.; North, B.; Yang, X.; Qiu, X. J.; DeGrado, W. F.; Saven, J. G. Computational design of a protein crystal. Proc. Natl. Acad. Sci. USA 2012, 109, 7304-7309; King, N. P.; Sheffler, W.; Sawaya, M. R.; Vollmar, B. S.; Sumida, J. P.; Andro, I.; Gonen, T.; Yeates, T. O.; Baker, D. Computational Design of Self-Assembling Protein Nanomaterials with Atomic Level Accuracy. Science 2012, 336, 1171-1174; Lai, Y.-T.; Cascio, D.; Yeates, T. O. Structure of a 16-nm Cage Designed by Using Protein Oligomers. Science 2012, 336, 1129; Lebeau, L. et al., Two-dimensional crystallization of a membrane protein on a detergent-resistant lipid monolayer. (2001). J Mol. Biol, 306, 639-647; Uzgiris, E. & Kornberg, R. Two-dimensional crystallization technique for imaging macromolecules with application to antigen-antibody-complement complexes. (1983). Nature, 301, 125-129. (All incorporated by reference in their entireties herein).
(109) Some embodiments provided herein relate to a highly efficient/expeditious design strategy for the fabrication of single layered, ultra-low defect 2D crystalline materials out of protein building blocks. Such 2D crystalline materials exhibit unique mechanical and electronic attributes, possess high surface area-to-volume ratios, offer a uniform display of atomic/molecular entities as well as pores, and provide structural access to materials with all other dimensionalities: to 0- and 1D materials through folding and to 3D materials through stacking.
(110) In some embodiments, an inherently symmetrical or an artificially “symmetrized” protein is modified with Cys residues in appropriate locations. The selective and easily tunable nature of Cys-Cys disulfide bonding is then utilized to assemble these protein building blocks into crystalline, 2D materials that 1) exhibit very low frequency of defects, 2) exhibit coherent dynamicity (i.e., lattices that open up and close in a cooperative fashion without loss of crystallinity), 3) are scalable, and 4) are readily modified chemically or genetically. The 2D crystalline materials produced by the methods of the embodiments described herein, are coherently dynamic and show large flexibility.
(111) In some embodiments, the 2D crystalline protein materials described herein may be used in applications including the following: 1) Fabrication of self-assembled, chemically dense, lab-on-a-chip platforms for sensing, diagnostics, vaccine development, and drug delivery; 2) Fabrication of molecular membranes for sieving and filtration; 3) Fabrication of molecular templates that provide 5-100 nm spatial resolution for patterning and deposition (which is a length scale that is hard to attain with diffraction-based methods); 4) Stabilization of enzymes and proteins of commercial value; and 5) Fabrication of crystalline molecular scaffolds for macromolecular structure determination by 2D crystallography and electron microscopy.
(112) In some embodiments, an inherently symmetrical or an artificially “symmetrized” protein is very simply modified with Cys residues in appropriate locations. The selective and easily tunable nature of Cys-Cys disulfide bonding is then utilized to assemble these protein building blocks into crystalline, 2D materials that 1) exhibit very low frequency of defects; 2) exhibit coherent dynamicity (i.e., lattices that open up and close in a cooperative fashion without loss of crystallinity); 3) are scalable; and 4) are readily modified chemically or genetically.
(113) Some embodiments of the methods and compositions described herein provide advantages over prior approaches due to their simplicity, low cost nature, effectiveness and potential generalizability. For example, some embodiments require a simple visual inspection of the protein building block that possesses the proper symmetry (C3, C4, C6, D3, D4 or D6), and incorporation of single Cys residues into appropriate positions for self-assembly. This contrasts with other protein design strategies that require extensive computational work and protein engineering, and have low success rates. It also contrasts with the fabrication of non-biological 2-D crystalline materials, which are not generalizable and scalable.
(114) Some embodiments of the 2D crystalline materials described herein are essentially defect-free and self-assemble in an unsupported fashion in solution. These contrasts with other 2D protein crystalline materials previously designed or produced that contain large defects, are not single-layered and often require the presence of lipids for supported assembly. In some embodiments, the 2D crystalline materials described herein are coherently dynamic. Other previous examples of dynamic 2D materials (based on proteins or other building blocks) do not show large flexibility. As such, the methods of some of the embodiments described herein, produce 2D crystals that are surprisingly flexible and dynamic and do not require the presence of lipids for supported assembly.
(115) In some embodiments described herein, a protein building block with inherent C3, C4, C6, D3, D4 or D6 symmetry is appropriately engineered to contain a single set of surface cysteine residues in the corner positions. The resulting variant may be incubated in solution under controllable oxidizing conditions (such as controlled atmosphere, a redox buffer consisting of reduced and oxidized glutathione, or a slowly degrading reducing agent like beta-mercaptoethanol) to self-assemble into suspended crystalline materials. The quality of the material may be readily validated by routine transmission electron microscopy or atomic force microscopy measurements. When/if desired, the protein building blocks may be genetically or chemically modified prior to self-assembly with functional groups and tags, including other proteins, peptide tags, fluorophores, nanoparticles.
(116) The strategy described here can be readily implemented on other protein systems that possess the appropriate inherent symmetry.
(117) As described herein, the 2D crystalline protein materials generated by the embodiments have diverse potential applications: 1) Fabrication of self-assembled, chemically dense, lab-on-a-chip platforms for sensing, diagnostics, vaccine development, drug delivery; 2) Fabrication of molecular membranes for sieving and filtration; 3) Fabrication of molecular templates that provide 5-100 nm spatial resolution for patterning and deposition (which is a length scale that is hard to attain with diffraction-based methods; 4) Stabilization of enzymes and proteins of commercial value; 5) Fabrication of crystalline molecular scaffolds for macromolecular structure determination by 2D crystallography and electron microscopy. In some embodiments, the 2D crystalline protein materials can be used in lab-on-a-chip platforms for sensing, diagnostics, vaccine development, drug delivery, fabrication of molecular membranes for sieving and filtration, fabrication of molecular templates that provide 5-100 nm spatial resolution for patterning and deposition (which is a length scale that is hard to attain with diffraction-based methods), stabilization of enzymes and proteins of commercial value and fabrication of crystalline molecular scaffolds for macromolecular structure determination by 2D crystallography and electron microscopy.
(118) Some embodiments described herein involve disulfide-mediated assembly of 2D protein materials. Some embodiments bypass the need for time-/cost-intensive computational design or protein-fusion. For example, in some embodiments the only step is the engineering of cysteine residues at proper positions on a protein building block of choice. In some embodiments, the cysteine residues are in appropriate positions in a C3, C4 or C6-symmetric protein that is expressible in bacteria or other desired organism, cell, or system. In some embodiments, the experimental flow/feasibility testing is highly streamlined, involving protein expression/purification, testing of different oxidative conditions for self-assembly (such as air oxidation or redox buffer systems), and characterization by electron microscopy) (
(119) In an exemplary embodiment, the RhuA protein was engineered to have cysteines at the corners of the protein. In particular, the wild type RhuA protein of SEQ ID NO: 1 (RCSB Protein Data Bank accession number 1OJR, the disclosure of which is incorporated herein by reference in its entirety) was modified to replace the Asp at position 98 with Cys and to replace the Cys at position 126 with a Ser (SEQ ID NO: 2). In addition, to replacing the Asp at position 98 with Cys and to replacing the Cys at position 126, the modified protein RhuA protein had the E192A mutation such that the modified RhuA protein had the sequence of SEQ ID NO: 3. Oxidation was performed via gradual degradation of the reducing agent β-mercaptoethanol (10 mM) at 4° C. under constant shaking to allow formation of disulfide bonds. This approach was simple to design, (only took 10 min to find proper locations for Cys incorporation) and readily tested. In particular, visual inspection of the RhuA crystal structure indicated four protrusions from the surface (since it is C4 symmetry protein, cysteines will be exact same location) which were identified as ideal locations for incorporating single cysteine residues (
(120) In addition, it provided robust, reproducible self-assembly, crystalline order over large length-scales (up to several microns), and single-layered structures which were essentially defect-free and dynamic.
(121) In some embodiments, new potential for smart/stimuli-responsive nano- and bio-materials or mechanical Nano devices are provided.
(122) Additional embodiments are provided in the figures submitted herewith.
(123) Fabrication of crystalline materials with distinct dimensionalities and tailorable structural, physical and chemical properties represents a major goal in fundamental and applied sciences. As reported herein, the bottom-up self-assembly of unsupported, two-dimensional protein lattices with precise spatial arrangements and patterns through a readily accessible design strategy, are provided. Three single- or double-point mutants of the soluble, C4 symmetric protein RhuA were designed to assemble via different modes of intermolecular interactions (single disulfide, double disulfide and metal coordination) into crystalline, two-dimensional arrays in a chemically tunable fashion. Owing to the flexibility of the single disulfide interactions, the lattices of one of the variants (C98RhuA) are essentially defect-free and undergo substantial but highly correlated changes in molecular arrangement and porosity, yielding a Poisson's ratio of −1, the lowest thermodynamically possible value for an isotropic material. In some embodiments described herein, the polypeptide building block can be designed to have one, two, three, four or more point mutations to allow assembly of intermolecular interactions into crystalline, two-dimensional arrays. In some embodiments, the sites for the point mutations that allow the protein-protein interactions are selected by structure prediction programs, which are known to those skilled in the art.
(124) Some embodiments relate to a self-assembled, protein-based molecular material that is auxetic. In some embodiments, this material displays the thermodynamically lowest possible Poisson's ratio of −1 for an isotropic material. Some embodiments relate to a general method to fabricate such auxetic materials from protein building blocks. In some embodiments, the self-assembled, protein-based molecular material comprises 2D crystals of a protein termed C98-RhuA. The method to fabricate auxetic self-assembled protein-based molecular material, such as, for example, 2D C98-RhuA crystals, is highly expeditious and can be readily utilized with a wide variety of protein building blocks. In some embodiments of this methodology, an inherently symmetrical or an artificially “symmetrized” protein is very simply modified with cysteine (Cys) residues in appropriate, “corner” locations. In some embodiments, the inherently symmetrical or an artificially “symmetrized” protein is selected to have cysteine mutations that allow the proteins to self assemble, wherein the cysteine mutation sites selected by studying the predicted protein structures from protein structure prediction databases. Alternatively, if there is a wild-type cysteine, these can also be mutated into an amino acid whose functional group will not interfere with self-assembly. These Cys-containing protein building blocks self-assemble selectively through the formation of disulfide bonds between Cys side chains. The simultaneous flexibility and short linker-length of Cys-Cys disulfide bonding allows the formation of highly ordered (crystalline) lattices that undergo dramatic conformational changes in a coherent manner. The “rotary” motion of each protein building block results in auxetic behavior.
(125) Poisson's ratio is a fundamental parameter that describes the response of a material to uniaxial strain. Most materials have positive Poisson's ratios, meaning that when they are stretched in one direction, they become thinner in the lateral direction (for example, a rubber band). Materials with negative Poisson's ratios (auxetic materials), on the other hand, display the counterintuitive behavior of lateral expansion upon transverse stretching. This property endows them with enhanced toughness, resistance to indentation, and shear stiffness, among many other advantageous. Though several auxetic materials have been identified or fabricated at the macroscopic level (most of them having Poisson's ratios between −0.3 and 0), in some embodiments the auxetic self-assembled, protein-based molecular material, such as for example, the 2D C98-RhuA crystals described herein, display the minimum allowed value of −1, which is not only significant because of its unprecedented magnitude, but also because it was achieved through bottom-up molecular design (which is extremely rare-if not unprecedented-among auxetic materials). As such the material processed by the methods described in some of the embodiments herein led to a material with surprising characteristics. In some embodiments the auxetic self-assembled, protein-based molecular material, such as for example, the C98-RhuA crystals, can be used as feedstocks for macroscopic auxetic and adaptive materials. This in turn permits tailoring of the macroscopic auxetic properties of resulting materials through molecular engineering. Several functionalized 2D crystalline protein arrays have been prepared using the procedures provided herein.
(126) Due to their superior/advantageous physical properties (toughness, high resistance to indentation, high shear stiffness while being lightweight, adaptiveness), auxetic materials have numerous potential applications, including, for example, as structural and functional components of: 1) protective armors; 2) smart textiles; 3) piezo electronics; 4) adaptive membranes, sieves; 5) controlled drug release; 6) run-flat tires.
(127) Some embodiments relate to a self-assembled, protein-based molecular material that is auxetic. In some embodiments, this material displays the thermodynamically lowest possible Poisson's ratio (−1; minus one) for an isotropic material. In some embodiments, the auxetic material comprises 2D crystals of a protein termed C98-RhuA. Other embodiments relate to a general method to fabricate such auxetic materials from protein building blocks.
(128) Poisson's ratio is a fundamental parameter that describes the response of a material to uniaxial strain. Most materials have positive Poisson' ratios, meaning that when they are stretched in one direction, they become thinner in the lateral direction (for example, a rubber band). Materials with negative Poisson' ratios (auxetic materials), on the other hand, display the counterintuitive behavior of lateral expansion upon transverse stretching. This property endows them with enhanced toughness, resistance to indentation, and shear stiffness, among many other advantageous.
(129) Though several auxetic materials have been identified or fabricated at the macroscopic level (most of them having Poisson's ratios between ν=0.5 to −0.85), 2D C98-RhuA crystals that were disclosed here displays the minimum allowed value of −1, which is not only significant because of its unprecedented magnitude, but also because it was achieved through bottom-up molecular design (which is extremely rare-if not unprecedented-among auxetic materials). In some embodiments, the auxetic materials, such as, for example, the C98-RhuA crystals, can be used as feedstocks for macroscopic auxetic and adaptive materials. This in turn allows tailoring of the macroscopic auxetic properties of resulting materials through molecular engineering.
(130) The method to fabricate auxetic self-assembled protein-based molecular material, such as, for example, 2D C98-RhuA crystals, is highly expeditious and can be readily utilized with a wide variety of protein building blocks. In some embodiments, an inherently symmetrical or an artificially “symmetrized” protein is very simply modified with cysteine (Cys) residues in appropriate, “corner” locations. These Cys-containing protein building blocks self-assemble selectively through the formation of disulfide bonds between Cys side chains. The simultaneous flexibility and short linker-length of Cys-Cys disulfide bonding allows the formation of highly ordered (crystalline) lattices that undergo dramatic conformational changes in a coherent manner. The “rotary” motion of each protein building block results in auxetic behavior.
(131) Some embodiments relate to a designed/synthetic, molecular material that has a Poisson's ratio of −1 (minus one). Other embodiments relate to a designed biological material that has a negative Poisson's ratio. Some embodiments provide a general method to fabricate molecular auxetic materials.
(132) Auxetic materials have been described recently in G. N. Greaves, A. Greer, R. Lakes, T. Rouxel, Nat. Mater. 10, 823 (2011) as well as existing patents but these predominantly involve macroscopic materials obtained through physical fabrication methods (and not by molecular self-assembly).
(133) In some embodiments, a protein building block (such as, for example, RhuA) with inherent C3, C4, C6 symmetry is appropriately engineered to contain a single set of surface cysteine residues in the corner positions. The resulting variant is incubated in solution under controllable oxidizing conditions (such as, for example, controlled atmosphere, a redox buffer consisting of reduced and oxidized glutathione, or a slowly degrading reducing agent like beta-mercaptoethanol) to self-assemble into suspended crystalline materials. If desired, the quality of the material may readily be validated by routine transmission electron microscopy or atomic force microscopy measurements. In some embodiments, the resulting 2D crystalline materials show dynamic/adaptive/auxetic behavior.
(134) Due to their superior/advantageous physical properties (toughness, high resistance to indentation, high shear stiffness while being lightweight, adaptiveness), auxetic materials have numerous potential applications, including, for example, as structural and functional components of 1) protective armors; 2) smart textiles; 3) piezo electronics; 4) adaptive membranes, sieves; 5) controlled drug release; 6) run-flat tires. In some embodiments described herein, the 2D crystalline material can be utilized in aerospace applications, materials in aircraft gas turbine engines, prosthetic materials, surgical implants, suture/muscle/ligament anchors, electrodes, piezoelectric sensors, filters and actuators.
(135) A summary of some applications for these materials is provided on the internet at www.azom.com/article.aspx?ArticleID=168.
(136) In some embodiments, coherently dynamic 2D protein crystals are obtained by design and exhibit the lowest possible Poisson's ratio for an isotropic material.
(137) Two-dimensional (2D) crystalline materials possess unique structural, mechanical, and electronic properties (R. Mas-Balleste, C. Gomez-Navarro, J. Gomez-Herrero, F. Zamora, Nanoscale 3, 20 (2011); S. Z. Butler et al., ACS Nano 7, 2898 (2013)), which has rendered them highly attractive in applications including electronics, sensing, coating, filtration and catalysis (S. Z. Butler et al., ACS Nano 7, 2898 (2013); F. Schedin et al., Nat. Mater. 6, 652 (2007); A. K. Geim, K. S. Novoselov, Nat. Mater. 6, 183 (2007); C.-H. Lu, H.-H. Yang, C.-L. Zhu, X. Chen, G.-N. Chen, Angew. Chem. Int. Ed. Engl. 121, 4879 (2009); R. K. Joshi et al., Science 343, 752 (2014); M. A. Lukowski et al., J. Am. Chem. Soc. 135, 10274 (2013)). Although there have been considerable advances in the preparation of 2D materials that consist of one or few atomic/molecular layers (V. Nicolosi, M. Chhowalla, M. G. Kanatzidis, M. S. Strano, J. N. Coleman, Science 340, 1226419 (2013); D. Li, M. B. Muller, S. Gilje, R. B. Kaner, G. G. Wallace, Nat. Nano. 3, 101 (2008)), bottom-up design and assembly of 2D crystalline materials remains a considerable challenge and a highly active area of development (J. W. Colson et al., Science 332, 228 (2011); P. Kissel, D. J. Murray, W. J. Wulftange, V. J. Catalano, B. T. King, Nat. Chem. 6, 774 (2014); M. J. Kory et al., Nat. Chem. 6, 779 (2014)). Even more challenging is the design of dynamic 2D lattices that can undergo large-scale coherent motions in the 2D plane without loss of crystallinity. Dynamicity in porous 3D crystalline solids has been exploited for stimuli-responsive functions and adaptive behavior (S. Shimomura et al., Nat. Chem. 2, 633 (2010); J. Rabone et al., Science 329, 1053 (2010); C. Serre et al., Science 315, 1828 (2007)). As in the case of such 3D materials, integrating flexibility into crystalline 2D lattices would greatly broaden the functional scope of 2D materials.
(138) Proteins are attractive building blocks for 2D materials because of their structural and chemical diversity, genetic tailorability and inherent functions. Prominent examples for natural, protein-based 2D materials are bacterial surface-layer (S-layer) proteins and purple-membrane bacteriorhodopsin assemblies, which form crystalline arrays in association with cell walls and membranes, respectively, and have been employed in diverse technological applications (F. Baneyx, J. F. Matthaei, Curr. Opin. Biotech. 28, 39 (2014); U. B. Sleytr, B. Schuster, E. M. Egelseer, D. Pum, FEMS Microbiol. Rev., (2014); N. Hampp, Chem. Rev. 100, 1755 (2000)). On the synthetic front, methods for 2D protein crystallization have been developed for the structural characterization of membrane proteins (A. Engel et al., J. Struct. Biol. 109, 219 (1992); H. Stahlberg et al., FEBS Lett. 504, 166 (2001)) or functional applications (P. O. Saboe et al., Adv. Mater. 26, 7064 (2014)), generally relying on the presence of lipid layers as supports. Recently, there has been progress in the rational, de novo design of 2- or 3D supramolecular protein arrays (J. C. Sinclair, K. M. Davies, C. Venien-Bryan, M. E. M. Noble, Nat. Nanotechnol. 6, 558 (2011); J. D. Brodin et al., Nat. Chem. 4, 375 (2012); N. P. King et al., Science 336, 1171 (2012); S. Gonen, F. DiMaio, T. Gonen, D. Baker, Science 348, 1365 (2015); C. J. Lanci et al., Proc. Natl. Acad. Sci. USA 109, 7304 (2012)), which has entailed the symmetric polymerization of protein building blocks through computationally designed protein-protein interactions or through genetic fusion of protein components. While elegant, these approaches are design-intensive, and the integration of dynamic/adaptive behavior has not been explored.
(139) To address these issues, a simple chemical bonding strategy to control protein self-assembly was used. It was reasoned that both cysteine (Cys)-mediated disulfide bonds and metal coordination interactions between protein building blocks could produce crystalline and dynamic protein arrays with minimal design, because these bonds are: 1) strong but reversible (to minimize the surface area to be designed and ensure self-healing), 2) short yet sufficiently flexible (to simultaneously afford crystallinity and adaptiveness), and 3) chemically tunable (to exert external control over self-assembly and enable stimuli-responsiveness), and 4) easily designed and engineered. As such, the embodiments described herein, the 2D crystalline material comprise polypeptides, wherein the polypeptides can form bond that are: 1) strong but reversible (to minimize the surface area to be designed and ensure self-healing), 2) short yet sufficiently flexible (to simultaneously afford crystallinity and adaptiveness), and 3) chemically tunable (to exert external control over self-assembly and enable stimuli-responsiveness), and 4) easily designed and engineered.
(140) The most straightforward route to obtaining 2D lattices is the tesselation of C.sub.3, C.sub.4 or C.sub.6 symmetric building blocks through appropriately positioned C.sub.2 symmetric linkages such as disulfide bonds or many metal coordination interactions. As a model building block, the L-rhamnulose-1-phosphate aldolase (RhuA) protein, was chosen, which is a stable, C.sub.4 symmetric homotetramer (4×274 residues) that was previously used as a synthon for engineering supramolecular assemblies (P. Ringler, G. E. Schulz, Science 302, 106 (2003)). RhuA roughly resembles a four-legged stool with dimensions of 7×7×5 nm (
(141) For the oxidation-driven self-assembly of the Cys-bearing variants .sup.C98RhuA and .sup.F88/C98RhuA, various strategies were tested, including air oxidation, redox buffer systems containing reduced and oxidized glutathione (GSH and GSSG) or low concentrations of the reductant β-mercaptoethanol βME (≤10 mM), which slowly decomposes in aqueous solution and results in gradually more oxidizing conditions. For the metal-coordination driven self-assembly of .sup.H63/H98RhuA, two different divalent metal ions (Zn.sup.2+ and Cu.sup.2+) that can accommodate the desired four-coordinate geometries and various buffering agents were screened, which can influence metal coordination by regulating both the solution pH and effective metal ion concentration. It was found that the self-assembly of all three variants was robust and occurred under a broad range of conditions (protein concentrations ranging from 25 to 175 μM, all methods of oxidation, metal identity, and 6<pH<8) at 4° C. The following solution conditions yielded 2D assemblies that were optimized in terms of size, crystallinity, yield and reproducibility: .sup.C98RhuA and .sup.F88/C98RhuA (≥125 μM protein, 10 mM βME, pH 7.5, 10 mM TRIS); .sup.H63/H98RhuA (25 μM protein, 200 μM ZnCl.sub.2, pH 7, 20 mM MOPS). Under these conditions, .sup.C98RhuA reproducibly and in high yield assembled into straight-edged, single- or few-layered 2D crystals that grew to several μm's over several days (
(142) The computed diffraction patterns from negative stain (ns) TEM images are consistent with P42.sub.12 plane group symmetry for .sup.C98RhuA and .sup.F88/C98RhuA and P4 symmetry for .sup.H63/H98RhuA crystals (
(143) The superior quality and the larger sizes of .sup.C98RhuA crystals compared to the .sup.F88/C98RhuA and .sup.H63/H98RhuA lattices can be readily explained by the bonding interactions that direct the self-assembly of the three variants. The .sup.F88/C98RhuA building block presents a roughly circular distribution of eight cysteines (
(144) In contrast to .sup.F88/C98 RhuA and .sup.H63/H98RhuA, the self-assembly of .sup.C98RhuA is both chemically and orientationally specific. Moreover, the reversibility and inherent flexibility of single Cys-Cys linkages—containing five rotatable bonds—likely allows for the correction of any defects such as step or surface vacancies and grain boundaries, which would be difficult to accomplish in a rigid lattice composed of strongly interacting building blocks such as .sup.F88/C98 RhuA. Indeed, as TEM images of mono-layered .sup.C98RhuA crystals indicate, the outcomes are a) macroscopic crystal morphologies that reflect the molecular symmetry of the building blocks, b) molecularly sharp crystal boundaries, and c) lattices with very low defect frequencies. In hundreds of monocrystalline .sup.C98RhuA lattices with surface areas >1 μm.sup.2 that were examined closely, a single lattice defect was not detected (vacancies or grain boundaries), despite the fact that these crystals grow in 3D space in an unsupported fashion. In a rare instance where a single lattice vacancy was found, the defect frequency still was one missing .sup.C98RhuA molecule in a 2D grid of ˜9000 molecules (˜0.6 μm.sup.2) (
(145) A perhaps more striking consequence of the flexibility of Cys-Cys linkages is the coherent dynamicity of the .sup.C98RhuA crystals. While our initial preparations predominantly yielded open lattices with large pores (
(146) TABLE-US-00001 TABLE 1 Structural parameters for conformations II, V and VII of .sup.C98RhuA crystals derived from images shown in FIG. 12. Open (II) Intermediate (V) Closed (VII) Unit cell (a = b, γ) 114.4 Å, 90° 110.0 Å, 90° 107.8 Å, 90° Intertetramer hinge 79° 49° 17° angle, α Protein surface area per 84.9 nm.sup.2 86.2 nm.sup.2 88.0 nm.sup.2 unit cell, A.sub.protein Pore surface area per 46.0 nm.sup.2 34.7 nm.sup.2 28.2 nm.sup.2 unit cell, A.sub.pore Relative protein/pore 1.8 2.5 3.1 density, A.sub.protein/A.sub.pore
(147) Conformational dynamics of .sup.C98RhuA crystals are fully coherent: in each crystal examined, only one type of conformational state is observed throughout the lattice and the overall P42.sub.12 plane group symmetry is preserved (
(148) Geometric considerations (
(149)
where −1≤ν≤0.5 for an isotropic material. Most materials possess positive Poisson's ratios, i.e., they become thinner in the longitudinal direction when stretched transversely (G. N. Greaves, A. Greer, R. Lakes, T. Rouxel, Nat. Mater. 10, 823 (2011)). Materials with negative Poisson's ratios (i.e., auxetic materials), on the other hand, display the counterintuitive behavior of longitudinal expansion upon transverse stretching. Thus, auxetic materials can be expected to possess enhanced toughness, resistance to indentation, and shear stiffness, and have been proposed for use in body armors, smart textiles, actuated filtration and piezoelectric devices, among many others (G. N. Greaves, A. Greer, R. Lakes, T. Rouxel, Nat. Mater. 10, 823 (2011); K. E. Evans, A. Alderson, Adv. Mater. 12, 617 (2000); R. H. Baughman, Nature 425, 667 (2003)). Although natural and synthetic materials with negative Poisson's ratios exist, most fall in the range of −0.4<ν<0, with the lowest value reported of −0.7, observed in reentrant polyurethane foams (R. Lakes, Science 235, 1038 (1987)). It was postulated that for a 2D lattice of rotating rigid squares with flexible hinges, the Poisson's ratio should be negative at all rotation angles and equal to the lowest thermodynamically permissible value of −1 (J. Grima, A. Alderson, K. Evans, Phys. Stat. Sol. b 242, 561 (2005)). .sup.C98RhuA lattices represent a true realization of this theoretical model at the molecular scale and represent—to our knowledge—the first synthetic or natural isotropic material with ν=−1. In the embodiments described herein, the 2D crystalline material comprises a Poisson's ratio of −1.
(150) It was envisioned that upon hierarchical assembly through physical methods, molecular architectures like 2D .sup.C98RhuA lattices can be used as feedstocks for adaptive and auxetic macroscopic materials. Of particular importance is the observation that compression and expansion of .sup.C98RhuA-type, “rotary” lattices occur without the deformation of individual building blocks, thereby opening the way for incorporating their inherent molecular functions and properties into higher-order assemblies. Due to their chemical tunability, reproducible production and high structural quality, .sup.C98RhuA lattices provide an ideal medium for studying molecular self-assembly, crystal nucleation and growth. The resulting understanding of structural/lattice dynamics at the nanoscale should greatly aid the fabrication of functional materials.
Example 1-Design of RhuA Variants and Site-Directed Mutagenesis
(151) RhuA variants were designed as described above based on previously reported crystal structures (PDB ID: 1OJR for .sup.C98RhuA and .sup.H63/H98RhuA (P. Ringler, G. E. Schulz, Science 302, 106 (2003)) and PDB ID 2UYU for .sup.F88/C98RhuA (D. Grueninger et al., Science 319, 206 (2008)). All RhuA variants also contain the mutations E192A and C126S as reported in (P. Ringler, G. E. Schulz, Science 302, 106 (2003)) and (D. Grueninger et al., Science 319, 206 (2008)). The gene for .sup.C98RhuA, pre-inserted into the pJ414 expression vector optimized for expression in E. coli (Ampicillin resistant), was purchased from DNA2.0. .sup.F88/C98RhuA and .sup.H63/H98RhuA were prepared using QuikChange mutagenesis (Stratagene) with primers obtained from Integrated DNA Technologies (Table 2). The mutant plasmids were transformed into XL-1 Blue E. coli cells followed by purification using the QIAprep Spin Miniprep kit (Qiagen). The presence of the mutations was verified by sequencing (Retrogen).
(152) TABLE-US-00002 .sup.C98RhuA Sequence (SEQ ID NO: 3): MQNITQSWFVQGMIKATTDAWLKGWDERNGGNLTLRLDDADIAPYHDNF HQQPRYIPLSQPMPLLANTPFIVTGSGKFFRNVQLDPAANLGIVKVDSC GAGYHILWGLTNEAVPTSELPAHFLSHSERIKATNGKDRVIMHCHATNL IALTYVLENDTAVFTRQLWEGSTECLVVFPDGVGILPWMVPGTDAIGQA TAQEMQKHSLVLWPFHGVFGSGPTLDETFGLIDTAEKSAQVLVKVYSMG GMKQTISREELIALGKRFGVTPLASALAL .sup.H63/H98RhuA Sequence (SEQ ID NO: 4): MQNITQSWFVQGMIKATTDAWLKGWDERNGGNLTLRLDDADIAPYHDNF HQQPRYIPLSQPMHLLANTPFIVTGSGKFFRNVQLDPAANLGIVKVDSH GAGYHILWGLTNEAVPTSELPAHFLSHSERIKATNGKDRVIMHCHATNL IALTYVLENDTAVFTRQLWEGSTECLVVFPDGVGILPWMVPGTDAIGQA TAQEMQKHSLVLWPFHGVFGSGPTLDETFGLIDTAEKSAQVLVKVYSMG GMKQTISREELIALGKRFGVTPLASALAL .sup.F88/C98RhuA Sequence (SEQ ID NO: 5): MQNITQSWFVQGMIKATTDAWLKGWDERNGGNLTLRLDDADIAPYHDNF HQQPRYIPLSQPMPLLANTPFIVTGSGKFFRNVQLDPAFNLGIVKVDSC GAGYHILWGLTNEAVPTSELPAHFLSHSERIKATNGKDRVIMHCHATNL IALTYVLENDTAVFTRQLWEGSTECLVVFPDGVGILPWMVPGTDAIGQA TAQEMQKHSLVLWPFHGVFGSGPTLDETFGLIDTAEKSAQVLVKVYSMG GMKQTISREELIALGKRFGVTPLASALAL
Example 2-Protein Expression and Purification
(153) Bacterial expression of RhuA variants was performed according to previously published procedures with slight modifications (M. Kroemer, G. E. Schulz, Acta Cryst. D 58, 824 (2002)). Plasmids bearing the variants were transformed into BL21(DE3) E. coli cells, and the colonies were grown overnight at 37° C. on lysogeny broth (LB) agar plates (pH 7.4) containing 100 mg/L ampicillin. Starter cultures (5 mL with 100 mg/L ampicillin) from single colonies were grown for ˜4-6 h at 37° C. (with shaking at 250 rpm) before inoculation into 1-L LB cultures containing 100 mg/L ampicillin. After the cells were grown to an optical density of ˜0.8 at 600 nm, protein expression was induced with 1 mM isopropyl β-D-1-thiogalactopyranoside (IPTG, Gold Biotechnology) for 12-13 h (at 37° C. with shaking at 250 rpm). Cells were pelleted by centrifugation (5,000 rpm at 4° C. for 10 min), and resuspended in a buffer solution containing 10 mM Tris(hydroxymethyl)aminomethane hydrochloride (TRIS) (pH 7.5), 1 mM ZnCl.sub.2, and 10 mM β-mercaptoethanol (βME). For .sup.H63/H98RhuA preparations, ZnCl.sub.2 was excluded from buffer solutions to avoid possible protein precipitation during purification. Cell lysis was performed by sonication for 15 min on ice. The lysis solution was centrifuged for 30 min at 12,000 rpm at 4° C. Polymin-P (Acros) was added to the supernatant at a final concentration of 0.15% (w/v) for nucleic acid precipitation and the resulting mixture was stirred for 30 min prior to centrifugation for 30 min at 12,000 rpm at 4° C. The supernatant was loaded onto a DEAE-Sepharose CL-6B (GE Healthcare) column and eluted using a gradient of 0-500 mM NaCl in Tris buffer at 4° C. Fractions containing RhuA which eluted at ˜200 mM NaCl were added 1.7 M ammonium sulfate, and were centrifuged for 45 min at 12,000 rpm at 4° C. The precipitate was dissolved in a buffer solution containing 5 mM sodium phosphate (NaPi) (pH 7.2), 1 mM ZnCl.sub.2, and 10 mM βME, and then dialyzed three times against 5 L of the same buffer solution. Further purification was done using either a High Q cartridge column (BioRad) (at pH 8.0) using a 0-500 mM NaCl gradient or a Mini CHT™ Type I hydroxyapatite column (BioRad) (at pH 7.2) using a 5-500 mM NaPi gradient on a DuoFlow fast protein chromatography workstation (Bio-Rad). Pure protein fractions eluted at 350 mM NaCl and 200 mM NaPi, respectively. These fractions were combined, dialyzed three times against a buffer solution of 10 mM TRIS (pH 7.5), 1 mM ZnCl.sub.2, and 10 mM β-mercaptoethanol (βME), and concentrated in an Amicon stirred cell at 4° C. The protein was then flash frozen and kept at −80° C. until use. Protein purity was confirmed by SDS-PAGE (
(154) Purification techniques can be performed using standard protein purification kits, columns, and methods and are known to those skilled in the art. In some embodiments described herein, the polypeptides or proteins purified for use in creating the 2D crystalline material is purified to a purity of 80%, 85%, 90%, 95% or 100% purity or any percent purity in between a range defined by any two aforementioned values.
Example 3-Preparation of 2D RhuA Crystals
(155) All 2D RhuA crystals reported herein were obtained in an unsupported fashion in solutions. Several solution conditions were screened for optimizing the formation of 2D protein crystals of .sup.C98RhuA, .sup.F88/C98RhuA and .sup.H63/H98RhuA variants. For all variants, these screening conditions included various pH's (6 to 8), starting protein concentrations (25 to 175 μM), buffer salt concentration and identity (5-20 mM bis-TRIS, CHES, MES, MOPS, NaPi, and TRIS), and temperature (4-37° C.). In some embodiments, the polypeptides are screened for formation of 2D crystals in buffers that comprise a pH of 5, 5.5, 6, 6.5, 7, 7.5, 8 or 8.5 or any pH in between a range defined by any two aforementioned values. For the disulfide-mediated self-assembly of .sup.C98RhuA and .sup.F88/C98RhuA, various oxidizing conditions were additionally screened (1-2 mM total GSH/GSSG at ratios varying from 1:19 to 19:1, or 5-10 mM βME, which slowly decomposed in aqueous solution in the presence of metal ions). For the metal-mediated assembly of .sup.H63/H98RhuA, 4-20 molar equivalents (over protein concentration) of ZnCl.sub.2 and CuCl.sub.2 were screened. As stated, in some of the embodiments herein, the best conditions were: .sup.C98RhuA and .sup.F88/C98RhuA (≥125 μM protein, 10 mM βME, pH 7.5, 10 mM TRIS); .sup.H63/H98RhuA (25 μM protein, 200 mM ZnCl.sub.2, pH 7, 20 mM MOPS) at 4° C. In general, the formation of crystals was either immediate (upon metal addition for .sup.H63/H98RhuA) or lasted overnight to several days (for .sup.C98RhuA and .sup.F88/C98RhuA). Crystal formation resulted in increasing cloudiness of the self-assembly solutions. The growth of .sup.C98RhuA crystals could be accelerated by gentle shaking (compare
Example 4-TEM Measurements and Image Processing
(156) For TEM sample preparation, 3-3.5 μL aliquots of crystal suspensions were applied onto a negatively glow-discharged carbon-coated Cu grids (Ted Pella, Inc), washed with Milli-Q water, and stained with 1% uranyl acetate at 4° C. Sample screening was preformed in an FEI Sphera transmission electron microscope equipped with a LaB.sub.6 electron gun at 200 keV and imaged on Gatan 2K.sup.2 CCD.
(157) Selected micrographs were each processed separately using the 2dx software package (B. Gipson, X. Zeng, Z. Y. Zhang, H. Stahlberg, J. Struct. Biol. 157, 64 (2007)) to determine 2D plane group lattice symmetry of each crystal, to calculate their unit cell dimensions and to generate a projection density map of each crystal. The estimated resolution limit of each image (between 15 and 30 Å) was assessed by visual inspection of its computed Fourier transform.
Example 5-Structural Modeling and Simulations
(158) Projected electron density maps were used as a reference in the visualization software UCSF Chimera (E. F. Pettersen et al., J. Comput. Chem. 25, 1605 (2004)) to determine the orientation of the RhuA molecules in each crystal. The atomic coordinates were extracted from the PDB entries 1OJR (C.sub.4-symmetric tetramer for .sup.C98RhuA and .sup.H63/H98RhuA) and 2UYU (D.sub.4-symmetric octamer for .sup.F88/C98RhuA) and placed manually to fit the position of one subunit in the observed projected density map. The orientation of the molecule was refined in an iterative manner by comparing the experimental density with the density simulated from a model of the unit cell, obtained as explained below.
(159) Simulated projected electron density maps were computed using Bsoft (lsbr.niams.nih.gov/bsoft) (J. B. Heymann, J. Struct. Biol. 133, 156 (2001)) and EMAN2 (blake.bcm.edu/emanwiki/EMAN2) (G. Tang et al., J. Struct. Biol. 157, 38 (2007)). Starting from the estimated position and orientation of a single subunit, multiple copies of the model were generated to cover one unit cell (bmoledit in Bsoft) and converted to electron density (e2pdb2mrc.py in EMAN2) with a resolution limit of 30 Å. Finally, the density volume was projected along the vertical direction (bproject in Bsoft) to generate a 2D density map comparable to the experimental map.
Example 6—Classification of the Conformational States of 2D .SUP.C98.RhuA Crystals
(160) TEM micrographs of .sup.C98RhuA crystals were analyzed computationally to categorize different conformational states of the 2D lattice. Essentially, for each raw image it was determined a roundness index number derived from the shape of the pores in the lattice, and used this value to classify the images. The analysis was performed using an ad hoc algorithm coded as a macro in Fiji (fiji.sc/Fiji) (J. Schindelin et al., Nat. Meth. 9, 676 (2012)) and ImageJ (imagej.nih.gov/ij/) (C. A. Schneider, W. S. Rasband, K. W. Eliceiri, Nat. Methods 9, 671 (2012)). Each image was initially processed by applying a 3×3 mean filter applied three times, and then it was converted to a binary image after automatic thresholding to segment out the pores. The mask was then filtered using the opening morphological operator to smooth the shape of the pores and to remove small outliers. Pores that were distorted from potential bending of the crystal in some regions of the field of view were discarded using their size for screening. For images acquired at a nominal magnification of ×50,000 and ×68,000 (calibrated pixel size=2.033 Å and 1.646 Å, respectively), only pores with areas that covered 500-1200 pixels were kept. The remaining pores were modeled as ellipses and their roundness index was determined as the ratio between the lengths of the major and the minor elliptical axes. A single index value was assigned to each micrograph as the average from all the segmented pores. The images were assigned to one of the seven identified states using the following criterion: State I: >0.85; State II: >0.75-0.85; State III: >0.65-0.75; State IV: >0.55-0.65; State V: >0.35-0.45; State VI: >0.35-0.45; State VII<0.35.
(161) TABLE-US-00003 TABLE 2 List of primers used in constructing site-directed mutants of RhuA using C98RhuA as a base. Variant Mutation Primer Sequence .sup.F88/C98RhuA A88F 5′-CGCAATGTCCAGTTGGACCCA GCGTTTAACCTGGGCATTGTTAAG GTGG-3′ (SEQ ID NO: 6) 5′-CCACCTTAACAATGCCCAGGT TAAACGCTGGGTCCAACTGGACAT TGCG-3′ (SEQ ID NO: 7) .sup.H63/H98RhuA P63H 5′-CGCTGAGCCAGCCGATGCATC TGTTGGCGAATACCC-3′ (SEQ ID NO: 8) C98H 5′-GGGTATTCGCCAACAGATGCA TCGGCTGGCTCAGCG-3′ (SEQ ID NO: 9) 5′-GGGCATTGTTAAGGTGGATAG CCATGGTGCAGGTTACCACATC C-3′ (SEQ ID NO: 10) 5′-GGATGTGGTAACCTGCACCAT GGCTATCCACCTTAACAATGCC C-3′ (SEQ ID NO: 11)
(162) TABLE-US-00004 TABLE 3 Positive ESI-MS characterization of RhuA mutants. For the actual mass spectra, refer to FIG. 14. Variant Calculated Mass (Da) Observed Mass (Da) .sup.C98RhuA 30059.5 30060.0 .sup.F88/C98RhuA 30135.6 30136.0 .sup.H63/H98RhuA 30133.5 30134.0
(163) Two-dimensional (2D) crystalline materials possess unique structural, mechanical, and electronic properties (Mas-Balleste, R., Gomez-Navarro, C., Gomez-Herrero, J. & Zamora, F. 2D materials: to graphene and beyond. Nanoscale 3, 20-30, (2011); Butler, S. Z. et al. Progress, challenges, and opportunities in two-dimensional materials beyond graphene. ACS Nano 7, 2898-2926, (2013)), which have rendered them highly attractive in many applications (Schedin, F. et al. Detection of individual gas molecules adsorbed on graphene. Nat. Mater. 6, 652-655, (2007); Lu, C.-H., Yang, H.-H., Zhu, C.-L., Chen, X. & Chen, G.-N. A Graphene Platform for Sensing Biomolecules. Angew. Chem. Int. Ed. Engl. 121, 4879-4881, (2009); Joshi, R. K. et al. Precise and Ultrafast Molecular Sieving Through Graphene Oxide Membranes. Science 343, 752-754, (2014)). Although there have been advances in preparing 2D materials that consist of one or few atomic/molecular layers (Nicolosi, V., Chhowalla, M., Kanatzidis, M. G., Strano, M. S. & Coleman, J. N. Liquid exfoliation of layered materials. Science 340, 1226419, (2013); Li, D., Muller, M. B., Gilje, S., Kaner, R. B. & Wallace, G. G. Processable aqueous dispersions of graphene nanosheets. Nat. Nano. 3, 101-105, (2008)), bottom-up assembly of 2D crystalline materials remains a considerable challenge and an active area of development (Colson, J. W. et al. Oriented 2D covalent organic framework thin films on single-layer graphene. Science 332, 228-231, (2011; Kissel, P., Murray, D. J., Wulftange, W. J., Catalano, V. J. & King, B. T. A nanoporous two-dimensional polymer by single-crystal-to-single-crystal photopolymerization. Nat. Chem. 6, 774-778, (2014); Kory, M. J. et al. Gram-scale synthesis of two-dimensional polymer crystals and their structure analysis by X-ray diffraction. Nat. Chem. 6, 779-784, (2014)). Even more challenging is the design of dynamic 2D lattices that can undergo large-scale motions without loss of crystallinity. Dynamicity in porous 3D crystalline solids has been exploited for stimuli-responsive functions and adaptive behavior (Shimomura, S. et al. Selective sorption of oxygen and nitric oxide by an electron-donating flexible porous coordination polymer. Nat. Chem. 2, 633-637, (2010); Rabone, J. et al. An adaptable peptide-based porous material. Science 329, 1053-1057, (2010); Serre, C. et al. Role of solvent-host interactions that lead to very large swelling of hybrid frameworks. Science 315, 1828-1831, (2007)). As in the case of such 3D materials, integrating flexibility/adaptiveness into crystalline 2D lattices would greatly broaden the functional scope of 2D materials. As described herein is the self-assembly of unsupported, 2D protein lattices with precise spatial arrangements and patterns through a readily accessible design strategy. Three single- or double-point mutants of the C.sub.4 symmetric protein RhuA were designed to assemble via different modes of intermolecular interactions (single disulfide, double disulfide and metal coordination) into crystalline 2D arrays. Owing to the flexibility of the single disulfide interactions, the lattices of one of the variants (.sup.C98RhuA) are essentially defect-free and undergo substantial but fully correlated changes in molecular arrangement, giving coherently dynamic 2D molecular lattices. Notably, .sup.C98RhuA lattices possess a Poisson's ratio of −1, the lowest thermodynamically possible value for an isotropic material. In some of the embodiments described herein, the 2D crystalline material comprises a Poisson's ratio of −1.
(164) Proteins are attractive building blocks for 2D materials because of their structural/chemical diversity and inherent functions. Examples for natural, protein-based 2D materials can include, but are not limited to bacterial S-layer proteins and purple-membrane assemblies, which form crystalline arrays in association with cell walls and membranes, respectively, and have been employed in diverse technological applications (Sleytr, U. B., Schuster, B., Egelseer, E. M. & Pum, D. S-layers: principles and applications. FEMS Microbiol. Rev. 38, 823-864, (2014), Hampp, N. Bacteriorhodopsin as a photochromic retinal protein for optical memories. Chem. Rev. 100, 1755-1776, (2000)). On the synthetic front, methods for 2D protein crystallization have been developed for the structural characterization of membrane proteins (Engel, A. et al. Assembly of 2-D membrane protein crystals: dynamics, crystal order, and fidelity of structure analysis by electron microscopy. J. Struct. Biol. 109, 219-234, (1992); Stahlberg, H. et al. Two-dimensional crystals: a powerful approach to assess structure, function and dynamics of membrane proteins. FEBS Lett. 504, 166-172, (2001)) or functional applications (Saboe, P. O. et al. Two-Dimensional Protein Crystals for Solar Energy Conversion. Adv. Mater. 26, 7064-7069, (2014)), generally relying on lipid layers as supports. Recently, 2D or 3D supramolecular protein arrays have been designed through the symmetric polymerization of protein building blocks via computationally designed protein-protein interactions or fusion of protein components (Sinclair, J. C., Davies, K. M., Venien-Bryan, C. & Noble, M. E. M. Generation of protein lattices by fusing proteins with matching rotational symmetry. Nat. Nanotechnol. 6, 558-562, (2011); Brodin, J. D. et al. Metal-directed, chemically tunable assembly of one-, two- and three-dimensional crystalline protein arrays. Nat. Chem. 4, 375-382, (2012); Gonen, S., DiMaio, F., Gonen, T. & Baker, D. Design of ordered two-dimensional arrays mediated by noncovalent protein-protein interfaces. Science 348, 1365-1368, (2015); Lanci, C. J. et al. Computational design of a protein crystal. Proc. Natl. Acad. Sci. USA 109, 7304-7309, (2012)). While elegant, these approaches are engineering-intensive and highly dependent on the accuracy of the design, and the integration of dynamic/adaptive behavior has not been explored.
(165) In order to address these issues, described herein is a developed simple chemical bonding strategy to control protein self-assembly. It was reasoned that both cysteine (Cys)-mediated disulfide bonds and metal coordination interactions between protein building blocks can produce crystalline and dynamic arrays with minimal design, because these bonds are: 1) strong but reversible (to minimize the surface area to be designed and ensure self-healing), 2) short yet sufficiently flexible (to simultaneously afford crystallinity and adaptiveness), and 3) chemically tunable (to exert external control over self-assembly and enable stimuli-responsiveness), and 4) easily designed and engineered. In some embodiments described herein, cysteine (Cys)-mediated disulfide bonds and metal coordination interactions between protein building blocks can produce crystalline and dynamic arrays with minimal design. In some embodiments, the cysteine bonds are strong but flexible. In some embodiments, the cysteine bonds and metal coordination interactions are strong but flexible. In some embodiments, the bonds are short yet sufficiently flexible. In some embodiments, the bonds are chemically tunable. In some embodiments, the bonds are easily designed and engineered.
(166) The most straightforward route to obtaining 2D lattices is the tesselation of C.sub.3, C.sub.4 or C.sub.6 symmetric building blocks through appropriately positioned C.sub.2 symmetric linkages such as disulfide bonds or many metal coordination interactions. As such, as described in several embodiments herein, 2D lattices were produced by the methods herein to have C.sub.3, C.sub.4 or C.sub.6 symmetric building blocks through appropriately positioned C.sub.2 symmetric linkages such as disulfide bonds or many metal coordination interactions. As a model building block, L-rhamnulose-1-phosphate aldolase (RhuA), and a C.sub.4 symmetric homotetramer (dimensions: 7×7×5 nm) that was previously used as a synthon for supramolecular assemblies, were chosen (Ringler, P. & Schulz, G. E. Self-assembly of proteins into designed networks. Science 302, 106-109, (2003)) (
(167) For the oxidative self-assembly of .sup.C98RhuA and .sup.F88/C98RhuA, various strategies were tested including air oxidation, redox buffer systems containing reduced and oxidized glutathione (GSH and GSSG) or low concentrations (≤10 mM) of the reductant β-mercaptoethanol (βME), which slowly decomposes in aqueous solution and results in gradually more oxidizing conditions. In these experiments, solutions of purified .sup.C98RhuA and .sup.F88/C98RhuA were first rapidly exchanged via repeated centrifugal filtration into solutions that varied in terms of their pH (6 to 8.5), buffering species (sodium phosphate, CHES, MES, MOPS, TRIS; at 5 to 20 mM), different compositions of the redox buffering system (1:19 or 19:1 GSH:GSSG; at 1 mM total concentration) or different concentrations of βME (0-10 mM). After adjustment to the desired final protein concentration (25-175 μM), these solutions were monitored for the formation of self-assembled structures by visual inspection for emergence of cloudiness and by transmission electron microscopy (TEM). Likewise, for metal-directed assembly, purified .sup.H63/H98RhuA was exchanged into solutions with varying pH's and buffer ions (to modulate metal binding kinetics and thermodynamics), with the exception that these solutions did not contain any reductants. Self-assembly was initiated by addition of 4-40 molar equivalents of Zn.sup.2+ and Cu.sup.2+ (1-10 equiv. per bis-His motif), both of which can accommodate the desired four-coordinate geometries to link .sup.H63/H98RhuA building blocks at their corners.
(168) It was found that the assembly of all variants into 2D arrays was robust and occurred under a wide range of conditions. As expected, crystalline self-assembly was favored by conditions that promoted slow, controlled oxidation or slow metal-binding kinetics. For example, uncontrolled air oxidation of .sup.C98RhuA solutions or addition of large molar excess of Zn.sup.2+ and Cu.sup.2+ to .sup.H63/H98RhuA samples resulted largely in amorphous aggregates in addition to some crystalline domains (
(169) As monitored by TEM and dynamic light scattering (DLS), self-assembly of all variants was reversible, either upon addition of high concentrations of βME (>10 mM) in the case of .sup.C98RhuA and .sup.F88/C98RhuA crystals or ethylene-diaminetetraacetic acid (EDTA, >10 mM) in the case of .sup.H63/H98RhuA (
(170) Exhaustive TEM analyses involving many crystals of each variant indicated p42.sub.12 plane group symmetry for .sup.C98RhuA and .sup.F88/C98RhuA, and p4 symmetry for .sup.H63/H98RhuA crystals (
(171) Superior quality and larger sizes of .sup.C98RhuA crystals compared to .sup.F88/C98RhuA and .sup.H63/H98RhuA lattices are readily explained by interactions that direct the self-assembly of the variants. .sup.F88/C98RhuA presents a roughly circular distribution of eight cysteines (
(172) In contrast to .sup.F88/C98RhuA and .sup.H63/H98RhuA, self-assembly of .sup.C98RhuA is both chemically and orientationally specific. Moreover, the reversibility and inherent flexibility of single Cys-Cys linkages—containing five rotatable bonds—likely allows for the correction of any defects such as vacancies and grain boundaries, which would be difficult to accomplish in a rigid lattice composed of strongly interacting building blocks such as .sup.F88/C98RhuA. Indeed, as TEM images of mono-layered .sup.C98RhuA crystals illustrate, the outcomes are a) macroscopic crystal morphologies that reflect the molecular symmetry of the building blocks, b) molecularly sharp crystal boundaries, and c) lattices with extremely low defect frequencies. In hundreds of monocrystalline .sup.C98RhuA lattices with surface areas >1 μm.sup.2 that were examined closely, a lattice defect was rarely found, despite the fact that these crystals grow in 3D space in an unsupported fashion. Even in a rare instance such as that shown in
(173) A more striking consequence of the disulfide bond flexibility is the coherent dynamicity of .sup.C98RhuA crystals. While the initial sample preparations of .sup.C98RhuA crystals predominantly yielded open lattices with large pores (
(174) TABLE-US-00005 TABLE 4 Structural parameters for conformations II, V and VII of C98RhuA crystals derived from images shown in FIG. 12(A-F). State II State V State VII Unit cell (a = b, γ) 114.4 Å, 90° 110 Å, 90° 107.8 Å, 90° Plane-group symmetry p42.sub.12 p42.sub.12 p42.sub.12 Intertetramer hinge 79° 49° 17° angle, α Protein surface area per 82.7 nm.sup.2 86.2 nm.sup.2 88.0 nm.sup.2 unit cell, A.sub.protein Pore surface area per 44.7 nm.sup.2 34.7 nm.sup.2 28.2 nm.sup.2 unit cell, A.sub.pore Relative protein/pore 1.9 2.5 3.1 density, A.sub.protein/A.sub.pore
(175) Conformational dynamics of .sup.C98RhuA crystals are fully coherent: in each crystal examined, only one type of conformational state (I-VII) was observed throughout the lattice (
(176) To establish that the conformational dynamics of .sup.C98RhuA crystals are reversible, the .sup.C98RhuA crystals were subjected to repeated sedimentation/resuspension cycles within the solutions in which they self-assembled at 4° C. In each cycle, TEM images of >100 individual crystals from the same container were obtained, collected either a) from the sediments that formed overnight, or b) from the suspensions immediately after mixing the sediments by repeated pipetting. As shown in
(177) Geometric considerations based on the retention of p42.sub.12 symmetry (
(178)
where −1≤ν≤0.5 for an isotropic 3D material and −1≤ν≤1 for an isotropic 2D material (Grima, J., Alderson, A. & Evans, K. Auxetic behaviour from rotating rigid units. Phys. Stat. Sol. b 242, 561-575, (2005)). Most materials possess positive ν's, i.e., they become thinner in the longitudinal direction when stretched transversely (Greaves, G. N., Greer, A., Lakes, R. & Rouxel, T. Poisson's ratio and modern materials. Nat. Mater. 10, 823-837, (2011)). Materials with negative ν's (i.e., auxetic materials), in contrast, display the counterintuitive behavior of longitudinal expansion upon transverse stretching. Thus, auxetic materials can be expected to possess enhanced toughness, resistance to indentation and shear stiffness as well as favorable damping and acoustic response, and have been proposed for use in protective armors, smart textiles, actuated filtration, piezoelectric and biomedical devices (Greaves, G. N., Greer, A., Lakes, R. & Rouxel, T. Poisson's ratio and modern materials. Nat. Mater. 10, 823-837, (2011); Evans, K. E. & Alderson, A. Auxetic materials: functional materials and structures from lateral thinking! Adv. Mater. 12, 617-628, (2000); Baughman, R. H. Auxetic materials: Avoiding the shrink. Nature 425, 667-667, (2003); Scarpa, F., Ciffo, L. & Yates, J. Dynamic properties of high structural integrity auxetic open cell foam. Smart Mat. Struct. 13, 49, (2004)). Although materials with negative ν's exist, most fall in the range of −0.4<ν<0, with lowest reported values of −0.7 to −0.8 observed in reentrant foams (Lakes, R. Foam structures with a negative Poisson's ratio. Science 235, 1038-1040, (1987); Choi, J. B. & Lakes, R. S. Non-linear properties of metallic cellular materials with a negative Poisson's ratio. J. Mater. Sci. 27, 5375-5381, (1992)). Grima et al. postulated that for a 2D lattice of rotating rigid squares with flexible hinges, ν should be equal to the lowest thermodynamically permissible value of −1 at all rotation angles (Grima, J., Alderson, A. & Evans, K. Auxetic behaviour from rotating rigid units. Phys. Stat. Sol. b 242, 561-575, (2005)). .sup.C98RhuA lattices represent a true realization of this theoretical model and represent the first isotropic material with ν=−1 designed and constructed at the molecular scale. Assuming Grima's model, it was calculated that .sup.C98RhuA crystals should shrink or expand simultaneously in x and y dimensions by at least 24% during the conversion between fully open (state I) and fully closed states (state VII) (
(179) It was envisioned that upon hierarchical assembly through physical methods or incorporation into polymeric materials through chemical strategies, molecular architectures like 2D .sup.C98RhuA lattices may be used as feedstocks for adaptive and auxetic macroscopic materials. In general, in some embodiments described herein, this study underscores the utility of dynamic covalent bonds in the construction of highly ordered yet adaptive protein materials. Specifically, due to their high structural quality and chemically tunable assembly under ambient conditions, .sup.C98RhuA crystals provide a unique medium for studying molecular self-assembly and crystallization as well as for investigating the energy landscape of lattice dynamics. The resulting understanding of structural dynamics at the nanoscale should greatly aid the fabrication of functional materials.
(180) More Alternatives
(181) Methods
Example 7: Design of RhuA Variants and Site-Directed Mutagenesis
(182) RhuA variants were designed as described in some of the embodiments herein, and were based on previously reported crystal structures (PDB ID: 1GT7.sup.23 for .sup.C98RhuA, .sup.H63/H98RhuA, .sup.D98RhuA, .sup.C133RhuA, and .sup.C266RhuA and PDB ID: 2UYU (Grueninger, D. et al. Designed protein-protein association. Science 319, 206-209, (2008)) for .sup.F88/C98RhuA. All RhuA variants also contain the mutations E192A and C126S as previously reported (Ringler, P. & Schulz, G. E. Self-assembly of proteins into designed networks. Science 302, 106-109, (2003); Grueninger, D. et al. Designed protein-protein association. Science 319, 206-209, (2008)). The gene for .sup.C98RhuA, pre-inserted into the pJ414 expression vector optimized for expression in E. coli, was purchased from DNA2.0. .sup.F88/C98RhuA, .sup.H63/H98RhuA, .sup.D98RhuA, .sup.C133RhuA, and .sup.C266RhuA were prepared using QuikChange mutagenesis (Stratagene) with primers obtained from Integrated DNA Technologies (Table 5). The mutant plasmids were transformed into XL-1 Blue E. coli cells followed by purification using the QIAprep Spin Miniprep kit (Qiagen). The presence of the mutations was verified by sequencing (Retrogen). Amino acid sequences of RhuA variants are shown in Table 6.
(183) TABLE-US-00006 TABLE 5 List of primers used in constructing site-directed mutants of RhuA using .sup.C98RhuA as a base. Variant Mutation Primer Sequence .sup.F88/C98RhuA A88F 5′-CGCAATGTCCAGTTGGACCCAG CGTTTAACCTGGGCATTGTTAAGGT GG-3′ (SEQ ID NO: 6) 5′-CCACCTTAACAATGCCCAGGTT AAACGCTGGGTCCAACTGGACATTG CG-3′ (SEQ ID NO: 7) .sup.H63/H98RhuA P63H 5′-CGCTGAGCCAGCCGATGCATCT GTTGGCGAATACCC-3′ (SEQ ID NO: 8) C98H 5′-GGGTATTCGCCAACAGATGCAT CGGCTGGCTCAGCG-3′ (SEQ ID NO: 9) 5′-GGGCATTGTTAAGGTGGATAGC CATGGTGCAGGTTACCACATCC-3′ (SEQ ID NO: 10) 5′-GGATGTGGTAACCTGCACCATG GCTATCCACCTTAACAATGCCC-3′ (SEQ ID NO: 11) .sup.D98RhuA C98D 5′-GCATTGTTAAGGTGGATAGCGA CGGTGCAGGTTACCACATCC-3′ (SEQ ID NO: 13) 5′-GGATGTGGTAACCTGCACCGTC GCTATCCACCTTAACAATGC-3′ (SEQ ID NO: 14) .sup.C133RhuA N133C 5′-GCGAGCGTATCAAGGCGACCTG CGGCAAAGACCGCG-3′ (SEQ ID NO: 15) 5′-CGCGGTCTTTGCCGCAGGTCGC CTTGATACGCTCGC-3′ (SEQ ID NO: 16) .sup.C266RhuA T266C 5′-GGTAAGCGTTTTGGTGTCTGTC CGCTGGCGTCCGCGCTGG-3′ (SEQ ID NO: 17) 5′-CCAGCGCGGACGCCAGCGGACA GACACCAAAACGCTTACC-3′ (SEQ ID NO: 18)
(184) TABLE-US-00007 TABLE 6 Amino acid sequences of RhuA variants. Variant Amino Acid Sequence .sup.C98RhuA MQNITQSWFVQGMIKATTDAWLKGWDERNGGNLTLRLDDADIAPYHDNFHQQPRYIPLSQ PMPLLANTPFIVTGSGKFFRNVQLDPAANLGIVKVDSCGAGYHILWGLTNEAVPTSELPA HFLSHSERIKATNGKDRVIMHCHATNLIALTYVLENDTAVFIRQLWEGSTECLVVFPDGV GILPWMVPGTDAIGQATAQEMQKHSLVLWPFHGVFGSGPTLDETFGLIDTAEKSAQVLVK VYSMGGMKQTISREELIALGKRFGVTPLASALAL (SEQ ID NO: 3) .sup.H63/H98RhuA MQNITQSWFVQGMIKATTDAWLKGWDERNGGNLTLRLDDADIAPYHDNFHQQPRYIPLSQ PMHLLANTPFIVTGSGKFFRNVQLDPAANLGIVKVDSHGAGYHILWGLINEAVPTSELPA HFLSHSERIKATNGKDRVIMHCHATNLIALTYVLENDTAVFTRQLWEGSTECLVVFPDGV GILPWMVPGTDAIGQATAQEMQKHSLVLWPFHGVFGSGPTLDETFGLIDTAEKSAQVLVK VYSMGGMKQTISREELIALGKRFGVTPLASALAL (SEQ ID NO: 4) .sup.F88/C98RhuA MQNITQSWFVQGMIKATTDAWLKGWDERNGGNLTLRLDDADIAPYHDNFHQQPRYIPLSQ PMPLLANTPFIVTGSGKFFRNVQLDPAFNLGIVKVDSCGAGYHILWGLTNEAVPTSELPA HFLSHSERIKATNGKDRVIMHCHATNLIALTYVLENDTAVFTRQLWEGSTECLVVFPDGV GILPWMVPGTDAIGQATAQEMQKHSLVLWPFHGVFGSGPTLDETFGLIDTAEKSAQVLVK VYSMGGMKQTISREELIALGKRFGVTPLASALAL (SEQ ID NO: 5) .sup.D98RhuA MQNITQSWFVQGMIKATTDAWLKGWDERNGGNLTLRLDDADIAPYHDNFHQQPRYIPLSQ PMPLLANTPFIVTGSGKFFRNVQLDPAANLGIVKVDSDGAGYHILWGLTNEAVPTSELPA HFLSHSERIKATNGKDRVIMHCHATNLIALTYVLENDTAVFTRQLWEGSTECLVVFPDGV GILPWMVPGTDAIGQATAQEMQKHSLVLWPFHGVFGSGPTLDETFGLIDTAEKSAQVLVK VYSMGGMKQTISREELIALGKRFGVTPLASALAL (SEQ ID NO: 19) .sup.C133RhuA MQNITQSWFVQGMIKATTDAWLKGWDERNGGNLTLRLDDADIAPYHDNFHQQPRYIPLSQ PMPLLANTPFIVTGSGKFFRNVQLDPAANLGIVKVDSDGAGYHILWGLTNEAVPTSELPA HFLSHSERIKATCGKDRVIMHCHATNLIALTYVLENDTAVFTRQLWEGSTECLVVFPDGV GILPWMVPGTDAIGQATAQEMQKHSLVLWPFHGVFGSGPTLDETFGLIDTAEKSAQVLVK VYSMGGMKQTISREELIALGKRFGVTPLASALAL (SEQ ID NO: 20) .sup.C266RhuA MQNITQSWFVQGMIKATTDAWLKGWDERNGGNLTLRLDDADIAPYHDNFHQQPRYIPLSQ PMPLLANTPFIVTGSGKFFRNVQLDPAANLGIVKVDSDGAGYHILWGLTNEAVPTSELPA HFLSHSERIKATNGKDRVIMHCHATNLIALTYVLENDTAVFIRQLWEGSTECLVVFPDGV GILPWMVPGTDAIGQATAQEMQKHSLVLWPFHGVFGSGPTLDETFGLIDTAEKSAQVLVK VYSMGGMKQTISREELIALGKRFGVCPLASALAL (SEQ ID NO: 21) Point mutation positions are underlined.
Example 8 Protein Expression and Purification
(185) Bacterial expression of RhuA variants was performed according to previously published procedures with slight modifications (Kroemer, M. & Schulz, G. E. The structure of L-rhamnulose-1-phosphate aldolase (class II) solved by low-resolution SIR phasing and 20-fold NCS averaging. Acta Cryst. D. 58, 824-832, (2002)). Plasmids bearing the variants were transformed into BL21(DE3) E. coli cells, and the colonies were grown overnight at 37° C. on lysogeny broth (LB) agar plates (pH 7.4) containing 100 mg/L ampicillin. Starter cultures (5 mL with 100 mg/L ampicillin) from single colonies were grown for ˜4-6 h at 37° C. (with shaking at 250 rpm) before inoculation into 1-L LB cultures containing 100 mg/L ampicillin. After the cells were grown to an optical density of ˜0.8 at 600 nm, protein expression was induced with 1 mM isopropyl β-D-1-thiogalactopyranoside (IPTG, Gold Biotechnology) for 12-13 h (at 37° C. with shaking at 250 rpm). Cells were pelleted by centrifugation (5,000 rpm at 4° C. for 10 min), and resuspended in a buffer solution containing 10 mM Tris(hydroxymethyl)aminomethane hydrochloride (TRIS) (pH 7.5), 1 mM ZnCl.sub.2, and 10 mM β-mercaptoethanol (βME). For .sup.H63/H98RhuA preparations, ZnCl.sub.2 was excluded from buffer solutions to avoid possible protein precipitation during purification. Cell lysis was performed by sonication for 15 min on ice. The lysis solution was centrifuged for 30 min at 12,000 rpm at 4° C. Polymin-P (Acros) was added to the supernatant at a final concentration of 0.15% (w/v) for nucleic acid precipitation and the resulting mixture was stirred for 30 min prior to centrifugation for 30 min at 12,000 rpm at 4° C. The supernatant was loaded onto a DEAE-Sepharose CL-6B (GE Healthcare) column and eluted using a gradient of 0-500 mM NaCl in Tris buffer at 4° C. Fractions containing RhuA which eluted at ˜200 mM NaCl were added 1.7 M ammonium sulfate, and were centrifuged for 45 min at 12,000 rpm at 4° C. The precipitate was dissolved in a buffer solution containing 5 mM sodium phosphate (NaPi) (pH 7.2), 1 mM ZnCl.sub.2, and 10 mM βME, and then dialyzed three times against 5 L of the same buffer solution. Further purification was done using either a High Q cartridge column (BioRad) (at pH 8.0) using a 0-500 mM NaCl gradient or a Mini CHT Type I hydroxyapatite column (BioRad) (at pH 7.2) using a 5-500 mM NaPi gradient on a DuoFlow fast protein chromatography workstation (Bio-Rad). Pure protein fractions eluted at 350 mM NaCl and 200 mM NaPi, respectively. These fractions were combined, dialyzed three times against a buffer solution of 10 mM TRIS (pH 7.5), 1 mM ZnCl.sub.2, and 10 mM β-mercaptoethanol (βME), and concentrated in an Amicon stirred cell at 4° C. The protein was then flash frozen and kept at −80° C. until use. Protein purity was confirmed by SDS PAGE (
(186) TABLE-US-00008 TABLE 7 Molecular masses of RhuA mutants. For the actual mass spectra, refer to FIG. 14. Variant Calculated Mass (Da) Observed Mass (Da) .sup.C98RhuA 30059.5 30060.0 .sup.F88/C98RhuA 30135.6 30136.0 .sup.H63/H98RhuA 30133.5 30134.0 .sup.D98RhuA 30071.4 30075.0 .sup.C133RhuA 30060.4 30061.0 .sup.C266RhuA 30073.4 30073.0
(187) TABLE-US-00009 TABLE 8 Symmetry analysis for the 2D lattices of RhuA variants. Internal phase residuals for all possible non-hexagonal plane groups. Residuals were determined from the power spectra shown in FIG. 23A using the program ALLSPACE, as described in Methods. Reflections up to 11 Å and with IQ less than 6 were included in the calculations. 2D plane Phase Residual.sup.a Number of Target Residual.sup.b group (°) comparisons (°) a, .sup.C98RhuA p1 22.4.sup.c 126 p2 29.6* 63 32.5 p12_b 74.6 45 23.1 p12_a 73.8 45 23.1 p12.sub.1.sub.
Example 9: Preparation of 2D RhuA Crystals
(188) All 2D RhuA crystals reported herein were obtained in an unsupported fashion in solutions. As described in the in several embodiments herein, several solution conditions were screened for optimizing the formation of 2D protein crystals of .sup.C98RhuA, .sup.F88/C98RhuA and .sup.H63/H98RhuA variants. For all variants, these screening conditions included various pH's (6 to 8), starting protein concentrations (25 to 175 μM), buffer salt concentration and identity (5-20 mM bis-TRIS, CHES, MES, MOPS, NaPi, and TRIS), and temperature (4-37° C.). For the disulfide-mediated self-assembly of .sup.C98RhuA and .sup.F88/C98RhuA, various oxidizing conditions (1-2 mM total GSH/GSSG at ratios varying from 1:19 to 19:1, or 5-10 mM βME, which slowly decomposed in aqueous solution in the presence of metal ions) were additionally screened. For the metal-mediated assembly of .sup.H63/H98RhuA, 4-20 molar equivalents (over tetrameric protein concentration) of ZnCl.sub.2 and CuCl.sub.2 were screened. As stated previously, the best conditions were: .sup.C98RhuA and .sup.F88/C98RhuA (≥125 μM protein, 10 mM βME, pH 7.5, 10 mM TRIS); .sup.H63/H98RhuA (25 μM protein, 200 μM ZnCl.sub.2, pH 7, 20 mM MOPS) at 4° C. In general, the formation of crystals was either immediate (upon metal addition for .sup.H63/H98RhuA) or lasted overnight to several days (for .sup.C98RhuA and .sup.F88/C98RhuA). Crystal formation resulted in increasing cloudiness of the self-assembly solutions. The growth of .sup.C98RhuA crystals could be accelerated by gentle shaking (Figures=11A, 11B). In additional experiments, the thermo- and chemo-stability of .sup.C98RhuA crystals as shown in
Example 10: Electron Microscopy
(189) For negative-stain TEM sample preparation, 3-3.5 μL aliquots of crystal suspensions were applied onto negatively glow-discharged carbon-coated Cu grids (Ted Pella, Inc.), washed with Milli-Q water, and stained with 1% uranyl acetate at 4° C. For cryo-EM sample preparation, 3-3.5 μl aliquots of 25 .sup.C98RhuA sample (diluted sample) were deposited onto negatively glow-discharged Quantifoil grids, and then plunged into liquid ethane after blotting. The sample was then stored under liquid nitrogen until analysis. Sample screening was performed in an FEI Sphera transmission electron microscope equipped with a LaB6 electron gun at 200 keV and imaged on Gatan 2K.sup.2 CCD. A complete electron crystallographic analysis was done on 43, 50 and 33 micrographs for .sup.C98RhuA, .sup.H63/H98RhuA and .sup.F88/C98RhuA respectively, which were selected by visual assessment. Micrographs were each processed separately using the 2dx software.sup.33, which implements a semi-automatic processing pipeline mostly based on programs from the MRC suite (Crowther, R., Henderson, R. & Smith, J. MRC image processing programs. J. Struct. Biol. 116, 9-16, (1996)). The program allows one to determine the 2D plane group lattice symmetry of each crystal, to calculate its unit cell dimensions and to generate a projection density map. The processing involves estimation of the Contrast Transfer Function (CTF) by CTFFIND3 (Mindell, J. A. & Grigorieff, N. Accurate determination of local defocus and specimen tilt in electron microscopy. J. Struct. Biol. 142, 334-347, (2003)), spot-list determination, automatic lattice determination, crystal masking, unbending and generation of projection map after CTF correction. Within this program, the symmetry plane group is determined using ALLSPACE (Valpuesta, J. M. a., Carrascosa, J. L. & Henderson, R. Analysis of electron microscope images and electron diffraction patterns of thin crystals of Ø29 connectors in ice. J. Mol. Biol. 240, 281-287, (1994)) by comparing the internal phase residual for each symmetry to its expected value. Lattice unit cell dimensions were determined on a subset of images, screened by the quality of the reflections, of 12, 44 and 13 for .sup.C98RhuA, .sup.H63/H98RhuA and .sup.F88/C98RhuA, respectively. The estimated resolution limit of each image (between 15 and 30 Å) was assessed both by visual inspection of its computed Fourier transform and by comparison with simulated images filtered at different levels of resolution.
Example 11: AFM Measurements
(190) For AFM sample preparation, 2 μL of crystal suspensions were applied on freshly cleaved mica, washed with deionized water and dried. AFM images were collected using a Dimension Icon microscope (Bruker, USA) using Scan Asyst peak force tapping (in air) mode at a resolution of 512 lines per image and a scan rate of 0.3-0.5 Hz. AFM images obtained were processed using Nanoscope Analysis (Bruker, USA).
Example 12: SEM Measurements
(191) For SEM sample preparation, 2 μL of crystal suspensions were applied onto SiO.sub.2 substrates. Sample was sputter-coated with iridium oxide before analysis to reduce charging effects. SEM micrographs were collected on an FEIXL 30UHR scanning electron microscope operated at 5 keV.
Example 13: DLS Measurements
(192) DLS experiments were performed using Wyatt DynaPro NanoStar instrument. The experiment runs were performed to collect 10 acquisitions with 657 nm excitation at a power setting of 100%. Measurements were plotted using a Rayleigh sphere model. Peak radius cutoffs were fixed according to default settings (0.5-10000 nm).
Example 14: Structural Modelling and Simulations
(193) Projected electron density maps were used as a reference in the visualization software UCSF Chimera (Pettersen, E. F. et al. UCSF Chimera—a visualization system for exploratory research and analysis. J. Comput. Chem. 25, 1605-1612, (2004)) to determine the orientation of the RhuA molecules in each crystal. The atomic coordinates were extracted from the PDB entries 1GT7 (C.sub.4-symmetric tetramer for .sup.C98RhuA and .sup.H63/H98RhuA) and 2UYU (D.sub.4-symmetric octamer for .sup.F88/C98RhuA) and placed manually to fit the position of one subunit in the observed projected density map. The orientation of the molecule was refined in an iterative manner by comparing the experimental density with the density simulated from a model of the unit cell, obtained as explained below. Simulated projected electron density maps were computed using Bsoft (lsbr.niams.nih.gov/bsoft) (Heymann, J. B. Bsoft: image and molecular processing in electron microscopy. J. Struct. Biol. 133, 156-169, (2001)) and EMAN2 (blake.bcm.edu/emanwiki/EMAN2) (Tang, G. et al. EMAN2: an extensible image processing suite for electron microscopy. J. Struct. Biol. 157, 38-46, (2007)). Software for calculating projected electron density maps are readily available and are known to those skilled in the art. Starting from the estimated position and orientation of a single subunit, multiple copies of the model were generated to cover one unit cell (bmoledit in Bsoft) and converted to electron density (e2pdb2mrc.py in EMAN2) with a resolution limit of 30 Å. Finally, the density volume was projected along the vertical direction (bproject in Bsoft) to generate a 2D density map comparable to the experimental map.
Example 15: Classification of the Conformational States of 2D .SUP.C98.RhuA Crystals
(194) TEM micrographs of .sup.C98RhuA crystals were analyzed computationally to categorize different conformational states of the 2D lattice. Essentially, for each raw image a roundness index number derived from the shape of the pores in the lattice was determined, and used this value to classify the images. The analysis was performed on 982 images using an ad hoc algorithm coded as a macro in Fiji (fiji.sc/Fiji) (Schindelin, J. et al. Fiji: an open-source platform for biological-image analysis. Nat. Meth. 9, 676-682, (2012)) and ImageJ (imagej.nih.gov/ij) (Schneider, C. A., Rasband, W. S. & Eliceiri, K. W. NIH Image to ImageJ: 25 years of image analysis. Nat. Methods 9, 671-675, (2012)). Each image was initially processed by applying a 3×3 mean filter applied three times and then converted to a binary image after automatic thresholding to segment out the pores. The mask was then filtered using the opening morphological operator to smooth the shape of the pores and to remove small outliers. Pores that were distorted from potential bending of the crystal in some regions of the field of view were discarded using their size for screening. For images acquired at nominal magnifications of ×50,000 and ×68,000 (calibrated pixel size=2.033 Å and 1.646 Å, respectively), only pores with areas that covered 500-1200 pixels were kept. The remaining pores were modeled as ellipses and their roundness index was determined as the ratio between the lengths of the major and the minor elliptical axes. A single index value was assigned to each micrograph as the average from all the segmented pores. The images were assigned to one of the seven identified states using the following criterion: State I: >0.85; State II: >0.75-0.85; State III: >0.65-0.75; State IV: >0.55-0.65; State V: >0.35-0.45; State VI: >0.35-0.45; State VII<0.35.
Example 16: Generation of Video Simulating the Lattice Motions
(195) A video (Supplementary Video 1) to illustrate the dynamics of 2D .sup.C98RhuA crystals was generated starting from the TEM snapshots of the seven conformational states (I-VII) (
Example 17: Digital Image Correlation for Poisson's Value Determination
(196) Using Matlab, digital image processing of the reconstructed 2D TEM images of dynamic .sup.C98RhuA crystals for evaluating Poisson's ratios was performed. As a first step, histogram normalization was performed taking as a reference the image of conformational state I in order to normalize the intensity of the images (
(197)
and considering that the deformed and undeformed configurations can be related through the deformation gradient F:
(198)
Then, homogenized values of the engineering strains for the RVE can be calculated as:
(199)
Finally, the Poisson's ratio is calculated as:
(200)
Example 18
(201) Development of templating and growth of functionalities on .sup.C98RhuA crystals:C98 with meleimido Au. Monomaleimino Nanogold® at 6 nmol was used for staining instead of UA. (See
(202) As shown in
(203) As shown in
Example 19
(204) The results for making the C98-CD with HAuCl4 is shown in
(205) As shown in
Example 20: Investigation of New Connectivity's Via Covalent Modification of .SUP.C98.RhuA
(206) In order to broaden the connectivity of lattices, the covalent modifications of cysteine on .sup.C98RhuA were carried out, and their self-assemblies were tested via addition of Metals, Small Molecule, or Counter Partner.
Example 21: Addition of Functional Groups onto .SUP.c98.RhuA
(207) 500 uM .sup.C98RhuA was reduced with 18 eq TCEP for a hour followed by reaction with 20 eq of N-(1,10-Phenanthrolin-5-yl)iodoacetamide, dmco(cycloakyne)maleimide, or 4-phenylazomaleinanil in 10 mM Tris pH 7.5 with 5 DMF. Sample was dialyzed against 10 mM Tris (with 5 DMF if necessary) pH 7.5. .sup.dmco(cycloakyne)maleimidoC98RhuA was then reacted with 20 eq of mono-6-Azido-6-deoxy-beta-cyclodextrin followed by dialysis.
Example 22: Metal Directed Self-Assembly of .SUP.iPhen-C98.RhuA (and .SUP.iPhen-C133.RhuA)
(208) 2 eq of ZnCl.sub.2, CuCl.sub.2, or NiSO.sub.4 was mixed with 100 μM .sup.iPhenC98RhuA at pH 5.5 in 20 mM MES for 1 day (or as indicated) to assemble 2D crystals. Sample was deposited onto negatively glow-discharged carbon-coated Cu grids, washed with Milli-Q water at 4° C., and stained with 1% uranyl acetate at 4° C.
(209) .sup.C133RhuA (control) was also tested in this experiment. Even though .sup.C133RhuA could not form ordered array via disulfide bonds, .sup.iPhen-C133RhuA (modification of cysteines) was able to form crystals via metal directed assembly due to additional space between protein-protein interactions. (See
Example 23
(210) Small molecule (curcumin) directed self-assembly of .sup.CD-C98RhuA. 100 uM .sup.CD-C98RhuA was incubated with 1 mM or 5 mM curcumin (stock in DMF) in 10 mM TRIS pH 7.5 with 5 DMF at 4° C. for indicated time. Sample was deposited onto negatively glow-discharged carbon-coated Cu grids, washed with Milli-Q water at 4° C., and stained with 1% uranyl acetate at 4° C. (See
Example 24: Self-Assembly of .SUP.CD-C98.RhuA and .SUP.Azo-C98.RhuA
(211) 100 μM of .sup.CD-C98RhuA and .sup.Azo-C98RhuA was mixed for 1 day at 4° C. Sample was deposited onto negatively glow-discharged carbon-coated Cu grids, washed with Milli-Q water at 4° C., and stained with 1% uranyl acetate at 4° C. (
Example 25
(212) The 2D protein lattices can be modified with inorganic compounds as shown in
Example 26: 2D Protein Lattices can be Used as Templates for Inorganic Nanoparticle Growth
(213) C98-CD with HAuCl.sub.4. As shown in
Example 27: 2D Crystalline Structures can be Modified with Functional Groups. (FIGS. 34-53)
(214) As shown, 2D crystalline material comprising a polypeptide building block of any one of the alternatives described herein is provided. The polypeptide building block can comprise the non-naturally occurring symmetrical polypeptide building block described herein. The non-naturally occurring symmetrical polypeptide building block can comprise a plurality of cysteine residues positioned such that formation of disulfide bonds between some or all of said plurality of cysteine residues facilitates formation of 2D crystals. polypeptide building block comprises a symmetrical polypeptide comprising a single set of surface cysteine residues in the corner positions. In some embodiments, said polypeptide has inherent C3, C4, C6, D3, D4 or D6 symmetry. In some embodiments, at least one of said cysteine residues has been introduced into said polypeptide building block through genetic engineering. In some embodiments, said polypeptide is generated via solid phase synthesis. In some embodiments, said polypeptide is genetically engineered. In some embodiments, said polypeptide further comprises an additional modification, wherein said additional modification is selected from the group consisting of a chemical modification, a modification made via an enzymatic reaction, and a modification made via genetic engineering. In some embodiments, said additional modification is selected from the group consisting of functional groups, tags, other polypeptides, peptide tags, detectable labels, fluorophores, and nanoparticles. In some embodiments, said polypeptide comprises the RhuA protein. In some embodiments, the polypeptide building block can be chemically modified with inorganic nanoparticles. In some embodiments, the polypeptide building block can be modified with organic functional groups (fluorophores, metal chelating groups or host complexes) for different modes of controllable self-assembly. In some embodiments, the polypeptide building block can be genetically modified/fused with functional proteins and peptides. In some embodiments, said 2D crystalline material is auxetic. In some embodiments, wherein the 2D crystalline material can be assembled by visible light and dissembled by UV light. In some embodiments, the 2D crystalline material comprises a Poisson's ratio of at least −1. In some embodiments, the 2D crystalline material comprises a Poisson's ratio of −1. In some embodiments, the 2D crystalline material can be chemically modified with inorganic nanoparticles. In some embodiments, the 2D crystalline material can be modified with organic functional groups (fluorophores, metal chelating groups or host complexes) for different modes of controllable self-assembly. In some embodiments, the 2D crystalline material can be genetically modified/fused with functional proteins and peptides. The 2D crystalline material can be modified with maleimido AU and with the addition of HAuCl.sub.4. The 2D crystalline material can also be fused to a protein. In the alternatives shown in
(215) As shown in
(216) Protein assembly was also shown to be photoswitchable as seen in
(217) Furthermore, the 2D crystalline materials can be further modified in some embodiments by Bis-azobenzene and curcumin (See
Example 28: Genetic Fusions
(218) As described herein, the 2D crystalline structures or materials of any one of the embodiments described herein can be further modified by a point mutation of an extra cysteine, covalent modification of the lattices (metal chealtors, cyclodextran), as well as any genetic fusions. This can include a His tag, a Pd4Tag or manufacturing of a ACP fusion protein for use (
(219) As shown in
(220) As shown in
(221) Assembly of .sup.C98RhuA-Pd4 (125 μM) under various conditions (after 1 day w/shake) was also examined (
(222) Assembly of .sup.C98RhuA-Pd4 (125 μM) under various conditions (after 1 day w/shake) was also examined in the presence of beta mercaptoethanol and zinc chloride. (
(223) As shown in
Example 29: Addition of Functionalities onto .SUP.C98.RhuA Via Genetic Fusions
(224) To investigate the functionalities on .sup.C98RhuA crystals, genetically added HisTag, Pd4, or acyl carrier protein (ACP) at C-terminus of .sup.C98RhuA, and their self-assemblies via disulfide formation were tested accordingly. In addition, additional cysteine (C18 or C22) inside of cavity at .sup.C98RhuA for chemical handle was also tested, not for self-assembly. The gene for .sup.C98RhuA-HisTag, .sup.C98RhuA-Pd4, and .sup.C98RhuA-ACP based on .sup.C98RhuA were pre-inserted into the pJ414 expression vector optimized for expression in E. coli, was purchased from DNA2.0. Protein expression and purification was followed as of .sup.C98RhuA.
(225) Right after C98RhuA sequence, below sequence was added:
(226) TABLE-US-00010 .sup.C98RhuA-HisTag: (SEQ ID NO: 22) GSGSGHHHHHH (Linker-HisTag) (FIG. 55) .sup.C98RhuA-Pd4: (SEQ ID NO: 23) GSGSGTSNAVHPTLRHL (Linker-Pd4 peptide) (FIG. 58) .sup.C98RhuA-ACP: (SEQ ID NO: 24) GSGSGSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELV MALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA (Linker-ACP protein) (FIG. 59)
(227) Additional Cys onto .sup.C98RhuA: .sup.C18C98RhuA and .sup.C22C98RhUA (
(228) Several solution conditions were screened for optimizing the formation of 2D protein crystals of fusion proteins and best condition so far was indicated in figures.
(229) The disclosures of all references listed herein and each of the following references are incorporated herein by reference in their entireties:
REFERENCES
(230) U.S. Pat. No. 9,030,079 U.S. Publication No. 2011/0059291 U.S. Publication No. 2011/0156314 U.S. Publication No. 2015/0075033 WO 2010/070505 A2 Baker/King et al., Nature 2014, 510:103-108. Baneyx, F. & Matthaei, J. F. Curr. Opin. Biotech. 2014, 28:39. Baughman, R. H. Auxetic materials: Avoiding the shrink. Nature 2003, 425:667-667. Brodin, J. D. et al. Metal-directed, chemically tunable assembly of one-, two- and three-dimensional crystalline protein arrays. Nat. Chem. 2012, 4:375-382. Buehler, Nat. Nanotech., 2011 Butler, S. Z.; Hollen, S. M.; Cao, L.; Cui, Y.; Gupta, J. A.; Gutiérrez, H. R.; Heinz, T. F.; Hong, S. S.; Huang, J.; Ismach, A. F.; Johnston-Halperin, E.; Kuno, M.; Plashnitsa, V. V.; Robinson, R. D.; Ruoff, R. S.; Salahuddin, S.; Shan, J.; Shi, L.; Spencer, M. G.; Terrones, M.; Windl, W.; & Goldberger, J. E. Progress, Challenges, and Opportunities in Two-Dimensional Materials Beyond Graphene. ACS Nano 2013, 7:2898-2926. Choi, J. B. & Lakes, R. S. Non-linear properties of metallic cellular materials with a negative Poisson's ratio. J. Mater. Sci. 1992, 27:5375-5381. Colson, J. W. et al. Oriented 2D covalent organic framework thin films on single-layer graphene. Science 2011, 332:228-231. Colson, J. W.; Dichtel, W. R. Rationally synthesized two-dimensional polymers. Nat. Chem. 2013, 5:453-465. Crowther, R., Henderson, R. & Smith, J. MRC image processing programs. J. Struct. Biol. 1996, 116:9-16. Edelhoch, H. Spectroscopic determination of tryptophan and tyrosine in proteins. Biochemistry 1967, 6:1948-1954. Engel, A. et al. Assembly of 2-D membrane protein crystals: dynamics, crystal order, and fidelity of structure analysis by electron microscopy. J. Struct. Biol. 1992, 109:219-234. Evans, K. E. & Alderson, A. Auxetic materials: functional materials and structures from lateral thinking! Adv. Mater. 2000, 12:617-628. Geim, A. K., & Novoselov, K. S., Nat. Mater. 2007, 6:183. Gipson, B., Zeng, X., Zhang, Z. Y., & Stahlberg, H., J. Struct. Biol. 2007, 157:64. Gonen, S., DiMaio, F., Gonen, T. & Baker, D. Design of ordered two-dimensional arrays mediated by noncovalent protein-protein interfaces. Science 2015, 348:1365-1368. Greaves, G. N., Greer, A., Lakes, R. & Rouxel, T. Poisson's ratio and modern materials. Nat. Mater. 2011, 10:823-837. Grima, J., Alderson, A. & Evans, K. Auxetic behaviour from rotating rigid units. Phys. Stat. Sol. b 2005, 242:561-575. Grueninger, D. et al. Designed protein-protein association. Science 2008, 319:206-209. Hampp, N. Bacteriorhodopsin as a photochromic retinal protein for optical memories. Chem. Rev. 2000, 100:1755-1776. Heymann, J. B. Bsoft: image and molecular processing in electron microscopy. J. Struct. Biol. 2001, 133:156-169. Joshi, R. K. et al. Precise and Ultrafast Molecular Sieving Through Graphene Oxide Membranes. Science 2014, 343:752-754. King, N. P.; Sheffler, W.; Sawaya, M. R.; Vollmar, B. S.; Sumida, J. P.; Andro, I.; Gonen, T.; Yeates, T. O.; Baker, D. Computational Design of Self-Assembling Protein Nanomaterials with Atomic Level Accuracy. Science 2012, 336:1171-1174. Kissel, P., Murray, D. J., Wulftange, W. J., Catalano, V. J. & King, B. T. A nanoporous two-dimensional polymer by single-crystal-to-single-crystal photopolymerization. Nat. Chem. 2014, 6:774-778. Kory, M. J. et al. Gram-scale synthesis of two-dimensional polymer crystals and their structure analysis by X-ray diffraction. Nat. Chem. 2014, 6:779-784. Kroemer, M. & Schulz, G. E. The structure of L-rhamnulose-1-phosphate aldolase (class II) solved by low-resolution SIR phasing and 20-fold NCS averaging. Acta Cryst. D. 2002, 58:824-832. Kroemer, Biochemistry, Vol. 42 (2003), pp. 10560-10568, Structure and Catalytic Mechanism of L-Rhamnulose-1-phosphate Aldolase. Lai, Y.-T.; Cascio, D.; Yeates, T. O. Structure of a 16-nm Cage Designed by Using Protein Oligomers. Science 2012, 336:1129. Lakes, R. Foam structures with a negative Poisson's ratio. Science 1987, 235:1038-1040. Lanci, C. J.; MacDermaid, C. M.; Kang, S.-g.; Acharya, R.; North, B.; Yang, X.; Qiu, X. J.; DeGrado, W. F.; Saven, J. G. Computational design of a protein crystal. Proc. Natl. Acad. Sci. USA 2012, 109:7304-7309. Lebeau, L. et al., Two-dimensional crystallization of a membrane protein on a detergent-resistant lipid monolayer. J. Mol. Biol, 2001, 306:639-647. Li, D., Muller, M. B., Gilje, S., Kaner, R. B. & Wallace, G. G. Processable aqueous dispersions of graphene nanosheets. Nat. Nano. 2008, 3:101-105. Lu, C.-H., Yang, H.-H., Zhu, C.-L., Chen, X. & Chen, G.-N. A Graphene Platform for Sensing Biomolecules. Angew. Chem. Int. Ed. Engl. 2009, 121:4879-4881. Lukowski. M. A. et al., J. Am. Chem. Soc. 2013, 135:10274. Mas-Balleste, R., Gomez-Navarro, C., Gomez-Herrero, J. & Zamora, F. 2D materials: to graphene and beyond. Nanoscale 2011, 3:20-30. Mindell, J. A. & Grigorieff, N. Accurate determination of local defocus and specimen tilt in electron microscopy. J. Struct. Biol. 2003, 142:334-347. Nicolosi, V., Chhowalla, M., Kanatzidis, M. G., Strano, M. S. & Coleman, J. N. Liquid exfoliation of layered materials. Science 2013, 340:1226419. Pettersen, E. F. et al. UCSF Chimera—a visualization system for exploratory research and analysis. J. Comput. Chem. 2004, 25:1605-1612. Rabone, J. et al. An adaptable peptide-based porous material. Science 2010, 329:1053-1057. Ringler, P. & Schulz, G. E. Self-assembly of proteins into designed networks. Science 2003, 302:106-109. Saboe, P. O. et al. Two-Dimensional Protein Crystals for Solar Energy Conversion. Adv. Mater. 2014, 26:7064-7069. Scarpa, F., Ciffo, L. & Yates, J. Dynamic properties of high structural integrity auxetic open cell foam. Smart Mat. Struct. 2004, 13:49. Schedin, F. et al. Detection of individual gas molecules adsorbed on graphene. Nat. Mater. 2007, 6:652-655. Schindelin, J. et al. Fiji: an open-source platform for biological-image analysis. Nat. Meth. 2012, 9:676-682. Schneider, C. A., Rasband, W. S. & Eliceiri, K. W. NIH Image to ImageJ: 25 years of image analysis. Nat. Methods 2012, 9:671-675. Serre, C. et al. Role of solvent-host interactions that lead to very large swelling of hybrid frameworks. Science 2007, 315:1828-1831. Shimomura, S. et al. Selective sorption of oxygen and nitric oxide by an electron-donating flexible porous coordination polymer. Nat. Chem. 2010, 2:633-637. Sinclair, J. C.; Davies, K. M.; Venien-Bryan, C.; Noble, M. E. M. Generation of protein lattices by fusing proteins with matching rotational symmetry. Nat. Nanotechnol. 2011, 6:558-562. Sleytr, U. B., Schuster, B., Egelseer, E. M. & Pum, D. S-layers: principles and applications. FEMS Microbiol. Rev. 2014, 38:823-864. Stahlberg, H. et al. Two-dimensional crystals: a powerful approach to assess structure, function and dynamics of membrane proteins. FEBS Lett. 2001, 504:166-172. Suzuki, et al. Self-assembly of coherently dynamic, auxetic, two-dimensional protein crystals. Nature, 2016, 533:369-385. Tang, G. et al. EMAN2: an extensible image processing suite for electron microscopy. J. Struct. Biol. 2007, 157:38-46. Valpuesta, J. M. a., Carrascosa, J. L. & Henderson, R. Analysis of electron microscope images and electron diffraction patterns of thin crystals of 029 connectors in ice. J. Mol. Biol. 1994, 240:281-287. Uzgiris, E. & Kornberg, R. Two-dimensional crystallization technique for imaging macromolecules with application to antigen-antibody-complement complexes. Nature 1983, 301:125-129. Yeates, T. O. Nanobiotechnology: Protein arrays made to order. Nat. Nanotechnol. 2011, 6:541-542.