Methods and compositions for protein purification and enzyme reaction
11300567 · 2022-04-12
Assignee
Inventors
- Gregory A. Weiss (Irvine, CA, US)
- Joshua BRITTON (Irvine, CA, US)
- Colin L. Raston (South Australia, AU)
Cpc classification
C07K1/22
CHEMISTRY; METALLURGY
G01N2400/00
PHYSICS
C12Y302/01023
CHEMISTRY; METALLURGY
C12N11/00
CHEMISTRY; METALLURGY
C12N13/00
CHEMISTRY; METALLURGY
C12N9/96
CHEMISTRY; METALLURGY
International classification
C12N9/96
CHEMISTRY; METALLURGY
C12N13/00
CHEMISTRY; METALLURGY
C07K1/22
CHEMISTRY; METALLURGY
C12N11/00
CHEMISTRY; METALLURGY
Abstract
There are provided, inter alia, methods for reacting an enzyme and its substrate, methods for purifying a protein and an enzyme reactor and its use thereof.
Claims
1. A method for reacting an enzyme and a substrate in a solution, the method comprising: (i) combining the enzyme and the substrate of the enzyme in a solution in a tube reactor of a vortex fluid device to form a solution comprising an enzyme-substrate mixture; (ii) rotationally mixing the solution comprising the enzyme-substrate mixture at a speed from 4,000 rpm to 15,000 rpm in the tube reactor of the vortex fluid device; and (iii) applying a mechanical vibrational energy to the solution comprising the enzyme-substrate mixture in the tube reactor of the vortex fluid device, thereby reacting the enzyme and the substrate; wherein the tube reactor comprises a longitudinal axis and an inner cylindrical surface; wherein the tube reactor is rotatable about the longitudinal axis; wherein the tube reactor is held between an upper bearing and a lower bearing; and wherein the tube reactor has a tilt angle from 20 degrees to 90 degrees.
2. The method of claim 1, comprising rotationally mixing the solution comprising the enzyme-substrate mixture at a speed from 6,500 rpm to 9,000 rpm.
3. The method of claim 1, comprising rotationally mixing the solution comprising the enzyme-substrate mixture at a speed from 6,000 rpm to 10,000 rpm.
4. The method of claim 1, wherein rotationally mixing the solution comprising the enzyme-substrate mixture forms an enzyme-substrate mixture thin film, and wherein the mechanical vibrational energy produces a vibrational response within the enzyme-substrate mixture thin film.
5. The method of claim 4, wherein the vibrational response is a Faraday wave.
6. The method of claim 1, wherein the mechanical vibrational energy produces a harmonic vibrational frequency.
7. The method of claim 1, wherein the solution comprising the enzyme-substrate mixture further comprises at least one steric crowding agent.
8. The method of claim 1, wherein the enzyme is a water-soluble enzyme.
9. The method of claim 8, wherein the water-soluble enzyme is an esterase, a lipase, deoxyribose-5-phosphate aldolase, β-glucosidase, or an alkaline phosphatase.
10. The method of claim 1, wherein the method is conducted at atmospheric pressure and at room temperature.
11. The method of claim 1, wherein the tube reactor has a tilt angle of 45 degrees.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
(36)
(37)
(38)
(39)
(40)
(41)
(42)
(43)
(44)
(45)
(46)
(47)
(48)
(49)
(50)
(51)
(52)
(53)
(54)
(55)
(56)
(57)
(58)
(59)
(60)
(61)
(62)
(63)
(64)
DETAILED DESCRIPTION
(65) Definitions
(66) While various embodiments and aspects of the present invention are shown and described herein, it will be obvious to those skilled in the art that such embodiments and aspects are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein may be employed in practicing the invention.
(67) The section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described. All documents, or portions of documents, cited in the application including, without limitation, patents, patent applications, articles, books, manuals, and treatises are hereby expressly incorporated by reference in their entirety for any purpose.
(68) Unless defined otherwise, all technical and scientific terms used herein have the meaning commonly understood by a person skilled in the art to which this invention belongs. The following references provide one of skill with a general definition of many of the terms used in this invention: Singleton et al., Dictionary of Microbiology and Molecular Biology (2nd ed. 1994); The Cambridge Dictionary of Science and Technology (Walker ed., 1988); The Glossary of Genetics, 5th Ed., R. Rieger et al. (eds.), Springer Verlag (1991); and Hale & Marham, The Harper Collins Dictionary of Biology (1991). As used herein, the following terms have the meanings ascribed to them unless specified otherwise.
(69) The use of a singular indefinite or definite article (e.g., “a,” “an,” “the,” etc.) in this disclosure and in the following claims follows the traditional approach in patents of meaning “at least one” unless in a particular instance it is clear from context that the term is intended in that particular instance to mean specifically one and only one. Likewise, the term “comprising” is open ended, not excluding additional items, features, components, etc. References identified herein are expressly incorporated herein by reference in their entireties unless otherwise indicated.
(70) The terms “comprise,” “include,” and “have,” and the derivatives thereof, are used herein interchangeably as comprehensive, open-ended terms. For example, use of “comprising,” “including,” or “having” means that whatever element is comprised, had, or included, is not the only element encompassed by the subject of the clause that contains the verb.
(71) The term “combining” or “contacting” is used in accordance with its plain ordinary meaning and refers to the process of allowing at least two distinct species (e.g. chemical compounds including enzymes and their substrates) to become sufficiently proximal to react, interact or physically touch. It should be appreciated, however, that the resulting reaction product can be produced directly from a reaction between the added reagents or from an intermediate from one or more of the added reagents which can be produced in the reaction mixture.
(72) The term “covalently” or “covalent” means directly or through a covalently bonded intermediary via one or more chemical bonds that involve the sharing of electron pairs between atoms. The term “non-covalently” or “non-covalent” means interactions through ionic bond(s), van der Waal's bond(s)/interactions, hydrogen bond(s), polar bond(s), or combinations or mixtures thereof.
(73) The term “enzyme” refers to macromolecular biological catalysts. Enzymes accelerate, or catalyze, chemical reactions. The molecules at the beginning of the process upon which enzymes may act are called substrates and the enzyme converts these into different molecules, called products. Enzymes must bind their substrates before they can catalyze any chemical reaction. Enzymes are usually very specific as to what substrates they bind and then the chemical reaction catalyzed. Specificity is achieved by binding pockets with complementary shape, charge and hydrophilic/hydrophobic characteristics to the substrates. The composition (e.g., liquid composition) that includes an enzyme and its substrate is called an “enzyme-substrate mixture” used herein. In embodiments, the enzyme-substrate mixture is in a liquid form (e.g., a solution) and referred as a “liquid enzyme-substrate mixture.” In embodiments, the enzyme-substrate mixture is in a form of a gel, a hydrogel, or a paste. In embodiments, the enzyme is a water soluble enzyme. A “water soluble enzyme” is an enzyme that is able to be dissolved in a water-based liquid (an aqueous solvent or aqueous liquid).
(74) The term “mechanically mixing” refers to combining two or more substances to form one substance or mass by mechanical forces (such as rotating or spinning) The term “rotationally mixing” or “rotating” or “rotational mixing” means an action of spinning around an axis or center.
(75) The term “vibrational energy” as used herein refers to energy derived from a vibration (e.g. a mechanical vibration). In embodiments, the vibrational energy is a mechanical vibrational energy whereby oscillation occurs. In embodiments, the oscillations occur about an equilibrium point. In embodiments, the oscillations are periodic. Thus, the vibrational energy may be in the form of a wave that is generated by repetitive mechanical motions transmitted to the container/reactor (reaction vessel) used for the enzymatic reaction. The source of the vibration may be a machine, or components thereof, used to facilitate the enzymatic reaction. For example, the machine may be used to rotate the reaction vessel or to mechanically stir the contents of the reaction vessel.
(76) In embodiments, the mechanical mixing (e.g., rotation or spinning) of the container (reaction vessel) that is used for the enzymatic reaction forces the mixture of the enzyme and the substrate (e.g., a solution, a gel, a hydrogel or a paste) into a thin layer upon such mechanical mixing (e.g., rapid mechanical mixing). This thin layer is referred herein as a “thin film.” In embodiments, the thin film is about 50-500 μm in thickness (e.g., about 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195, 200, 205, 210, 215, 220, 225, 230, 235, 240, 245, 250, 255, 260, 265, 270, 275, 280, 285, 290, 295, 300, 305, 310, 315, 320, 325, 330, 335, 340, 345, 350, 355, 360, 365, 370, 375, 380, 385, 390, 395, 400, 405, 410, 415, 420, 425, 430, 435, 440, 445, 450, 455, 460, 465, 470, 475, 480, 485, 490, 495, 500 μm). In embodiments, the thin film is about 200-400 μm in thickness (e.g., about 200, 205, 210, 215, 220, 225, 230, 235, 240, 245, 250, 255, 260, 265, 270, 275, 280, 285, 290, 295, 300, 305, 310, 315, 320, 325, 330, 335, 340, 345, 350, 355, 360, 365, 370, 375, 380, 385, 390, 395, 400 μm). In embodiments, the thin film is about 200-300 μm in thickness (e.g., about 200, 205, 210, 215, 220, 225, 230, 235, 240, 245, 250, 255, 260, 265, 270, 275, 280, 285, 290, 295, 300 μm). Accordingly, an “enzyme-substrate mixture thin film” used herein refers to a thin film that includes the enzyme-substrate mixture described herein. The thin film may be a liquid, gel or paste. In embodiments, the thin film is a liquid.
(77) Faraday waves, also known as Faraday ripples, are nonlinear standing waves that appear on liquids enclosed by a vibrating receptacle (e.g., vibrating reaction vessel).
(78) “Harmonic vibrational frequency,” as used herein, refers to a frequency of vibrational energy (e.g. a vibrational wave) that is harmonic in nature. In embodiments, a given harmonic vibrational energy generates a vibrational response within the enzyme-substrate mixture (e.g. enzyme-substrate mixture thin film).
(79) The term “vibrational response” as used herein refers to an effect on the enzyme-substrate mixture caused by vibrational energy that results in a Faraday wave and/or an increase in enzyme functionality. In embodiments, the vibrational response is an increase in enzymatic activity of the enzyme, increase in turnover rate of the enzyme, increase in rate constant (k.sub.cat), increase in enzymatic efficiency (K.sub.cat/K.sub.m), and/or decrease in the reaction time relative to an enzymatic reaction conducted in the absence of the vibrational energy. Enzyme activity or enzymatic activity may be calculated as moles of substrate converted per unit time or is calculated as rate×reaction volume. Enzyme activity may be a measure of the quantity of active enzyme present and is thus dependent on conditions. The apparent unimolecular rate constant k.sub.cat is also called turnover number and denotes the maximum number of enzymatic reactions catalyzed per second. The term “reaction time” refers to the duration of a complete enzymatic reaction. Michaelis-Menten equation is the basis for most single-substrate enzyme kinetics. The Michaelis constant K.sub.M is experimentally defined as the concentration at which the rate of the enzyme reaction is half V.sub.max, which can be verified by substituting [S]=K.sub.m, into the Michaelis-Menten equation and can also be seen graphically. If the rate-determining enzymatic step is slow compared to substrate dissociation (k.sub.2<<k_1), the Michaelis constant K.sub.M is roughly the dissociation constant KD of the enzyme-substrate complex.
(80) The “tilt angle (θ)” used herein refers to the angle of the longitudinal axis relative to the horizontal axis of the container (or reactor or enzyme reactor) for enzymatic reactions (see, e.g.,
(81) The terms “polypeptide,” “peptide” and “protein” are used interchangeably herein to refer to a polymer of amino acid residues, wherein the polymer may in embodiments be conjugated to a moiety that does not consist of amino acids. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers.
(82) In embodiments, the mechanical mixing (e.g., rotation or spinning), such as rapid mechanical mixing of the reactor or enzyme reactor forces the protein binding material (e.g., materials that can covalently or non-covalently bind to the protein of interest) into a thin layer upon such mechanical mixing. This thin layer is referred herein as “protein binding film.” In embodiments, the film is about 50-500 μm in thickness (e.g., about 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195, 200, 205, 210, 215, 220, 225, 230, 235, 240, 245, 250, 255, 260, 265, 270, 275, 280, 285, 290, 295, 300, 305, 310, 315, 320, 325, 330, 335, 340, 345, 350, 355, 360, 365, 370, 375, 380, 385, 390, 395, 400, 405, 410, 415, 420, 425, 430, 435, 440, 445, 450, 455, 460, 465, 470, 475, 480, 485, 490, 495, 500 μm). In embodiments, the thin film is about 200-400 μm in thickness (e.g., about 200, 205, 210, 215, 220, 225, 230, 235, 240, 245, 250, 255, 260, 265, 270, 275, 280, 285, 290, 295, 300, 305, 310, 315, 320, 325, 330, 335, 340, 345, 350, 355, 360, 365, 370, 375, 380, 385, 390, 395, 400 μm). In embodiments, the thin film is about 200-300 μm in thickness (e.g., about 200, 205, 210, 215, 220, 225, 230, 235, 240, 245, 250, 255, 260, 265, 270, 275, 280, 285, 290, 295, 300 μm). Accordingly, a “protein binding film complex” used herein refers to a complex of protein of interest and the protein binding film, where the protein of interest is either covalently or non-covalently linked (bound) to the protein binding film.
(83) A “binding moiety” refers to a functional group that is covalently attached to the molecule. In embodiments, the binding moiety attached to the protein recognizes and binds to the binding partner attached to the protein binding film. In embodiments, the binding moiety used herein is a reactive moiety. As used herein, the term reactive moiety includes any group capable of reacting with another molecule, e.g., a nucleic acid or polypeptide through covalent, non-covalent or other interactions. By way of example, a polypeptide or a protein of interest can include an amino acid reactive moiety that reacts with a funtional group on another molecule through a covalent, non-covalent or other interaction (e.g., to form a disulfide bond, amide bond or click chemistry bond). In embodiments, the binding moiety used herein is an expression tag. The term “expression tag” is further defined below.
(84) A His-tag is a peptide moiety composed of 5-10 (e.g., 5, 6, 7, 8, 9 or 10) histidines capable of being used as a binding moiety. In embodiments, the His-tag is capable of binding to divalent nickel or divalent cobalt ligands.
(85) The term “reactor” as used herein refers to a device for containing a chemical reaction (e.g., an enzymatic reaction) or process (e.g., purifying a protein) (e.g. a reaction vessel). The term “enzyme reactor” refers to a reactor for containing an enzymatic reaction (e.g. enzyme reaction vessel). In embodiments, the reactor is a VFD or the like. In embodiments, an enzyme reactor is a VFD or the like.
(86) Methods
(87) Enzymes make life possible by catalyzing diverse and challenging chemical transformations with exquisite specificity. Applications in both industry and academia rely on the selectivity and power of enzymes to catalyze otherwise challenging transformations. Biocatalysts offer remarkable rate accelerations compared to uncatalyzed reactions, with typical rate accelerations (k.sub.cat/k.sub.uncat) of 10.sup.5- to 10.sup.15-fold faster. Though some enzymes are diffusion-limited, the catalytic rates of enzymes are often more typically limited by their catalytic efficiency (k.sub.cat/K.sub.m); additionally, molecular crowding, along with product and substrate inhibition, can reduce enzyme efficiency. Though some enzymes catalyze transformations with rapid rates (e.g., laccases, fumarases and alcohol dehydrogenases), other enzymes operate at only modest reaction rates, requiring long reaction times and carefully optimized conditions; for example, DERA requires long processing times (hours to days), and is substrate-inhibited. The methods described herein solve these and other problems in the field of accelerating enzymatic catalytic reactions. In embodiments, methods are provided that utilize the combination of mechanically mixing of the enzyme-substrate mixture and applying a vibrational energy to the mixture, therefore generating a vibrational response within the mixture and accelerating the enzymatic reactions.
(88) In a first aspect, there is provided a method for reacting an enzyme and a substrate. The method includes combining an enzyme and a substrate of the enzyme to form an enzyme-substrate mixture. The method further includes mechanically mixing the enzyme-substrate mixture. The method further includes applying a vibrational energy to the enzyme-substrate mixture, thereby reacting the enzyme and the substrate.
(89) In embodiments, the method includes combining an enzyme and a substrate of the enzyme to form an enzyme-substrate mixture; mechanically mixing the enzyme-substrate mixture; generating an enzyme-substrate mixture thin film; and applying a vibrational energy to the enzyme-substrate mixture thin film, thereby reacting the enzyme and the substrate.
(90) Enzymes are macromolecular biological catalysts. Enzymes accelerate, or catalyze, chemical reactions. The molecules at the beginning of the process upon which enzymes may act are called substrates and the enzyme converts these into different molecules, called products. Any enzymes can be used in the methods described herein, particularly water soluble enzymes. In embodiments, the enzyme is a water soluble enzyme. In embodiments, the water soluble enzyme is an esterase, a lipase, deoxyribose-5-phosphate aldolase (DERA), β-glucosidase, or an alkaline phosphatase.
(91) In embodiments, the enzyme-substrate mixture is a liquid, a gel, a hydrogel, or a paste. In embodiments, the enzyme-substrate mixture is a liquid. In embodiments, the enzyme-substrate mixture is a gel. In embodiments, the enzyme-substrate mixture is a hydrogel. In embodiments, the enzyme-substrate mixture is a paste.
(92) In embodiments, mechanically mixing the enzyme mixture forms an enzyme-substrate mixture thin film, where the vibrational energy is sufficient to produce a vibrational response within the enzyme-substrate mixture thin film. In embodiments, the thin film is about 50-500 in thickness (e.g., about 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195, 200, 205, 210, 215, 220, 225, 230, 235, 240, 245, 250, 255, 260, 265, 270, 275, 280, 285, 290, 295, 300, 305, 310, 315, 320, 325, 330, 335, 340, 345, 350, 355, 360, 365, 370, 375, 380, 385, 390, 395, 400, 405, 410, 415, 420, 425, 430, 435, 440, 445, 450, 455, 460, 465, 470, 475, 480, 485, 490, 495, 500 μm). In embodiments, the thin film is about 200-400 μm (e.g., about 200, 205, 210, 215, 220, 225, 230, 235, 240, 245, 250, 255, 260, 265, 270, 275, 280, 285, 290, 295, 300, 305, 310, 315, 320, 325, 330, 335, 340, 345, 350, 355, 360, 365, 370, 375, 380, 385, 390, 395, 400 μm). In embodiments, the thin film is about 200-300 μm (e.g., about 200, 205, 210, 215, 220, 225, 230, 235, 240, 245, 250, 255, 260, 265, 270, 275, 280, 285, 290, 295, 300 μm).
(93) In embodiments, a vibrational response within the enzyme-substrate mixture thin film is a Faraday wave. Faraday waves, also known as Faraday ripples, are nonlinear standing waves that appear on liquids enclosed by a vibrating receptacle. In embodiments, a vibrational response within the enzyme-substrate mixture thin film is to increase the enzymatic activity of the enzyme, increase the turnover rate of the enzyme, increase the rate constant (K.sub.cat), increase the enzymatic efficiency (K.sub.cat/K.sub.m), and/or decrease the reaction time relative to an enzymatic reaction conducted in the absence of the vibrational energy.
(94) In embodiments, the vibrational energy is sufficient to increase the enzymatic activity of the enzyme, increase the turnover rate of the enzyme, increase the rate constant (K.sub.cat), increase the enzymatic efficiency (K.sub.cat/K.sub.m), and/or decrease the reaction time relative to an enzymatic reaction conducted in the absence of the vibrational energy. Examples of methods for quantifying the enzymatic activity, the turnover rate of the enzyme, the rate constant, the enzymatic efficiency and the reaction time are provided in Examples 1-4.
(95) In embodiments, the vibrational energy is sufficient to increase the enzymatic activity of the enzyme relative to an enzymatic reaction conducted in the absence of the vibrational energy. In embodiments, the vibrational energy is sufficient to increase the enzymatic activity of the enzyme at least 2-fold (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100-fold or more) relative to the enzymatic activity in the absence of the vibrational energy. In embodiments, the enzymatic activity is increased from 2-fold to 100-fold. In embodiments, the enzymatic activity is increased from 2-fold to 50-fold. In embodiments, the enzymatic activity is increased from 2-fold to 15-fold. In embodiments, the enzymatic activity is increased from 5-fold to 20-fold.
(96) In embodiments, the vibrational energy is sufficient to increase the turnover rate of the enzyme relative to an enzymatic reaction conducted in the absence of the vibrational energy. In embodiments, the vibrational energy is sufficient to increase the turnover rate of the enzyme at least 2-fold (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100-fold or more) relative to the turnover rate of the enzyme in the absence of the vibrational energy. In embodiments, the turnover rate is increased from 2-fold to 100-fold. In embodiments, the turnover rate is increased from 2-fold to 50-fold. In embodiments, the turnover rate is increased from 2-fold to 15-fold. In embodiments, the turnover rate is increased from 5-fold to 20-fold.
(97) In embodiments, the vibrational energy is sufficient to increase the rate constant (K.sub.cat) relative to an enzymatic reaction conducted in the absence of the vibrational energy. In embodiments, the vibrational energy is sufficient to increase the rate constant of the enzyme at least 2-fold (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100-fold or more) relative to the rate constant of the enzyme in the absence of the vibrational energy. In embodiments, the rate constant is increased from 2-fold to 100-fold. In embodiments, the rate constant is increased from 2-fold to 50-fold. In embodiments, the rate constant is increased from 2-fold to 15-fold. In embodiments, the rate constant is increased from 5-fold to 20-fold.
(98) In embodiments, the vibrational energy is sufficient to increase the enzymatic efficiency (K.sub.cat/K.sub.m) relative to an enzymatic reaction conducted in the absence of the vibrational energy. In embodiments, the vibrational energy is sufficient to increase the enzymatic efficiency of the enzyme at least 2-fold (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100-fold or more) relative to the enzymatic efficiency of the enzyme in the absence of the vibrational energy. In embodiments, the enzymatic efficiency increased from 2-fold to 100-fold. In embodiments, the enzymatic efficiency is increased from 2-fold to 50-fold. In embodiments, the enzymatic efficiency is increased from 2-fold to 15-fold. In embodiments, the enzymatic efficiency is increased from 5-fold to 20-fold.
(99) In embodiments, the vibrational energy is sufficient to decrease the reaction time relative to an enzymatic reaction conducted in the absence of the vibrational energy. In embodiments, the vibrational energy is sufficient to reduce reaction time of the enzyme at least 2-fold (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100-fold or more) relative to reaction time of the enzyme in the absence of the vibrational energy. In embodiments, the reaction time is reduced from 2-fold to 100-fold. In embodiments, the reaction time is reduced from 2-fold to 50-fold. In embodiments, the reaction time is reduced from 2-fold to 15-fold. In embodiments, the reaction time is reduced from 5-fold to 20-fold.
(100) In embodiments, the vibrational energy produces a harmonic vibrational frequency. In embodiments, vibrational energy produces a non-harmonic (anharmonic) vibrational frequency. In embodiments, the vibrational energy produces a mix of harmonic vibrational frequency and non-harmonic vibrational frequency.
(101) In embodiments, the mechanically mixing is rotationally mixing. In embodiments, the rotational speed of the rotationally mixing is about 3 krpm to about 10 krpm. In embodiments, the rotational speed is about 3 krpm, 3.5 krmp, 4 krmp, 4.5 krmp, 5 krmp, 5.5 krmp, 6 krmp, 6.5 krmp, 7 krmp, 7.5 krmp, 8 krmp, 8.5 krmp, 9 krmp, 9.5 krmp, or even 10 krmp. In embodiments, the rotational speed exceeds 10 krpm, e.g., 10.5 krpm, 11 krmp, 11.5 krmp, 12 krmp, 12.5 krmp, 13 krmp, 13.5 krmp, 14 krmp, 14.5 krmp, or even 15 krmp or greater. In embodiments, the maximum rotational speed depends on the type of motor used to impart rotational mixing. In embodiments, the rotational speed required for the enzymatic reaction depends on the type of enzyme.
(102) In embodiments, the rotationally mixing is generated by a vortex fluid device (VFD). In embodiments, the VFD includes a tube reactor, which reactor includes a tube having a longitudinal axis, an inner cylindrical surface, and a closed and an open end. In embodiments, the tube is rotatable about the longitudinal axis. In embodiments, the tilt angle of the longitudinal axis relative to the horizontal is variable between about 0 degrees and about 90 degrees. In embodiments, the thin film tube reactor is substantially cylindrical or comprises at least a portion that is tapered. In embodiments, the thin film tube reactor is substantially cylindrical. In embodiments, the thin film tube reactor includes at least a portion that is tapered. In embodiments, the thin film tube includes a lip adjacent to the open end.
(103) In embodiments, the enzyme-substrate mixture is within a confined container (i.e., the enzymatic reaction is conducted in a confined mode). In embodiments, the enzyme-substrate mixture is within a glass container. In embodiments, the mixture is within a metal or a plastic container. In embodiments, the container has a tilt angle of about 20 degree to about 90 degree. In embodiments, the glass container has a tilt angle of about 20 degree to about 90 degree (e.g., about 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90 degree).
(104) In embodiments, the enzymatic reaction is conducted in a continuous flow mode, where the reagents (e.g., enzymes, substrates and other necessary reagents) are introduced into the rotating container in a continuous flow manner.
(105) In embodiments, the vibrational energy is imparted to the enzyme-substrate mixture by acoustic energy, e.g., sound waves, from a sound source. In embodiments, the vibrational energy is imparted to the enzyme-substrate mixture by mechanical impingement; e.g., mechanical tapping. In embodiments, the vibrational energy is imparted to the enzyme-substrate mixture by fluidic manipulation. The term “fluidic manipulation” in this context includes mechanically induced manipulation of the fluid due to features in the sample tube holding the enzyme-substrate mixture, e.g., constrictions, expansions, knobs, paddles, and like formed into the walls of the sample tube. In embodiments, the vibrational energy is imparted to the enzyme-substrate mixture due to asymmetric rotation of the sample tube holding the enzyme-substrate mixture.
(106) In embodiments, the container is subjected to acoustic energy. In embodiments, the tilt angle of the container can be any angle, if the container is subjected to acoustic energy. In embodiments, the container is subjected to mechanical impingement. In embodiments, the tilt angle of the container can be any angle, if the container is subjected to mechanical impingement. In embodiments, the container is subjected to fluidic manipulation. In embodiments, the tilt angle of the container can be any angle, if the container is subjected to fluidic manipulation. In embodiments, the container is subjected to asymmetric rotation. In embodiments, the tilt angle of the container can be any angle, if the container is subjected to asymmetric rotation.
(107) In embodiments, the methods described herein include a plurality of enzymes. In embodiments, the methods described herein include a plurality of substrates.
(108) In embodiments, the methods described herein include combining at least one enzyme, at least one substrate and at least one steric crowding reagent (e.g., polyethylene glycol (PEG) molecules, such as PEG 3350, PEG 8000).
(109) In another aspect, there is provided a method for purifying a protein. The method includes contacting a protein mixture includes the protein with a protein binding film, where the protein binding film is immobilized to a solid support, thereby forming a protein binding film complex. The method further includes separating the protein from the protein binding film complex, thereby obtaining a purified protein. “Purified” protein is substantially free of other unwanted nucleotides and polypeptides (i.e., any nucleotides or polypeptides without a specific expression tag). Purified protein is also free of cellular material. For example, a purified protein is one that is at least about 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or even 99%, or 100% (w/w) of the desired protein by weight. Purity is measured by any appropriate standard method, for example, by SDS-PAGE analysis, column chromatography, thin layer chromatography, or high-performance liquid chromatography (HPLC) analysis.
(110) The method for purifying a protein described herein provides great yield of the protein. In embodiments, the method provides at least about 80% (e.g., about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or even 99%) yield rate of the protein. The yield rate is measured by weight percentage of the purified protein out of the initial total weight of this protein in the protein mixture. In embodiments, the method provides at least about 85% yield rate.
(111) The method for purifying a protein described herein provides great efficiency. In embodiments, the purified protein prepared according to the method described herein is substantially pure. By “substantially pure” is meant a polypeptide or a protein that has been separated from the components that naturally accompany it. Typically, the polypeptide or the protein is substantially pure when they are at least about 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or even 99% or 99.5%, by weight, free from the unwanted nucleic acids, proteins and naturally-occurring organic molecules with they are naturally associated. In embodiments, the purified protein prepared according to the method described herein has at least about 76% purity.
(112) The method for purifying a protein described herein is very rapid. In embodiments, the total time for purifying a protein is less than about 5 hours, 4 hours, 3 hours, 2 hours, 1 hour, 50 min, 40 min, 30 min, 20 min, 10 min or even 5 min. In embodiments, the total time for purifying a protein according to the method described herein is about 10 min. In embodiments, the method described herein does not include any dialysis step.
(113) In embodiments, the contacting includes mechanically mixing. In embodiments, the mechanically mixing is rotationally mixing. In embodiments, the rotationally mixing has a rotational speed of about 3 krpm to 10 krpm. In embodiments, the rotational speed is about 3 krpm, 3.5 krmp, 4 krmp, 4.5 krmp, 5 krmp, 5.5 krmp, 6 krmp, 6.5 krmp, 7 krmp, 7.5 krmp, 8 krmp, 8.5 krmp, 9 krmp, 9.5 krmp, or even 10 krmp. In embodiments, the rotational speed exceeds 10 krpm, e.g., 10.5 krpm, 11 krmp, 11.5 krmp, 12 krmp, 12.5 krmp, 13 krmp, 13.5 krmp, 14 krmp, 14.5 krmp, or even 15 krmp or greater.
(114) In embodiments, the protein mixture is within a cell lysate. In embodiments, the cell lysate can be centrifuged. In embodiments, the cell lysate is not centrifuged unlike other known conventional methods for purifying a protein (such as FPLC) where a slurry of cell lysate will immediately block the conventional protein purification apparatus with cell debris.
(115) In another aspect, there is provided an enzyme reactor including a first enzyme, a protein binding film and a solid support, where the first enzyme is immobilized to the protein binding film in a first zone, and where the protein binding film is immobilized to the solid support.
(116) In embodiments, the enzyme reactor includes one or more additional enzymes. In embodiments, one or more additional enzymes are different from the first enzyme. In embodiments, one or more additional enzymes are the same as the first enzyme. In embodiments one or more additional enzymes are immobilized in the first zone. In embodiments one or more additional enzymes are not immobilized in the first zone. In embodiments, one or more additional enzymes are the same as the first enzyme and are immobilized in the first zone. In embodiments, one or more additional enzymes are different from the first enzyme and are immobilized in the first zone.
(117) In embodiments, the enzyme reactor includes one or more additional enzymes, each being different enzymes. In embodiments, the one or more additional enzymes are immobilized to the protein binding film in the first zone. In embodiments, at least one of the one or more additional enzymes are immobilized to the protein binding film in one or more zones that are different from the first zone.
(118) In embodiments, the reactor can include a plurality types of different enzymes (including the first enzyme), e.g., including 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or even greater than 50 types of enzymes in the reactor. In embodiments, each type of enzyme is a plurality of that type of enzymes.
(119) In embodiments, a plurality types of different enzymes can be immobilized in the same zone. In embodiments, a plurality types of different enzymes can be immobilized in 2 or more zones (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or even more than 50 zones). In embodiments, some of the plurality types of different enzymes are in the same zone(s). In embodiments, some of the plurality types of different enzymes are in different zone(s).
(120) In embodiments, the enzyme reactor includes one or more additional zones. In embodiments, the reactor includes a plurality of zones (including the first zone), e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or even greater than 50 zones in the reactor. In embodiments, each of the plurality of zones can be non-overlapping (see
(121) In embodiment, each zone may contain a plurality (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or even greater) types of enzymes. In embodiments, each zone may contain a plurality (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or even greater) types of enzymes where each type of enzyme is a plurality of that type of enzymes. In embodiments, each zone has a unique plurality types of enzymes (i.e., the enzymes among different zones are all different). In embodiments, the 2 or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or even more) zones contain same type or types of enzymes.
(122) In embodiments, the enzyme is immobilized within discrete zones. In embodiments, there is a plurality of discrete zones within which one enzyme is immobilized. In embodiments, the plurality of discrete zones of enzyme immobilization is not contiguous.
(123) In embodiments, the width of the first zone and any additional zones is from about 1 mm to the full length of the diameter of the solid support (i.e., the inner surface of the reactor). In embodiments, the width of one zone is about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49 or 50 mm or greater or to the full length of the diameter of the solid support.
(124) In embodiments, the length of the first zone and any additional zones is from about 1 mm to the full length (i.e., the full length of the longitude axis) of the solid support (see
(125) In embodiments, the solid support is an inner surface of the enzyme reactor.
(126) In embodiments, each zone can have a singularity or a plurality of enzymes, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or even greater than 50 different enzymes. In embodiments, the enzyme(s) within each zone can be different. In embodiments, the enzyme(s) within each zone can be present in multiple zones. In other words, some zones can share the same enzyme(s).
(127) In embodiments, the protein binding film used in any method or of any enzyme reactor described herein is covalently immobilized (e.g., bound) to the solid support. In embodiments, the protein binding film can be covalently immobilized to the solid support via siloxane bonds via e.g., APTES or other linker. In embodiments, the protein binding film can be covalently immobilized to the solid support through imine and/or amine linkages (e.g., the protein binding film including glutaraldehyde and the like).
(128) In embodiments, the protein binding film used in any method or of any enzyme reactor described herein is non-covalently immobilized to the solid support. In embodiments, the protein binding film is non-covalently immobilized to the solid support through, e.g., specific adsorption or non-specific adsorption. In embodiments, the protein binding film is non-covalently immobilized to the solid support through, e.g., hydrophilic interactions or specific absorption (e.g., the protein binding film including IMAC resin). In embodiments, the protein binding film is non-covalently immobilized to the solid support through IMAC resin attachment(s). In embodiments, non-covalent linkage can be through a bifunctional reagent, e.g., glutaraldehyde and the like via non-specific adsorption.
(129) In embodiments, the protein binding film used in any method or of any enzyme reactor described herein is non-covalently and covalently immobilized to the solid support. In embodiments, the protein binding film can be non-covalently immobilized to the solid support via, e.g., specific adsorption or non-specific adsorption and the protein binding film can be immobilized to the solid support covalently through imine and/or amine linkages.
(130) In embodiments, the rotation of the sample tube (i.e., reactor or enzyme reactor) forces the protein binding film into a thin layer upon such rotation. In further embodiments, solvent (e.g., water) can evaporate leaving the protein binding film immobilized to the solid support.
(131) In embodiments, the protein of interest (e.g., the protein to be purified or the one or more enzymes of the enzyme reactor) is covalently bound to the protein binding film. In embodiments, the protein of interest (e.g., the protein to be purified or the one or more enzymes of the enzyme reactor) is non-covalently bound to the protein binding film.
(132) In embodiments, the binding of the protein of interest (e.g., the protein to be purified or the one or more enzymes of the enzyme reactor) to the protein binding film is stable. In embodiments, less than about 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1% or lower percentage of the protein bound to the protein binding film is leached away from the protein binding film/the reactor over a period of time (e.g., at least about 30 min, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 hours, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 days or even longer time).
(133) Further to any embodiment of the method or any embodiment of the enzyme reactor, in embodiments the protein of interest includes a binding moiety. In embodiments, the binding moiety is an expression tag. In embodiments, the expression tag is biotin-modified tag (e.g., a BirA encoding peptide), a streptavidin binding peptide, or an affinity chromatography epitope (e.g., polyArg, polyHis, or the like). In embodiments, the expression tag is a His tag.
(134) An amino acid tag sequence, also called protein tag or expression tag, is peptide sequence genetically grafted onto a recombinant protein. These tags are often removable by chemical agents or by enzymatic means, such as proteolysis or intein splicing. Tags are attached to proteins for various purposes. Affinity tags are appended to proteins so that they can be purified from their crude biological source using an affinity technique. These include chitin binding protein (CBP), maltose binding protein (MBP), and glutathione-S-transferase (GST). The poly(His) tag is a widely used protein tag; it binds to metal matrices. Solubilization tags are used, especially for recombinant proteins expressed in chaperone-deficient species such as E. coli, to assist in the proper folding in proteins and keep them from precipitating. These include thioredoxin (TRX) and poly(NANP). Some affinity tags have a dual role as a solubilization agent, such as MBP, and GST. Chromatography tags are used to alter chromatographic properties of the protein to afford different resolution across a particular separation technique. Often, these consist of polyanionic amino acids, such as FLAG® tag.
(135) Exemplary expression tags that can be used in the protein or enzyme described herein include, but are not limited to:
(136) TABLE-US-00001 TABLE 6 Expression tags SEQ ID Name of Tags Description NO AviTag ™ a peptide allowing biotinylation by the enzyme BirA and so the 11 protein can be isolated by streptavidin (GLNDIFEAQKIEWHE) Calmodulin-tag a peptide bound by the protein calmodulin 12 (KRRWKKNFIAVSAANRFKKISSSGAL) polyglutamate a peptide binding efficiently to anion-exchange resin such as 13 tag MONO Q ® (EEEEEE) E-tag a peptide recognized by an antibody (GAPVPYPDPLEPR) 14 FLAG ® tag a peptide recognized by an antibody (DYKDDDDK) 15 HA-tag a peptide from hemagglutinin recognized by an antibody 16 (YPYDVPDYA) His-tag 5-10 (e.g., 5, 6, 7, 8, 9 or 10) histidines bound by a nickel or 17 cobalt chelate (HHHHHH) Myc-tag a peptide derived from c-myc recognized by an antibody 18 (EQKLISEEDL) S-tag a peptide derived from Ribonuclease A 19 (KETAAAKFERQHMDS) SBP-tag a peptide which binds to streptavidin 20 (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) SOFTAG ™ 1 for mammalian expression (SLAELLNAGLGGS) 21 SOFTAG ™ 3 for prokaryotic expression (TQDPSRVG) 22 STREP TAG ® a peptide which binds to streptavidin or the modified streptavidin 23 called streptactin (STREP TAG ® II: WSHPQFEK) TC tag a tetracysteine tag that is recognized by FlAsH and ReAsH 24 biarsenical compounds (CCPGCC) V5 tag a peptide recognized by an antibody (GKPIPNPLLGLDST) 25 VSV-tag a peptide recognized by an antibody (YTDIEMNRLGK) 26 Xpress tag (DLYDDDDK) 27 Glutathione-S- a protein which binds to immobilized glutathione transferase-tag
(137) In embodiments, the protein binding film used in any method or of any enzyme reactor described herein includes a binding partner of the binding moiety. In embodiments, the binding partner is a metal. In embodiments, the binding partner is nickel, cobalt or copper.
(138) As used herein, the term “binding partners” includes two molecules, or portions thereof, which have a specific binding affinity for one another and typically will bind to each other in preference to binding to other molecules. Typically but not necessarily some or all of the structure of one member of a specific binding pair is complementary to some or all of the structure possessed by the other member, with the two members being able to bind together specifically by way of a bond between the complementary structures, optionally by virtue of multiple noncovalent attractions.
(139) In embodiments, molecules that function as binding partners include: biotin (and its derivatives) and their binding partner avidin moieties, streptavidin moieties (and their derivatives); His-tags which bind with nickel, cobalt or copper; cysteine, histidine, or histidine patch which binds Ni-NTA; maltose which binds with maltose binding protein (MBP); lectin-carbohydrate binding partners; calcium-calcium binding protein (CBP); acetylcholine and receptor-acetylcholine; protein A and binding partner anti-FLAG antibody; GST and binding partner glutathione; uracil DNA glycosylase (UDG) and ugi (uracil-DNA glycosylase inhibitor) protein; antigen or epitope tags which bind to antibody or antibody fragments, particularly antigens such as digoxigenin, fluorescein, dinitrophenol or bromodeoxyuridine and their respective antibodies; mouse immunoglobulin and goat anti-mouse immunoglobulin; IgG bound and protein A; receptor-receptor agonist or receptor antagonist; enzyme-enzyme cofactors; enzyme-enzyme inhibitors; and thyroxine-cortisol. Another binding partner for biotin can be a biotin-binding protein from chicken (Hytonen, et al., BMC Structural Biology 7:8).
(140) An avidin moiety can include an avidin protein, as well as any derivatives, analogs and other non-native forms of avidin that can bind to biotin moieties. Other forms of avidin moieties include native and recombinant avidin and streptavidin as well as derivatized molecules, e.g. nonglycosylated avidins, N-acyl avidins and truncated streptavidins. For example, avidin moiety includes deglycosylated forms of avidin, bacterial streptavidins produced by Streptomyces (e.g., Streptomyces avidinii), truncated streptavidins, recombinant avidin and streptavidin as well as to derivatives of native, deglycosylated and recombinant avidin and of native, recombinant and truncated streptavidin, for example, N-acyl avidins, e.g., N-acetyl, N-phthalyl and N-succinyl avidin, and the commercial products ExtrAvidin™, Captavidin™, Neutravidin™ and Neutralite Avidin™.
(141) Further to any embodiment of the method or any embodiment of the enzyme reactor, in embodiments the solid support is an inner surface of a reactor. The term “reactor” used herein refers to a device for containing and controlling a chemical reaction (e.g., an enzymatic reaction) or process (e.g., purifying a protein). The term “enzyme reactor” refers to a reactor for containing and controlling an enzymatic reaction.
(142) Further to any embodiment of the method or any embodiment of the enzyme reactor, in embodiments the reactor includes a closed end and an open end. In embodiments, the reactor can be in any shape. In embodiments, the reactor is cylindrical. In embodiments, the reactor is cuboidal. In embodiments, the reactor is a glass reactor. In embodiments, the reactor is a metal reactor. In embodiments, the reactor is a plastic reactor. In embodiments, the reactor is made of any material that is suitable for protein purification and/or enzymatic reactions.
(143) Further to any embodiment of the method or any embodiment of the enzyme reactor, in embodiments the protein mixture is contacted with the protein binding film by continuous flow. In embodiments, the protein mixture is contacted with the protein binding film by bolus contact. In embodiments, the protein mixture is contacted with the protein binding film in a confined mode.
(144) In another aspect, there is provided a method for reacting an enzyme and a substrate. The method includes contacting the protein binding film of the enzyme reactor as disclosed herein with a substrate of the first enzyme. The method further includes allowing the substrate to react with the first enzyme.
(145) In embodiments, the substrate is contacted with the protein binding film by continuous flow. In embodiments, method and embodiments thereof include applying a vibrational energy described herein to the enzyme reactor.
(146) In embodiments, the substrate is a plurality of substrates, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, or even greater than 50. In embodiments, the substrate is a plurality of substrates, each corresponding to one enzyme of the enzyme reactor described herein.
(147) In embodiments, any methods or enzyme reactors described herein may include one or more additional reagents besides enzyme and substrate.
(148) In embodiments, the enzyme reactor described herein is a vortex fluid devise (VFD). In embodiments, the VFD provides shear stress, dynamic and standing pressure waves and micro-mixing of enzyme/substrate/reagents while rotating. In embodiments, the VFD is operated at constant volume of solution, where enzyme and substrate reagents do not flow into or out of the VFD during the reaction. In embodiments, the VFD is operated under continuous flow conditions of solution, where enzyme or substrate reagents flow into or out of the VFD during the reaction. In embodiments, the enzyme is immobilized within the VFD and substrate reagents flow into or out of the VFD during the reaction.
(149) In embodiments, any method described herein is conducted at room temperature (25° C.). In embodiments, any method described herein is conducted at elevated temperature. In embodiments, any method described herein is conducted at reduced temperatures. In embodiments, any method described herein is conducted at atmospheric pressure. In embodiments, any method described herein is conducted at elevated pressure. In embodiments, any method described herein is conducted at reduced pressure.
EXAMPLES
Example 1. A General Approach to Accelerating Enzymatic Catalysis Using Vortex Fluidic Processing
(150) Summary.
(151) We describe a general method to accelerate catalysis by enzymes. Specifically, a vortex fluidic device can drive enzyme activity without requiring enzyme mutagenesis, altered temperatures, or added chemicals, pressure, or microwaves. The enzyme and its substrate are spun rapidly in a tube (up to 10,000 rpm) whereby the mechanical energy of the device rotating the solution leads to a dramatic enzyme enhancement.
(152) The Vortex Fluidic Device (VFD) can be operated with a constant volume of solution (confined mode) or continuous flow for higher volumes of solution. The enzyme and the substrate are introduced into a rotating glass tube (which is held between two bearings), and the tube spun rapidly for a set period of time. The degree of chemical conversion is then established through the use of a colorimetric assay. Enzyme activity for fast thermosensitive alkaline phosphatase (Thermo-fisher), lipase from wheat germ, Type 1 (Sigma and Aldrich) and β-glucosidase from almonds (Sigma and Aldrich) were enhanced with up to a 12-fold enhancement in catalytic productivity.
(153) This technology could be readily applied to other enzymes important to both academia and industry. The industrial enzyme market is forecasted to be worth S6 billion by 2018. General processes to accelerate enzymatic catalysis could have a major impact. As this process can be used for smaller processes or a continuous flow system to enable processing of very large volumes, this technology will be competitive on both academic and industrial scales.
(154) Introduction.
(155) Enzymes catalyze chemical transformations and are used extensively in industrial, food, and research applications. Accelerating such catalysis could lower the costs for such processes. Current methods to enhance the activity of enzymes largely focus on engineering the enzyme for improved activity; this approach is slow and cumbersome. More general approaches to accelerating enzymatic catalysis apply (i) the use of forcing conditions such as high pressure and precise temperature control, (ii) acceptance of the limitation that enzymes can be inherently slow for some processes (giving the process longer time periods), (iii) increased enzyme loading, which costs more money and (iv) increased substrate loading, which eventually shuts down the enzyme due to substrate inhibition.
(156) There have been numerous ways to increase enzyme activity including (i) Enzyme modification and design, which is specific only to the enzyme under consideration, (ii) Chemical additions to the reaction mixture, which increases the waste stream and adds to the purification challenges, (iii) High energy microwave radiation, (iv) Immobilization onto a solid support, (v) High pressure treatment, (vi) Polymer attachment (vii) Noble gas doping and (viii) Pretreatments. All of these processes, disclosed following, involve expensive, complex techniques and/or involve the addition of other chemicals to the process.
(157) (i) Enzyme modification for individual enzymes—Engineering enzymes is a timely, costly, complex and idiosyncratic art. Many approaches have been made in this area, but none solve the problem of necessitating the synthesis and testing of large numbers of enzyme variants.
(158) (ii) Chemical addition—Specific to the reaction and add expense and waste to synthesis. See e.g., WO1194012621.
(159) (iii) High energy microwave radiation (general solution)—This high-energy process requires expensive infrastructure, and incurs safety implications. See e.g., WO2013027053.
(160) (iv) Immobilization onto a solid support—This potentially complex path to enzyme enhancement raises questions about scalability. See e.g., U.S. Pat. No. 8,715,982.
(161) (v) Purification agents—These are mainly related to (i) Specific washes to increase the purity of enzymes located on immobilization surfaces (see e.g., U.S. Pat. No. 7,312,056) and washing raw enzyme solutions with species like activated carbon to increase activity (see; e.g., CA2421832 C). These are specific to the reaction and adds expense to pathways.
(162) (vi) Attachment to solid support—This approach requires optimization to achieve enzyme enhancement. See e.g., EP2834355,
(163) (vii) Noble gas doping—A is a complex approach to enzyme enhancement, which is difficult to scale, and noble gases have large added expense. See e.g., U.S. Pat. No. 5,462,861.
(164) (viii) Pretreatment of enzyme solutions—Pretreatment of substrates with organic solvents, salts and other chemical species can be useful to increase enzyme activity. See e.g., EP2384364, U.S. Pat. No. 8,241,880 and WO2010080434. This is a time consuming step requiring the addition of chemicals.
(165) Results and Discussion.
(166) This disclosure reports an exciting new application for the previously disclosed vortex fluidic device (VFD). Here, we apply the approach to accelerate enzymatic catalysis using the following two modes of vortex fluidic processing. (1) Confined mode—whereby a fixed volume of liquid is rotated within the confinements of the glass tube and (2) Continuous flow mode—whereby reagents are introduced into the rotating tube in a continuous manner. The reagents are processed as they flow up the rotating glass tube and exit through the top of the unit, where they are collected. The resultant solutions are then subjected to a pH treatment or rapid dilution to quench enzymatic activity before analysis.
(167) An enzyme is a protein-based catalyst that operates by decreasing the activation energy of a chemical reaction to result in an increased reaction rate. Enzymes exert exquisite control over reaction starting materials, transition states, intermediates and product; for example, enzymes can favor formation of specific stereochemistry from complex reactions. Due to such specificity, enzymes are employed extensively in industrial and academic processes. The VFD approach disclosed here can dramatically speed up enzymatic catalysis.
(168) After introducing the enzyme and substrate into the VFD sample tube (
(169) In a typical experiment, fast thermosensitive alkaline phosphatase (1 μL, 1 unit, Thermo-Fisher) was added to 10 mL of diethanolamine buffer (1.0 M diethanolamine buffer with 0.50 mM magnesium chloride at pH 9.8 at 25° C.) in creating an enzyme stock solution. This solution was stored on ice and not stored for more than two hours. p-nitrophenyl phosphate liquid substrate solution (500 μL, Sigma-Aldrich) was added to a 20 mm external diameter VFD tube. To this was added alkaline phosphatase enzyme solution (800 μL) and the tube was inserted into the VFD and immediately spun to the required rotational speed. The VFD tube was rotated about its axis for 10 minutes at a 45-degree tilt angle relative to the horizontal position. At the end of this time 4 M NaOH (150 μL) was added in quenching the reaction. The sample was then added to a 96-well reader plate and the absorbance read at 401 nM (being the λ.sub.max for this system with 150 μL NaOH quench). The higher the enzyme activity the more P-nitrophenol is liberated, thus the stronger the absorption at 401 nM. The results obtained in this manner can be directly compared to a batch type experiment where by the enzyme and substrates are not introduced into the VFD, but allowed to reaction without mechanical involvement. From a comparison of the absorption values of the VFD vs. batch an enhancement factor can be determined (
(170) For the steric crowding studies the following method was performed. Fast thermosensitive alkaline phosphatase (1 μL, 1 unit, Thermo-Fisher) was added to a 15 mL Eppendorf tube containing 10 mL of diethanolamine buffer (1.0 M diethanolamine buffer with 0.50 mM Magnesium Chloride at pH 9.8 at 25° C.) with the correct mass of PEG.sub.3350 or PEG.sub.s000 (0.5, 1, 2, 3 or 6 mg/mL) pre-dissolved. This created enzyme stock solutions with the correct level of PEG-doping. This solution was stored on ice and not stored for more than two hours. p-nitrophenyl phosphate liquid substrate solution (500 μL, Sigma-Aldrich) was added to a 20 mm external diameter VFD tube. To this was added alkaline phosphatase enzyme solution (800 μL) and the tube was inserted into the VFD and immediately spun to the required rotational speed. The VFD tube was rotated about its axis for 10 minutes at a 45-degree tilt angle relative to the horizontal position. At the end of this time 4 M NaOH (150 μL) was added in quenching the reaction. The sample was then added to a 96-well reader plate and the absorbance read at 401 nM (being the λ.sub.max for this system with 150 μL NaOH quench). The results obtained in this manner can be directly compared to a batch type experiment where by the enzyme and substrates are not introduced into the VFD, but allowed to reaction without mechanical involvement. From a comparison of the absorption values of the VFD vs. batch an enhancement factor can be determined (
(171) For the concentration of substrate studies the following method was performed.
(172) Example: β-Glucosidase. To a 15 mL centrifuge tube was added lyophilized β-glucosidase enzyme (5.0 mg). The enzyme was taken up in sodium acetate buffer (50 mM, pH 5.0, 10 mL) and vortexed for two minutes. From this solution a 100 μL aliquot was taken and added to 100 mL of sodium acetate (50 mM, pH 5.0) in creating a 0.005 mg/mL concentration of enzyme. The substrate solution constituted of 4-nitrophenyl β-D-glucopyranoside (31.25 mg) in 10 mL of sodium acetate buffer (50 mM, pH 5.0) in creating a 0.01 M substrate solution. For all concentration experiments the volume of the system was maintained at 1.300 mL and to scan the enzymatic enhancement space at a rapid rate the following was achieved.
(173) For example; 100 μL of substrate was added to 1200 μL of enzyme solution and placed in a 20 mm external diameter VFD tube, in creating a 0.77 mM substrate concentration. The tube was rotated about its axis at a 45-degree tilt angle for 10 minutes. After this time the processed solution was added to 200 μL of sodium hydroxide-glycine buffer (pH 10.80) and quenched. An aliquot of 100 μL was then added to a 96 well plate and the absorbance tested at 405 nm. The level of absorption can be directly related to the level of enzymatic activity, with the absorption at 405 nm corresponding to the absorption of light due to the presence of 4-nitrophenol. The range of typical experiments follows: 100 μL of substrate solution and 1200 μL of enzyme solution in creating a 0.77 mM substrate concentration; 200 μL of substrate solution and 1100 μL of enzyme solution in creating a 1.54 mM substrate concentration; 300 μL of substrate solution and 1000 μL of enzyme solution in creating a 2.31 mM substrate concentration; 400 μL of substrate solution and 900 μL of enzyme solution in creating a 3.08 mM substrate concentration; 500 μL of substrate solution and 800 μL of enzyme solution in creating a 3.85 mM substrate concentration; 600 μL of substrate solution and 700 μL of enzyme solution in creating a 4.62 mM substrate concentration; 700 μL of substrate solution and 600 μL of enzyme solution in creating a 5.38 mM substrate concentration; 800 μL of substrate solution and 500 μL of enzyme solution in creating a 6.15 mM substrate concentration; 900 μL of substrate solution and 400 μL of enzyme solution in creating a 6.92 mM substrate concentration; 1000 μL of substrate solution and 300 μL of enzyme solution in creating a 7.69 mM substrate concentration; 1100 μL of substrate solution and 200 μL of enzyme solution in creating a 8.46 mM substrate concentration; or 1200 μL of substrate solution and 100 μL of enzyme solution in creating a 9.23 mM substrate concentration.
(174) This methodology allows rapid determination of an optimum concentration in the system.
(175) As mentioned above, at specific rotational speeds the rotating tube can fall into a harmonic vibration, leading to a secondary fluid dynamical response. Thus, at specific rotational speeds we see a greater enhancement compared to other speeds. This has been investigated in detail and has been optimized for the three enzymes mentioned above. It is theorized that the increase in enzyme activity is a direct result from this harmonic vibration set up at specific rotational speeds. Through optimization of (i) enzyme concentration, (ii) substrate concentration, (iii) rotational speed of the tube, (iv) inclination angle of the rotating tube, (v) steric crowding reagents and (vi) reaction length the enzyme of choice can be optimized in short order to produce a dramatic enhancement. This was achieved for three enzymes studied to date, alkaline phosphatase, β-glucosidase and a lipase (
(176) This process occurs at room temperature and pressure. Thus, the VFD is a less expensive, safer operation compared to a high pressure or temperature systems. As there are no chemical additives required, this process is more efficient and more cost effective than other techniques.
(177) This technology allows enzyme activity optimization on a small scale before going to continuous flow for industrial scale-up. Using the enzyme with its substrate in batch first allows quick optimization thus saving time and money. Once the enzyme has been optimized the parameters can be directly applied to the scaled-up continuous flow system, which again saves time and re-optimization, a caveat associated with most other approaches to this area of chemistry.
(178) Other, less general approaches to enzyme optimization focus on making changes to the amino acid composition of the enzyme. Such enzyme engineering approaches take a long time, and are only applicable to the enzyme under study.
(179) Other benefits include: (i) ease of operation, (ii) simplicity of the invention and (iii) most importantly, the invention is not specific to one enzyme, it can be used to enhance numerous enzymes, unlike other technologies patented in this area.
Example 2. Immobilization of Enzymes onto a Thin Film Reactor Tube for Rapid Enzymatic Synthesis in Continuous Flow
(180) Abstract.
(181) Covalent attachment of enzymes to a rapidly rotating boro-silicate glass tube has been achieved within the confinements of a vortex fluidic device (VFD). The optimization process yielded enzyme attachment in less than four hours under mild conditions. These attachments now allow continuous flow enzymatic synthesis to occur within a VFD. The large surface area and high mass transfer within the tube ensures high levels of contact between reagents and immobilized enzymes. Utilizing dynamic thin films created within the device is a quality that no other flow chemistry device possesses. Conventionally, flow chemistry units pass liquids through well-defined channels and paths, and as a result have low levels of contact and mass transfer between the enzyme and substrate.
(182) Methodology.
(183) Enzyme attachment was optimized with β-glucosidase from almonds (Sigma). β-glucosidase is a commercial available enzyme that has a rapid colorimetric assay utilizing p-nitrophenol production from 4-nitrophenyl-β-D-glucopyranoside. Covalent attachment was carried out using the following method.
(184) Preparing the enzyme coating; A 17.7 mm-internal diameter VFD tube was filled with piranha solution (33% H.sub.2O.sub.2 and 77% H.sub.2SO.sub.4) and left for one-hour at room temperature. The tube was then rinsed with copious amounts of de-ionized water (30×50 mL) to remove any remaining acidic solution and then placed in an oven at 160° C. for two hours to remove all remaining water. All residual water must be removed to achieve an efficient APTES coating. Following this, APTES (49 mL, 2% v/v in methanol) was added, and the tube sealed. The tube was then submerged in a water bath at 40° C. for one hour. After this time, the APTES solution was removed and the tube washed with copious amounts of methanol (10×50 mL), then placed in the oven at 160° C. for another two hours to anneal the newly formed APTES layer. After this period, the tube was removed from the oven, purged with N.sub.2 for 5 minutes and then sealed.
(185) The enzyme solution (0.30 mg/mL) composed of β-glucosidase (3 mg) added to 10 mL of PBS (3.00 mL) was immediately used for immobilization. This solution was bench vortexed for 1 minute and then left to stand for 14 minutes. After this time, 2.0 mL of this enzyme solution and an additional 1.0 mL of PBS buffer (pH 7.2) were added to the APTES coated VFD tube. The VFD was rotated about its axis at 8000 rpm, at a 45-degree tilt angle for 30 minutes to afford covalent attachment. The tube was then removed from the VFD and washed with PBS (10×50 mL).
(186) Testing the enzyme coating; The substrate, 4-nitrophenyl-β-D-glucopyranoside (1.30 mL, 0.1 M in phosphate buffer pH 4.2, Sigma) was added to the VFD tube and rotated at a 45-degree tilt angles for 5 minutes at 8000 rpm. The solution was then removed from the tube and added to a quench of NaOH-Glycine buffer (0.200 mL, pH 10.8). From this quenched solution a 0.100 mL sample was removed and tested for its absorptivity at 405 nM. The product from the enzymatic reaction absorbs at 405 nM, thus providing direct analysis of enzyme activity. The same tube was tested three sequential times. These sequential tests ensure that the coating is covalent in nature and not intermolecular associations.
(187) Results.
(188) We report optimization of the APTES coating.
Example 3. A General Method for Enzyme Acceleration Using Vortex Fluidics
(189) Abstract.
(190) Enzymes provide outstanding stereo- and region-specificity when catalyzing diverse organic transformations under mild conditions. These biocatalysts are however typically slow. We describe a general method using a thin film vortex fluidic device (VFD) to accelerate enzymatic catalysis under standard conditions. The mechanical vibrations of the VFD at specific rotational frequencies generate Faraday waves within the thin film. These pressure waves can accelerate enzymatic catalysis by a reduction in the reaction and activation volumes. Five different enzymes, alkaline phosphatase, β-glucosidase, lipase, esterase and deoxyribose-5-phosphate aldolase (DERA) displayed increased activity through this approach, and essentially any soluble enzyme should be amenable to VFD-mediated rate acceleration.
(191) Introduction.
(192) Enzymes catalyze diverse and challenging chemical transformations with exquisite stereo- and regiospecificity. These biocatalysts offer remarkable rate accelerations compared to the uncatalyzed reaction—often 10.sup.5 to 10.sup.8-fold faster. However, despite such abilities, many enzymes run at only modest reaction rates. For their selectivity and abilities to catalyze other inaccessible reactions, enzymes find diverse applications in industrial, food, and laboratory processes.
(193) Applications of enzymatic catalysts in synthetic chemistry have expanded driven by pressure to incorporate sustainable methods. Most enzymes operate at room temperature, can be used in conjunction with non-natural catalysts, and sometimes tolerate organic solvents [1]. Enzymes have contributed to key steps in the syntheses of atorvastatin, indinavirsulphate, and aprepitant [2,3]. Conventional methods to improve enzymatic catalysis explore directed evolution [4,5], computational design [6], and other methods. After laborious, expensive and time-consuming efforts, such methods typically uncover specific solutions to the challenges facing each enzyme. More general methods to accelerate enzyme activity include tinkering with the reaction temperature or small increases in pressure. However, too high a pressure can lead to denatured enzymes, a process used in the food industry.[7]
(194) We have described applying the VFD to protein folding, another challenge requiring new generally applicable technologies. The VFD demonstrated effective folding of four different proteins within minutes at room temperature and pressures (standard conditions). Such abilities were ascribed to the shear forces and Faraday waves generated by the VFD. The VFD has also been successful in a number of chemical and materials transformations such as the assembly line synthesis of local anesthetic lidocaine,[8] the refolding of proteins [9] and several other organic transformations.[10,11] Since such forces also affect enzymatic catalysis, we were interested to explore biocatalysis by the VFD.
(195) The VFD generates thin film of ≈200 μm through rotation of a tube at specific speeds. Held between two, multi-ball bearings, the tube rotates at a variable tilt angle, θ, relative to the horizontal (
(196) Experimental Section
(197) At specific rotational speeds, the rotating sample tube fall into harmonic vibrations. This primary mechanical response induces a secondary fluid dynamical response into the thin film in the form of a Faraday wave. This has been linked to the many surprising transformations that occur within the VFD.[14-16] and this work is no exception. Faraday waves create rapid modulation in the thin film pressure. An increase in pressure at the rapidly fluctuating anti-nodes of the Faraday wave (
(198) Results and Discussion
(199) The rates and position of equilibrium with catalysis can be explained to varying degrees of vigor known in the art using the Van't Hoff equation;
(200)
(201) Here the rate constant (k), equilibrium constant (K), pressure in the system (P), temperature of the system (T), the volume change from the initial state to the final state (V), the activation volume (V*) and the ideal gas constant (R). To consider the thermodynamics; if a ΔV is positive then the reaction favors the initial state and vice versa. However, given the complexity enzyme pathways, each chemical transformation has multiple steps associated. Conformational changes, unfolding and folding, ionization, hydration and the association and dissociation of subunits all have a thermodynamic consideration. High pressure processing on these variables has been thoroughly investigated but no study on rapid modulations of lower pressures systems exist to our knowledge. Kinetically, ΔV* is the difference between the activation volumes of the initial reactants and the activation volume of the transition state. If the activation volume is negative, an increase in pressure will accelerate the reaction and vice versa. Much like the thermodynamic, kinetically, enzymes encompass a multitude of steps such as; substrate binding and release, chemical transformation(s) of the substrate and eventual product release. These kinetic steps have been well studied and arise from Michaelis-Menton models. We now investigate how Faraday wave pressure modulation drives enzyme enhancement and if this effect is thermodynamic or kinetic in nature.
(202) First to be ascertained was the ability of enzymes to withstand levels of high shear stress within the thin film. We previously disclosed that proteins can be refolded within the confinements of a VFD.[9] This process was driven by the high levels of shear stress mediating the folding process into a thermodynamic sink, much like a protein chaperone. In testing enzyme behavior in the VFD, shear stress has no effect. More impressive, is that the VFD accelerates the rate of biocatalysis.
(203) Alkaline phosphatase is a well understood, commercially available hydrolase enzyme that is responsible for the removal of phosphate groups from a variety of nucleotides, proteins, and alkaloids.[19] This enzyme was used to explore the variables for accelerated enzyme activity within the VFD. For every VFD experiment, the corresponding control experiment was carried out. This ensures that any enhancement is directly from the VFD. Control reactions were ran from the same stock solution using the same volume (1.30 mL), concentration, temperature and reaction time for all enzymes tested. The substrate was also rotated at high speed in its buffer to demonstrate that the enhancement was not due to substrate hydrolysis. A quencher was used in order to immediately halt reactivity in both VFD and non-VFD samples. The use of colorimetric or fluorogenic assays was employed to allow high throughput testing so that optimization occurs in short order, vida infra.
(204) Further control experiments provided an insight into the mechanism behind the observed acceleration. Centrifuging samples to 14,000 rpm to simulate high shear stress levels displayed no increase in enzymatic activity. A temperature-controlled experiment demonstrated that if any increase in temperature occurred during processing, it would be detrimental to enzyme activity. Rapid micromixing has increased the yield of several organic reactions in the VFD. However, many of the rotational speeds of the VFD tested in this work (often up to 9,000 rpm) afforded no acceleration (
(205) In order to fully quantify this system, the variables of; reaction time, simultaneous changes in enzyme and substrate concentration, tube inclination angle, rotational speed, product inhibition, substrate loading levels and the use steric crowding reagents were explored (
(206) The angle of the inclined tube is also a key factor in the ability of the VFD to accelerate enzymes (
(207) Doping the reaction with set concentrations of both products (
(208) The optimal conditions for alkaline phosphatase was used to explore four other enzymes; β-glucosidase, esterase, lipase and DERA. Three sets of crucial experiments are undertaken to allow rapid optimization of enzyme activity. Exploring reaction time, simultaneously changing enzyme and substrate concentration and variation in rotational speeds leads to rapid optimization. All enzymes were tested using these three experiments, and all enzymes demonstrated enhancement compared to non-VFD samples (
(209) Forecasting that high usage of the bearings, the closed bearings (where additional lubricant cannot be added) were changed to open bearings so that additional lubricant can be added to allow maintenance. The closed bearings have a lifetime of around 200 hours before they need to be replaced. Using open bearings, with the same exact specification allows a much longer lifetime, given correct maintenance is undertaken. The switch to open bearings was made and a high-resolution, rotational speeds scan at 5.00-rpm increments was achieved. It was found that the activity landscape of these bearings is very fine and intricate. This further justifies the importance of the devices bearings.
(210) In determining if the observed acceleration is due to a kinetic or thermodynamic effect, the initial rates of each reaction were explored. All five enzymes were subjected typical kinetic experiments using the Michaelis-Menton model. The intrinsic values of the enzymes in a batch type and VFD system could be ascertained (Table 1).
(211) TABLE-US-00002 TABLE 1 The Michaelis-Menton parameters that were generated through initial rates experiments both in the VFD and non-VFD. V.sub.max (Mol/sec) K.sub.M (M) k.sub.cat (sec.sup.−1) k.sub.cat/K.sub.M (M.sup.−1S.sup.−1) Enzyme Batch VFD Batch VFD Batch VFD Batch VFD Phosphatase 2.271 × 10.sup.−8 — 4.836 × 10.sup.−4 — 1 — 1 — β- 1.489 × 10.sup.−7 — 1.068 × 10.sup.−2 — 4 — 375 — glucosidase Lipase 2.205 × 10.sup.−8 — 1.452 × 10.sup.−3 — 0.024 — 17 — Esterase 1.439 × 10.sup.−8 — 2.083 × 10.sup.−3 — 337 — 1.56 × 10.sup.−5 — DERA
(212) General Protocol.
(213) To a 17.7 mm internal diameter VFD tube was added the substrate and enzyme in buffer at the appropriate concentration. The VFD tube was rotated about its axis at a specific rotational speed at an inclination angle of 45-degrees. After a set amount of time had elapsed, the rotation was immediately halted and the quenching reagent added. The exact same reaction was run alongside the VFD in mimicking a non-VFD process. From both the VFD processed and non-VFD processed sample an aliquot of 0.100 mL was removed and added to a 96 well plate and read at 405 nM to detect the production of p-nitrophenoxide. These measurements were carried out in triplicate and allow an accurate comparison to be drawn between VFD and non-VFD processing. For all alterations to this general protocol, assay and further experimental design, see supporting information.
References
Example 3
(214) [1]. Koeller, C.-H. Wong, Enzymes for chemical synthesis. Nature 409, 232-240 (2001); [2]. D. J. Pollard, J. M. Woodley, Biocatalysis for pharmaceutical intermediates: the future is now. Trends in Biotechnology 25, 66-73 (2007); [3]. R. N. Patel, Microbial/enzymatic synthesis of chiral pharmaceutical intermediates. Curr. Opin. Drug. Discov. Devel 6, 902-920 (2003); [4]. O. Kuchner, F. H. Arnold, Directed evolution of enzyme catalysts. Trends in Biotechnology 15, 523-530 (1997); [5]. D. Bloom, M. M. Meyer, P. Meinhold, C. R. Otey, D. MacMillan, F. H. Arnold, Evolving strategies for enzyme engineering. Current Opinion in Structural Biology 15, 447-452 (2005); [6]. N. Bolon, C. A. Voigt, S. L. Mayo, De novo design of biocatalysts. Current Opinion in Chemical Biology 6, 125-129 (2002); [7]. B. Boonyaratanakornkit, C. B. Park, D. S. Clark, Pressure effects on intra- and intermolecular interactions within proteins. Biochimica et Biophysica Acta (BBA)—Protein Structure and Molecular Enzymology 1595, 235-249 (2002); [8]. J. Britton, J. M. Chalker, C. L. Raston, Rapid Vortex Fluidics: Continuous Flow Synthesis of Amides and Local Anesthetic Lidocaine. Chemistry—A European Journal 21, 10660-10665 (2015)10.1002); [9]. T. Z. Yuan, C. F. G. Ormonde, S. T. Kudlacek, S. Kunche, J. N. Smith, W. A. Brown, K. M. Pugliese, T. J. Olsen, M. Iftikhar, C. L. Raston, G. A. Weiss, Shear-Stress-Mediated Refolding of Proteins from Aggregates and Inclusion Bodies. ChemBioChem 16, 393-396 (2015)10; [10]. J. Britton, C. L. Raston, Continuous flow vortex fluidic production of biodiesel. RSC Advances 4, 49850-49854 (2014)10.1039; [11]. J. Britton, S. B. Dalziel, C. L. Raston, Continuous flow Fischer esterifications harnessing vibrational-coupled thin film fluidics. RSC Advances 5, 1655-1660 (2015); [12]. S. P. Harsha, K. Sandeep, R. Prakash, Non-linear dynamic behaviors of rolling element bearings due to surface waviness. Journal of Sound and Vibration 272, 557-580 (2004); [13]. L. D. Meyer, F. F. Ahlgren, B. Weichbrodt, An Analytic Model for Ball Bearing Vibrations to Predict Vibration Response to Distributed Defects. Journal of Mechanical Design 102, 205-210 (1980); [14]. J. Britton, C. L. Raston, Rapid high conversion of high free fatty acid feedstock into biodiesel using continuous flow vortex fluidics. RSC Advances 5, 2276-2280 (2015); [15]. K. Vimalanathan, X. Chen, C. L. Raston, Shear induced fabrication of intertwined single walled carbon nanotube rings. Chemical Communications 50, 11295-11298 (2014); [16]. L. Yasmin, X. Chen, K. A. Stubbs, C. L. Raston, Optimising a vortex fluidic device for controlling chemical reactivity and selectivity. Sci. Rep. 3, (2013); [17]. M. Ali, A. Umemura, Capillary Phenomena On A Liquid Surface. Journal of Mechanical Engineering ME38, 45-51 (2007); [18]. X. Han, S. Bian, Y. Liang, K. N. Houk, A. B. Braunschweig, Reactions in Elastomeric Nanoreactors Reveal the Role of Force on the Kinetics of the Huisgen Reaction on Surfaces. Journal of the American Chemical Society 136, 10553-10556 (2014); [19]. J. E. Coleman, Structure and Mechanism of Alkaline Phosphatase. Annual Review of Biophysics and Biomolecular Structure 21, 441-483 (1992); [20]. J. Britton, S. B. Dalziel, C. L. Raston, Enhancing the kinetics and thermodynamics of SN2 substitution reactions using vortex fluidic flow chemistry. Submitted (2015).
Example 4—Accelerating Enzymatic Catalysis Using Vortex Fluidics
(215) Abstract:
(216) Enzymes catalyze chemical transformations with outstanding stereo- and regio-specificities, but many enzymes are limited by their long reaction times. There is provided herein a general method to accelerate enzymes using pressure waves contained within thin films. Each enzyme responds best to specific frequencies of pressure waves, and we report acceleration landscapes for each protein. A vortex fluidic device introduces pressure waves that drive increased rate constants (k.sub.cat) and enzymatic efficiency (k.sub.cat/K.sub.m). Four enzymes displayed an average seven-fold acceleration with deoxyribose-5-phosphate aldolase (DERA) achieving an average 15-fold enhancement through this approach. In solving a common problem in enzyme catalysis, we have uncovered a powerful, generalizable tool for enzyme acceleration. This research provides new insights into previously uncontrolled factors affecting enzyme function.
(217) Introduction.
(218) Enzymes make life possible by catalyzing diverse and challenging chemical transformations with exquisite specificity. Applications in both industry [1] and academia [2] rely on the selectivity and power of enzymes to catalyze otherwise challenging transformations. Biocatalysts offer remarkable rate accelerations compared to uncatalyzed reactions, with typical rate accelerations (k.sub.cat/k.sub.uncat) of 10.sup.5- to 10.sup.15-fold faster [3]. Though some enzymes are diffusion-limited [4], the catalytic rates of enzymes are often more typically limited by their catalytic efficiency (k.sub.cat/K.sub.m); additionally, molecular crowding, along with product and substrate inhibition, can reduce enzyme efficiency [5]. Though some enzymes catalyse transformations with rapid rates (e.g., laccases, fumarases and alcohol dehydrogenases) [6], other enzymes operate at only modest reaction rates, requiring long reaction times and carefully optimized conditions; for example, DERA requires long processing times (hours to days), and is substrate-inhibited [7]. There is provided a process that accelerates four different enzymes at standard temperature and pressure. Without wishing to be bound by theory, it is believed that many water-soluble enzymes could be accelerated.
(219) Results and Discussion.
(220) Recently, vortex fluidic devices (VFDs) have been used to accelerate covalent and non-covalent bond formation. VFDs process solutions in thin films by the rapid rotation of a sample tube (
(221) Control reactions with alkaline phosphatase can demonstrate the requirements for high, specific rotational speeds of the VFD to generate a thin film containing the enzyme for accelerated catalysis (
(222) Next, substrate and enzyme concentrations were simultaneously varied for the rapid scanning of reaction space to find effective reaction conditions (
(223) Enzyme acceleration by the VFD is sensitive to the tilt angle of the sample tube and the viscosity of the solution (
(224) The dependence on rotational speeds was also specific to each enzyme (
(225) Michaelis-Menten-based experiments were performed with β-glucosidase, and the kinetic constants for both VFD-processed and non-VFD conditions were derived (Table 2 following). The k.sub.cat in the VFD-mediated reaction was around 2.5-fold faster than the non-VFD reaction (
(226) TABLE-US-00003 TABLE 2 Michaelis-Menten parameters for the VFD vs. non- VFD mediated processing of β-glucosidase.* Non VFD-mediated VFD-mediated rate Parameter reaction acceleration V.sub.max (nM s.sup.−1) 128 ± 5.71 309 ± 52.4 K.sub.M (mM) 3.76 ± 0.15 2.50 ± 0.44 k.sub.cat (s.sup.−1) 13.4 ± 0.59 32.1 ± 5.45 k.sub.cat/K.sub.M (mM.sup.−1s.sup.−1) 3.55 ± 0.19 13.32 ± 4.03 *For this VFD-process, β-glucosidase (9.26 nM), a rotational speed of 7.60 krpm was used, as this provided the most consistent enhancement over sustained time periods. Error indicates the standard deviation around the mean (n = 3). There was no overlapping error at 95% confidence limits. The raw data was fitted to a Michaelis-Menten plot and analyzed using a least squares fitting (LSF) approach (FIGS. 27B-27C, 28B-28C).
(227) Without wishing to be bound by theory, it is believed that enzymes are accelerated in the VFD in part from the instantaneous pressure changes generated by Faraday waves. Three possible mechanisms could harness such pressures. Firstly, transient pressurization of the active site around the substrate could occur. In this situation, a decrease in the active site volume through pressurization [15] could increase the turnover number of the enzyme; such enhancement follows from the Van't Hoff equation [16]. Secondly, pressure-induced protein conformational changes could occur at accelerated rates [17]. As enzymatic catalysis correlates with protein motion, faster protein motions could accelerate catalysis by contributing to the rate-determining process [17]. Thirdly, enzymatic catalysis requires a fine balance between protein stability and conformational flexibility [18]. Pressure-driven conformational changes may increase enzyme activity through β and α-relaxations [19]. These small changes can lead to the acquisition of protein conformations more suited for catalysis [18].
(228) The rotational landscape can be specific for each enzyme and appears to result from enzyme-specific preferences. Single-molecule experiments have elucidated the range of speeds and conformations required for enzymatic catalysis, which are specific for each enzyme [20]. The range of acceleration disclosed herein falls within the expected range of enzyme speeds uncovered through such experiments. Thus, the VFD-driven rate acceleration could shift the distribution of enzyme conformational states to favor catalytic events. It is believed that shaped Faraday waves with specific timing can provide further control and enhancement of biocatalysis.
(229) To recapitulate, control reactions with alkaline phosphatase (MW 46 kDa, E.C 3.1.3.1) confirmed that enzymatic acceleration in the VFD arises from the unique attributes of the device. First, identical enzyme-substrate solutions were centrifuged at 14 krpm (17530 g) to mimic the introduction of centrifugal forces exceeding levels expected inside the VFD sample tube; no increase in enzymatic activity resulted from centrifugation (
(230) TABLE-US-00004 TABLE 3 DLS data Peak 1 Peak 2 Sample PDI (d .Math. nm) (d .Math. nm) Non-VFD processed 0.491 177.2 5271 VFD processed 0.431 176.8 5295 PDI—Polydispersity index; d .Math. nm—mean diameter of particles (nm).
(231) Additionally, the reported acceleration in enzymatic catalysis likely does not result from a temperature increase during VFD processing. We apply short processing times with a dual bearing device to limit temperature variation due to friction. Monitoring by thermal imaging IR camera has shown that the temperature increase for such conditions is <2° C. [2]. In the thermal image (
(232) Centrifuge Control
(233) The enzyme-substrate solution (alkaline phosphatase and p-nitrophenol phosphate) was subjected to centrifugation in a bench top centrifuge at the indicated rotational speeds for 10 min. A direct comparison was then made between a VFD sample and a centrifuged sample (
(234) Control Reaction in a Convention Vortexer.
(235) The enzyme-substrate solution (1.3 mL) (β-glucosidase and 4-nitrophenyl β-D-glucopyranoside) was added to an Eppendorf tube, and vortexed for 10 min at 25° C. before quenching as described herein. No increase in enzyme rates comparable to the VFD-processed solution was observed (
(236) VFD-Processed Vs. Non-VFD-Processed Enzyme Solutions for Analysis in a Kinetic Assay.
(237) To ensure that protein folding was not driving enzymatic acceleration, a comparative kinetic study was performed with VFD-processed and non-VFD-processed β-glucosidase and 4-nitrophenyl β-D-glucopyranoside. In this experiment, β-glucosidase (77 nM solution, 2.00 mL) was added to a sample tube and rotated at 7850 rpm for 10 min. The enzyme was collected and 0.500 mL of treated enzyme added to 0.500 mL of 0.01 M 4-nitrophenyl β-D-glucopyranoside. The solution was immediately mixed and 100 μL was added to a 96-well micro plate for kinetic analysis. As a control, non-VFD-treated enzyme was also tested under identical conditions. There was no significant difference in activities between VFD-processed and non-VFD-processed enzymes.
(238) VFD-Processed Enzyme Vs. Non-VFD-Treated Enzyme Dynamic Light Scattering (DLS) Measurements.
(239) To examine particle size after VFD-processing, DLS measurements were performed on VFD- and non-VFD-processed enzyme solutions. β-glucosidase (77 nM solution, 2.00 mL) was added to a sample tube and rotated at 7850 rpm for 10 min. The enzyme was collected and then centrifuged (24154 g) for 20 min. The solution was then passed through a syringe filter (0.22 μm, 30 mm diameter) into a DLS cuvette and the measurements performed. The results indicated that there are imperceptible differences between the samples (Table 3).
(240) Materials and Methods.
(241) Unless otherwise indicated, all commercially available reagents and solvents were used directly from the supplier without further purification. Technical grade solvents and silica gel (60-120 mesh) were used for column chromatography with visualization accomplished with UV light (254 nm) and/or a potassium permanganate solution (40 g K.sub.2CO.sub.3, 600 mL of water, 6.0 g KMnO.sub.4 and 5.0 mL 2.0 M NaOH). .sup.1H NMR and .sup.13C NMR spectra were recorded at ambient temperature using CDCl.sub.3 (7.27 ppm) or D.sub.6-DMSO (2.50 ppm), unless otherwise indicated on a Brülker 400 MHz spectrometer. Chemical shift values are expressed as parts per million (ppm) and J-values are in Hertz (Hz). Splitting patterns are indicated as s:singlet, d:doublet, t:triplet, q:quartet, hex:hextet or combination, br.s:broad singlet or m:multiplet. The vortex fluid device (VFD) sample tubes were commercial quality borosilicate glass, with an internal diameter of 17.7 mm, and were cleaned with piranha solution (4:1, sulfuric acid: H.sub.2O.sub.2), rinsed with diH.sub.2O, dried using acetone, and stored in an oven at 160° C. prior to usage. FTIR spectra were collected using Perkin Elmer at 25° C. Optical rotation was measured using a Perkin Elmer device at RT using a 1.0 dm3 glass cell. All buffered solutions were prepared with double-deionized water (diH.sub.2O, >18 MΩ) from a Milli-Q water system (Millipore, Bedford, Mass.).
(242) Composition of Non-VFD Solutions.
(243) In a 2.0 mL Eppendorf tube, enzyme and substrate in the appropriate buffer (below) were mixed (final volume of 1.3 mL). The reaction proceeded for the indicated length of time and then quenched as described. A 100 μL aliquot of the reaction mixture was transferred to a 96-well plate (Corning, UV transparent, pathlength of 0.375 cm) and the absorption was measured at the required wavelength (MicroQuant; Biotek Instruments, Winooski, Vt.).
(244) General VFD-Mediated Enzyme Acceleration.
(245) The outside length of the sample tube was lubricated with Dow Corning high vacuum grease before insertion into the VFD. A solution of enzyme and substrate in buffer (1.30 mL) identical to the comparison described above was added to this tube. The sample tube was then stoppered with a B19 S
(246) Enzymes, Buffers and Assays.
(247) Alkaline Phosphatase.
(248) Buffer.
(249) The enzyme buffer, 1.0 M diethanolamine, was prepared as follows: 140 g of diethanolamine was added to 1.0 L of H.sub.2O, then the pH of the solution was adjusted to pH 9.8 at 25° C. with 5 M HCl. This buffer was further diluted to 1 M diethanolamine, and 500 μL of 1 M MgCl.sub.2 was added. The resulting buffer was filtered-sterilized through a 0.22 μm filter (Corning), and stored wrapped in aluminum foil at 4° C.
(250) Assay.
(251) FAsTAP™ thermosensitive alkaline phosphatase (1.0 μL, 0.11 mM) was added to 10 mL of the diethanolamine buffer to generate an enzyme stock solution (11.1 nM). This solution was made fresh every two hours and stored on ice. Each sample was prepared by combining 0.800 mL of the enzyme stock solution and 0.500 mL of alkaline phosphatase liquid substrate system (pNPP, Sigma-Aldrich, 0.435 mM); this solution (1.3 mL) was added to either an Eppendorf or VFD sample tube. The reaction was incubated at 25° C. for 10 min unless otherwise indicated. After this time period, 4.0 M NaOH (150 μL) was added to quench the reaction. The sample (100 μL) was then transferred to a 96-well micro plate reader, and the absorbance measured at 402 nm (λ.sub.max). The molar absorption coefficient of p-nitrophenol after the quench described above was 15644 M.sup.−1cm.sup.−1.
(252) β-Glucosidase.
(253) Buffer.
(254) 50 mM sodium acetate, pH 5.0 buffer was prepared as follows: 4.37 g sodium acetate (anhydrous) was dissolved in 1.0 L diH2O and .sup.˜1.1 mL of glacial acetic acid to generate a buffer of pH 5.0 at 25° C. The buffer was then filtered-sterilized through a 0.22 μm filter and stored at 25° C. Assay: In a 15 mL falcon tube, 5.0 mg of lyophilized β-glucosidase enzyme (Sigma) was re-suspended in 10 mL of 50 mM sodium acetate, pH 5.0 buffer. From this solution, a 100 μL aliquot was transferred to 10 mL of 50 mM sodium acetate, pH 5.0 buffer to create a 77 nM solution. The substrate solution consisted of 0.01 M 4-nitrophenyl β-D-glucopyranoside (31.25 mg) in 10 mL of 50 mM sodium acetate, pH 5.0 buffer. Each sample was prepared by combining 0.325 mL of the enzyme stock solution and 0.975 mL of the substrate stock solution; this solution (1.30 mL total volume) was added to either an Eppendorf or VFD sample tube. The reaction was performed for 10 mM unless otherwise indicated. Then, a solution of 0.70 M glycine, NaOH, pH 10.8 buffer (200 μL) was added to quench the reaction. The sample was then transferred to a 96-well micro plate reader, and the absorbance was measured at 405 nm. The molar absorption coefficient of p-nitrophenol after the quench described above was 9413 M.sup.−1cm.sup.−1.
(255) Esterase.
(256) Buffer.
(257) 50 mM phosphate, pH 7.0 buffer was prepared as follows: 1.459 g of monosodium phosphate and 3.867 g of dibasic phosphate were mixed in 500 mL of diH.sub.2O. The pH of the resulting solution was adjusted to pH 7.0 at 25° C. with 5.0 M HCl. The buffer was then filtered-sterilized through a 0.22 μm filter and stored at 10° C.
(258) Assay.
(259) In a 15 mL falcon tube, 64 mg of p-nitrophenylacetate was re-suspended in 10 mL of ACS R
(260) DERA.
(261) Enzyme assays and also protein production of py-DERA, referred to as DERA, were adapted from previous publications [S3].
(262) Enzyme Production.
(263) Enzyme Assay Buffer.
(264) 100 mM bis-tris propane, pH 8.5 buffer was prepared as follows. 28.23 g bis-tris propane was dissolved into 900 mL NANOpure water. The solution was adjusted to pH 8.5 at 25° C. with .sup.˜5 mL of conc. HCl and a final volume of 1 L. The solution was filtered-sterilized through a 0.22 μm filter and stored at 25° C.
(265) Assay.
(266) The substrate solution was generated by re-suspending 30 mg of 7-deoxyribosyl-4-methylumbelliferone in 3.0 mL of DMSO. The volume was adjusted to 15 mL with 100 mM bis-tris propane, pH 8.5 to generate a final 6.80 mM solution in 20% DMSO. The substrate solution was wrapped in aluminum foil and stored at 25° C.
(267) Enzyme Solution.
(268) After dialyzing the recombinant py-DERA into 100 mM bis-tris propane, pH 8.5, the protein concentration was determined by A.sub.280 using (e=16305 M.sup.−1cm.sup.−1) and a MW of 30906.5 g/mol. A working stock of 8.33 μM enzyme solution was prepared by either diluting with 100 mM bis-tris propane, pH 8.5 or through microconcentration with a 10 kDa cutoff Amicon Ultra-15 Centrifugal Filter (EMD Millipore, Billerica, Mass.). The purity of the protein was confirmed by 12% SDS-PAGE (Coomassie brilliant blue stain,
(269) Enzymes Sources.
(270) Alkaline phosphatase was purchased from Life Technologies (F
(271) Production of Py-DERA
(272) Since py-DERA is not commercially available, the enzyme was prepared using bacterial overexpression as follows.
(273) The gene 2-deoxyribose-5-phosphate aldolase (DERA) from Plasmodium yoelli was purchased from Addgene in DH5 alpha cells (Plasmid #25577). The QlAprep Spin Miniprep Kit (Qiagen) was used as directed by the manufacturer to isolate plasmid DNA from an overnight culture of E. coli cells. The following PCR parameters and oligonucleotides (Eurofins MWG Operon) were used to amplify the py-DERA gene. IPRooF™ DNA Polymerase (BioRad) was used for all PCR amplification steps as directed in the manufacturer's instructions. Ten ng of plasmid #25577 was used as the template for 1 cycle at 95° C. for 1 min, 30 cycles at 95° C. for 1 min, 60° C. for 1 min, and 72° C. for 1 min, and 1 cycle at 72° C. for 5 min
(274) TABLE-US-00005 Lig_DERA_Fwd: (SEQ ID NO: 1) 5′-GAC GAC GAC AAG ATG GCT AAT TAT ACA GAA AAA TTC GCA GCG TGG TCA G-3′; Lig_DERA_Rev: (SEQ ID NO: 2) 5′-GAG GAG AAG CCC GGT TCA TCA CAA TGG ACA TTG AGA AAT AAC TTT TCT CAA TTT TAT CAC TAA TGA TGA TGA-3′.
(275) DNA excised from agarose gels was purified using the QIAquick Gel Extraction Kit (QIAGEN). The purified PCR product was then used with the pET46 Ek/LIC Vector Kit (EMD Millipore Novagen, Billerica, Mass., USA) to generate the py-DERA recombinant protein expression vector. E. coli TOP10 cells (Invitrogen) were used to isolate the plasmid prior to transformation into other heterologous hosts. The DNA was sequencing by standard methods.
(276) Expression and Purification of Py-DERA.
(277) The pET46-pyDERA construct was transformed into E. coli ROSETTA™ (DE3) cells (Novagen). The transformed cells were transferred to an LB agar plate supplemented with 50 μg/mL kanamycin antibiotic, and incubated at 28° C. for 14-16 h. A seed culture was prepared by inoculating a single colony from the transformation plate in 50 mL of 2YT medium with 50 μg/mL kanamycin antibiotic and shaking the culture at 225 rpm for 14-16 h at 28° C. in a 250 mL baffled flask. The expression culture was then prepared by inoculating 10 mL of the seed culture in 1.0 L of TB media (12 g Tryptone, 24.0 g yeast extract, 4.0 mL glycerol, 0.17 M KH2PO4, 0.72 M K2HPO4) with 50 μg/mL kanamycin and shaking the culture at 225 rpm in 28° C. (2.0 L baffled flask). When the optical density of the culture reached A.sub.600 0.6, overexpression of py-DERA protein with a C-terminal 6×His-tag was induced through addition of 0.50 mM isopropyl β-D thiogalactopyranoside (IPTG), and the mixture was incubated further for 36 h at 15° C. with shaking at 225 rpm. The cells were harvested and re-suspended in buffer A (50 mM Hepes pH 7.5, 200 mM NaCl, 10 mM imidazole, 10 mM BME, 5% glycerol, 0.5% CHAPS, 250 units benzonase (Sigma), 1.0 mM PMSF, and 1.0 mM benzamidine). The cell lysate was prepared by sonication (D
(278) Assessment of Enzyme Purity.
(279) SDS-PAGE analyses of the enzymes disclosed herein are depicted in
(280) Calculation of alkaline phosphatase concentration and MW. Because it is a proprietary enzyme solution, the use of FAsTAP™ alkaline phosphatase required estimation of MW by SDS-Page chromatography (
(281) Synthesis of the Fluorophorogenic Substrate for the DERA Assay.
(282) The synthesis of the DERA assay substrate (compound 3) was adapted from the literature [S4]. The scheme follows.
(283) ##STR00001##
(284) Part 1.
(285) Toluenesulfonyl chloride (6.44 g, 33.77 mmol) was added in small portions over the course of one hour to a stirring solution of 1-O-methyl-2-deoxy-D-ribose (5.00 g, 33.77 mmol) in anhydrous pyridine (100 mL). This mixture was stirred vigorously for 15 h. Then, the solvent was removed under reduced pressure to afford a dark gum. The residue was redissolved in EtOAc (150 mL), washed with brine (1.0 M, 50 mL), saturated NaHCO.sub.3 (1.0 M, 50 mL), water (50 mL) and then brine again (50 mL). The organic layer was dried over anhydrous Na.sub.2SO.sub.4, filtered and the solvent removed under reduced pressure to yield a yellow gum. The intermediate product was confirmed by TLC (pure EtOAc, Rf—0.75), and purified by column chromatography (neat EtOAc) to yield crude methyl 5-toluenesulfonyl-2-deoxyribose as an off-white gum, 3.32 g, 33% yield. Compound 2 had .sup.1H and .sup.13C NMR spectra identical to a previous report. [S5]
(286) Part 2:
(287) Crude methyl 5-toluenesulfonyl-2-deoxyriboside (2) (2.00 g, 6.62 mmol) was dissolved in anhydrous DMF (20 mL). K.sub.2CO.sub.3 (1.87 g, 13.24 mmol) and methylumbelliferone (1.47 g, 8.27 mmol) were added to this solution, which was then stirred at 75° C. for 15 h. Next, water (75 mL) was added, and the product extracted with EtOAc (2×50 mL). The organic layer was washed with NaOH (0.1 M, 50 mL), water (20 mL) and then dried using anhydrous MgSO.sub.4. The product solution was concentrated in vacuo, and suspended in acetonitrile (5 mL) and water (15 mL). Dowex-WXD-100 (500 mg) ion exchange resin was added, and the solution stirred for 2 h. Next, the solution was briefly exposed to reduced pressure to remove any generated methanol. The remaining solution was the stirred for two days, filtered and then concentrated under vacuum. The product was purified via column chromatography with an EtOAc:acetone gradient running from 100:0 to 80:20. TLC confirmed the product purity (EtOAc, Rf—0.46). The product (3) was isolated as a thick colorless oil, which formed a white foam under vacuum, 440 mg, 24% yield. .sup.1H NMR (400 MHz, DMSO-d6): δ 7.70-7.67 (m, 1H, CH-1,4-enone), 7.01-6.95 (m, 2H, CH-Aryl), 6.29 (d, J=4.00 Hz, 0.30H, CHa), 6.21 (s, 0.82H, CH), 6.17 (d, J=4.00 Hz, 0.51H, CHß), 5.43-5.39 (0.42H, CHa), 5.35-5.31 (0.46H, CHß), 5.16 (d, J=4.00 Hz, 0.69H) 4.27-3.92 (m, 4H), 2.89 (s, 0.20 Ha), 2.73 (s, 0.21Hß), 2.40 (s, 3H), 2.37-2.33 (m, 1H), 2.00-1.61 (br.m, 2H); 13 C NMR; (100.0 MHz, DMSO-d6) dc 161.6, 160.2, 154.7, 153.4 (CH-1,4-enone), 126.5 113.2, 112.4, 111.2, 101.3, 98.0, 97.0 (CH aryl), 82.9, 80.9, 70.9, 70.7, 70.5, 69.0, 42.1, 39.7, 38.9, 30.7 and 18.1; FTIR (cm.sup.−1) 3400, 2928, 1699, 1608, 1557, 1511, 1427, 1389, 1368, 1281, 1266, 1204, 1149, 1069, 1016, 956, 845, 748, 706 and 636; [α].sup.24,D=+29 (c=0.0016 g/mL, CH.sub.3OH). EIMS calc; 294.1 [M+Na].sup.+, found; 317.1. This compound (3) had .sup.1H and .sup.13C NMR spectra identical to the previous report.[S3].
(288) Reaction Times for VFD-Mediated Acceleration.
(289) Reaction times, also referred to herein as processing times, for alkaline phosphatase, β-glucosidase, esterase and DERA, are depicted in
(290) Variation of Substrate Concentration.
(291) Comparisons of VFD-mediated and Non-VFD-mediated product generation for alkaline phosphatase, β-glucosidase, esterase and DERA are depicted in
(292) β-Glucosidase.
(293) The 65 kDa, dimeric β-glucosidase was dissolved in the appropriate buffer (above) to 77 nM, and the substrate stock solution had a concentration of 0.010 M. For the data in
(294) TABLE-US-00006 TABLE 4A Enzyme and substrate concentration for β-glucosidase and 4-nitrophenyl β-D-glucopyranoside. Enzyme Enzyme Substrate Substrate volume (mL) concentration (nM) volume (mL) concentration (mM) 1.20 71 0.10 0.8 1.10 65 0.20 1.5 1.00 59 0.30 2.3 0.90 53 0.40 3.1 0.80 47 0.50 3.8 0.70 41 0.60 4.6 0.60 35 0.70 5.4 0.50 29 0.80 6.2 0.40 23 0.90 6.9 0.30 17 1.00 7.7 0.20 11 1.10 8.5 0.10 0.5 1.20 9.2
(295) Esterase.
(296) This 62 kDa, trimeric esterase was dissolved in the appropriate buffer disclosed above to 0.806 nM, and the substrate stock solution had a concentration of 0.052 mM. For the data in
(297) TABLE-US-00007 TABLE 4B Enzyme and substrate concentration for esterase and p-nitrophenylacetate. Enzyme Enzyme Substrate Substrate volume (mL) concentration (nM) volume (mL) concentration (μM) 1.20 0.74 0.10 4 1.10 0.68 0.20 8 1.00 0.62 0.30 12 0.90 0.56 0.40 16 0.80 0.50 0.50 20 0.70 0.43 0.60 24 0.60 0.37 0.70 28 0.50 0.31 0.80 32 0.40 0.25 0.90 36 0.30 0.19 1.00 40 0.20 0.12 1.10 44 0.10 0.062 1.20 48
(298) DERA.
(299) The 30 kDa, dimeric DERA was dissolved in the appropriate buffer (above) to 8.33 μM and the substrate stock solution had a concentration of 6.80 mM. For the data in
(300) TABLE-US-00008 TABLE 4C Enzyme and substrate concentration for DERA and Substrate 3/4. Enzyme Enzyme Substrate Substrate volume (mL) concentration (μM) volume (mL) concentration (mM) 1.20 7.69 0.10 0.52 1.10 7.05 0.20 1.05 1.00 6.41 0.30 1.57 0.90 5.77 0.40 2.09 0.80 5.13 0.50 2.62 0.70 4.49 0.60 3.14 0.60 3.85 0.70 3.66 0.50 3.21 0.80 4.18 0.40 2.56 0.90 4.71 0.30 1.92 1.00 5.23 0.20 1.28 1.10 5.78 0.10 0.64 1.20 6.28
(301) Alkaline Phosphatase.
(302) The 36 kDa, dimeric alkaline phosphatase was dissolved in the appropriate buffer (above) to 11 nM, and the substrate stock solution had a concentration of 0.435 mM. For the data in
(303) TABLE-US-00009 TABLE 4D Enzyme and substrate concentrations for alkaline phosphatase and the p-nitrophenyl phosphate liquid substrate system. Enzyme Enzyme Substrate Substrate volume (mL) concentration (nM) volume (mL) concentration (mM) 1.20 10.15 0.10 0.033 1.10 9.31 0.20 0.067 1.00 8.46 0.30 0.10 0.90 7.61 0.40 0.13 0.80 6.77 0.50 0.17 0.70 5.92 0.60 0.20 0.60 5.08 0.70 0.23 0.50 4.23 0.80 0.27 0.40 3.38 0.90 0.30 0.30 2.53 1.00 0.33 0.20 1.69 1.10 0.37 0.10 0.84 1.20 0.40
(304) The Effect of Rotation Speed on Enhancement.
(305) The effect of rotational speed of the VFD device on the fold acceleration of enzymatic catalysis for alkaline phosphatase, b-glucosidase, DERA, and esterase are depicted in
(306) Product Inhibition.
(307) Product inhibition during VFD processing was examined by the following reaction conditions for alkaline phosphatase.
(308) Phosphate Inhibition.
(309) The amount of sodium phosphate, dibasic required for the indicated final concentrations was added to the enzyme buffer, and the pH adjusted to 9.8 with 5.0 M HCl. Then, alkaline phosposphatase was added to 0.80 mL of this solution before transfer to the VFD sample tube. p-Nitrophenyl phosphate liquid substrate solution (0.50 mL) was next added. The solution was rotated for 10 min at the indicated rotational speeds, and then immediately quenched with 4.0 M NaOH (0.150 mL). Analysis proceeded as described herein.
(310) p-Nitrophenyl inhibition. The amount of p-nitrophenol required for the indicated final concentrations was added to the enzyme buffer, and the pH adjusted to 9.8 with 4.0 M NaOH. The experiment proceeded as described above. The absorbance values are higher due to the absorbance of 4-nitrophenoxide in basic solution. See
(311) Crowding Studies.
(312) To explore the ability of VFD-mediated processing to overcome steric crowding reagents, two PEG polymers with average MW of 3350 and 8000 g/mol were added to the alkaline phosphatase-substrate solutions as follows. The appropriate quantities of PEG reagent for the indicated final concentrations were dissolved in diethanolamine buffer (total volume of 10.0 mL). Alkaline phosphatase (1.0 μL) was added, and this enzyme solution (800 μL, 11.1 nM) was added to the p-nitrophenyl phosphate liquid substrate solution (500 μL, 0.435 mM). After 10 min, the reaction was quenched through addition of 4.0 M NaOH (150 μL). The absorbance of the solution was then measured at 402 nm (
(313) Faraday Wave Studies.
(314) The generation and observation of Faraday waves within the VFD device is depicted in
(315) Measuring the Rate of Product Generation with DERA Under VFD-Mediated Conditions.
(316) A standard curve for quantifying concentrations of 4-methylumbelliferone was produced (
(317) Michaelis-Menten Kinetics.
(318) Non-VFD-Mediated Kinetics.
(319) Conventional Michaelis-Menten measurements were performed as follows. The enzyme solution (β-glucosidase, 9.62 nM) and the substrate at the indicated concentration were mixed (1.30 mL total volume) and incubated for 1, 2, 3 and 4 min. Then, 200 μL of the quench solution (as described herein) was added, and the absorbance data collected as previously described. The initial rates of the reaction where calculated and fitted to the Michaelis-Menten equation. The global minimum was found for both Vmax and Km to demonstrate that these values have the lowest sum of squared fitting (SSR), whilst still maintain a good calculated fit to the data. Raw plots of initial rate as a function of substrate concentration are provided in
(320) VFD-mediated kinetics. This comparable experiment applied the conditions above with the following modifications necessary for measuring enzyme kinetics in a rapidly rotating tube. The enzyme β-glucosidase, 9.62 nM) was added to the bottom of VFD sample tube, which had been inserted into the VFD. The substrate solution (775 μL) was then flowed down the side of the sample tube (1.30 mL total volume); this tube was immediately capped, and rotation began. Thus, the enzyme and substrate solutions remained apart until a fraction of a second before the VFD reached the indicated rotation speed. In order to achieve the indicated time points, the VFD motor was stopped 16 s prior to the end of the required time point; thus, each time point indicates the rotational time within 1-2 s. The quenching and measurement steps then followed the protocol described above. Raw plots of initial rate as a function of substrate concentration are provided in
(321) A tabulation of Michaelis-Menten parameters Kmax, KM, kcat and kcat/kM for Non-VFD-mediated reaction and VFD-mediate reaction is set forth in Table 2.
(322) 3D-Printed Interchangeable Plastic Collar and Sleeve.
(323) To maintain the vibrations generating VFD-mediated enzyme acceleration, a 3D printed plastic collar and interchangeable sleeve were created. See
(324) Kinetic Constants for the Enzyme-Substrate Systems Disclosed Herein.
(325) Kinetic constants for the enzyme-substrate system disclosed herein are set forth in Table 5 following.
(326) TABLE-US-00010 TABLE 5 Kinetic constants for the enzyme-substrate systems Kinetic measurement Enzyme and Substrate Kinetic constants conditions FASTAP ™ alkaline Unknown Unknown phosphatase and p- nitrophenylphosphate β-glucosidase and 4- K.sub.M - Literature - 27° C., pH 5.6, 10 nitrophenyl β- Literature - 2.50 mM mM piperazine, 20 mM Dglucopyranoside This work - 3.76 mM sodium acetate, 0.1 mM k.sub.cat -This work - 804 min.sup.−1 EDTA [S6]. k.sub.cat/K.sub.M - This work - 25° C., pH 5.0, 50 Literature - 3.2 × 10.sup.6M.sup.−1min.sup.−1 mM sodium acetate This work - 2.1 × 10.sup.6M.sup.−1min.sup.−1 DERA and substrate 3 Unknown Unknown Esterase and p- K.sub.M - Literature - 0.52 mM pH 7.4, 37° C., 10 mM nitrophenylacetate kcat - Literature - 1209 min.sup.−1 KH.sub.2PO.sub.4 [S7] k.sub.cat/K.sub.M - Literature - 2320 mM.sup.−1min.sup.−1
References
Example 4
(327) [1] a) W. Aehle, Enzymes in Industry, WILEY-VCH, Weinheim, 2004; b) B. M. Nestl, B. A. Nebel, B. Hauer, Curr. Opin. Chem. Biol. 2011, 15, 187-193; c) R. DiCosimo, J. McAuliffe, A. J. Poulose, G. Bohlmann, Chem. Soc. Rev. 2013, 42, 6437-6474; d) D. J. Pollard, J. M. Woodley, Trends Biotechnol. 2007, 25, 66-73; e) J.-M. Choi, S.-S. Han, H.-S. Kim, Biotechnol. Adv. 2015, 33, 1443-1454; [2] a) H. Renata, Z. J. Wang, F. H. Arnold, Angew. Chem. Int. Edit. 2015, 54, 3351-3367; b) Z. J. Wang, H. Renata, N. E. Peck, C. C. Farwell, P. S. Coelho, F. H. Arnold, Angew. Chem. Int. Edit. 2014, 126, 6928-6931; c) J. B. Siegel, A. L. Smith, S. Poust, A. J. Wargacki, A. Bar-Even, C. Louw, B. W. Shen, C. B. Eiben, H. M. Tran, E. Noor, J. L. Gallaher, J. Bale, Y. Yoshikuni, M. H. Gelb, J. D. Keasling, B. L. Stoddard, M. E. Lidstrom, D. Baker, P. Natl. Acad. Sci. USA 2015, 112, 3704-3709; d) S. Wallace, E. P. Balskus, Angew. Chem. Int. Edit. 2015, 54, 7106-7109; e) P. Srivastava, H. Yang, K. Ellis-Guardiola, J. C. Lewis, Nat. Commun. 2015, 6; [3] a) A. S. Bommarius, B. R. Riebel, Biocatalysis, Wiley-VCH, Weinheim, 2004; b) K. M. Koeller, C.-H. Wong, Nature 2001, 409, 232-240; c) V. L. Schramm, Annu. Rev. Biochem. 1998, 67, 693-720; [4] M. E. Stroppolo, M. Falconi, A. M. Caccuri, A. Desideri, CMLS, Cell. Mol. Life Sci. 2001, 58, 1451-1460; [5] D. L. Nelson, M. M. Cox, Lehninger Principles of Biochemistry, 5th ed., W. H. Freeman, New York, 2008; [6] R. Wolfenden, M. J. Snider, Accounts Chem. Res. 2001, 34, 938-945; [7] a) F. Subrizi, M. Crucianelli, V. Grossi, M. Passacantando, G. Botta, R. Antiochia, R. Saladino, ACS Catalysis 2014, 4, 3059-3068; b) W. A. Greenberg, A. Varvak, S. R. Hanson, K. Wong, H. Huang, P. Chen, M. J. Burk, P. Natl. Acad. Sci. USA 2004, 101, 5788-5793; [8] a) J. Britton, S. B. Dalziel, C. L. Raston, Green Chem. 2016, 18, 2193-2200; b) J. Britton, S. B. Dalziel, C. L. Raston, RSC Adv. 2015, 5, 1655-1660; [9] T. Z. Yuan, C. F. G. Ormonde, S. T. Kudlacek, S. Kunche, J. N. Smith, W. A. Brown, K. M. Pugliese, T. J. Olsen, M. Iftikhar, C. L. Raston, G. A. Weiss, ChemBioChem 2015, 16, 393-396; [10] J. Britton, J. M. Chalker, C. L. Raston, Chem. Eur. J. 2015, 21, 10660-10665; [11] a) L. Yasmin, X. Chen, K. A. Stubbs, C. L. Raston, Sci. Rep. 2013, 3; b) J. Britton, C. L. Raston, RSC Adv. 2014, 4, 49850-49854; c) J. Britton, C. L. Raston, RSC Adv. 2015, 5, 2276-2280; [12] F. M. Menger, M. Ladika, J. Am. Chem. Soc. 1987, 109, 3145-3146; [13] K. Zhu, H. Liu, P. Han, P. Wei, Frontiers of Chemical Engineering in China 2010, 4, 367-371; [14] S. Jennewein, M. Schürmann, M. Wolberg, I. Hilker, R. Luiten, M. Wubbolts, D. Mink, Biotechnology Journal 2006, 1, 537-548; [15] N. Hillson, J. N. Onuchic, A. E. García, P. Natl. Acad. Sci. USA 1999, 96, 14848-14853; [16] C. J. T. Kuster, H. W. Scheeren, In High Pressure Chemistry, Wiley-VCH, Weinheim, 2007; [17] S. Hay, N. S. Scrutton, Nat. Chem. 2012, 4, 161-168; [18] K. A. Henzler-Wildman, M. Lei, V. Thai, S. J. Kerns, M. Karplus, D. Kern, Nature 2007, 450, 913-916; [19] U. R. Shrestha, D. Bhowmik, J. R. D. Copley, M. Tyagi, J. B. Leão, X.-q. Chu, P. Natl. Acad. Sci. USA 2015, 112, 13886-13891; [20] a) P. C. Sims, I. S. Moody, Y. Choi, C. Dong, M. Iftikhar, B. L. Corso, O. T. Gul, P. G. Collins, G. A. Weiss, J. Am. Chem. Soc. 2013, 135, 7861-7868; b) S. Xie, Single Mol. 2001, 2, 229-236; [S1] a) L. A. Lerin, R. A. Loss, D. Remonatto, M. C. Zenevicz, M. Balen, V. O. Netto, J. L. Ninow, C. M. Trentin, J. V. Oliveira, D. Oliveira, Bioproc. Biosyst. Eng. 2014, 37, 2381-2394; b) F. I. Braginskaya, E. A. Zaitzeva, O. M. Zorina, O. M. Poltorak, E. S. Chukrai, F. Dunn, Radiat. Environ. Bioph. 29, 47-56; [S2] J. Britton, S. B. Dalziel, C. L. Raston, Green Chem. 2016, 18, 2193-2200; [S3] M. Vedadi, J. Lew, J. Artz, M. Amani, Y. Zhao, A. Dong, G. A. Wasney, M. Gao, T. Hills, S. Brokx, W. Qiu, S. Sharma, A. Diassiti, Z. Alam, M. Melone, A. Mulichak, A. Wernimont, J. Bray, P. Loppnau, O. Plotnikova, K. Newberry, E. Sundararajan, S. Houston, J. Walker, W. Tempel, A. Bochkarev, I. Kozieradzki, A. Edwards, C. Arrowsmith, D. Roos, K. Kain, R. Hui, Mol. Biochem. Parasit. 2007, 151, 100-110; [S4] W. A. Greenberg, A. Varvak, S. R. Hanson, K. Wong, H. Huang, P. Chen, M. J. Burk, P. Natl. Acad. Sci. USA 2004, 101, 5788-5793; [S5] D. Wang, W. A. Nugent, J. Org. Chem 2007, 72, 7307-7312; [S6] M. P. Dale, H. E. Ensley, K. Kern, K. A. R. Sastry, L. D. Byers, Biochemistry-US 1985, 24, 3530-3539; [S7] C. P. Landowski, P. L. Lorenzi, X. Song, G. L. Amidon, J. Pharm. Exp. Thera. 2006, 316, 572-580.
Example 5—Ten-Minute Protein Purification and Assembly Line Creation for Continuous Flow Biocatalysis
(328) Abstract.
(329) Nature applies enzyme-driven assembly lines for the synthesis of bioactive compounds. Inspired by nature's capabilities for complex organic synthesis, we report a facile method for spatially segregating attached enzymes in a continuous flow system. Using His.sub.n-tag epitope complexation makes this strategy broadly applicable and telescopes protein immobilization and consequent purification. Six different proteins from complex cell lysates required only ten minutes processing for purification to >85% homogeneity. Furthermore, this “reaction-ready” system demonstrated excellent stability during five days of continuous flow processing. Towards multistep transformations in continuous flow, proteins were arrayed as ordered zones (up to 28) on the reactor surface allowing segregation of reaction conditions and catalysts. Choosing enzymes and ordering them into zones could open new opportunities for continuous flow biosynthesis.
(330) Introduction.
(331) Over millions of years, organisms have evolved highly efficient biosynthetic pathways to construct complex molecules through enzymatic assembly lines [1]. Polyketide biosynthesis, for example, uses multiple proteins, including some with multiple domains, to perform iterative synthetic transformations acting upon intermediate compounds. During these pathways, mobile scaffolds carry intermediates between enzyme active sites, termed substrate channeling [1f,2]. Such pathways can generate an enormous range of bioactive secondary metabolites, and substrate channeling can enhance reaction efficiency and yields [3]. Inspired by these biosynthetic pathways, multistep continuous flow offers an analogous approach in vitro.
(332) Elegant multistep continuous flow systems have provided access to numerous APIs [4] including artemisinin [4h], rufinamide [5] and efavirenz [6]. Though relatively unexplored, multistep biosynthesis in continuous flow could provide two major benefits to API synthesis. First, starting materials, reagents and enzymatic catalysts from nature can reduce the environmental impacts associated with syntheses. Second, all natural products are synthesized through cassettes of enzymes linked in biosynthetic pathways analogous to continuous flow systems; such examples could provide a roadmap for in vitro implementation of nature's powerful synthetic technology.
(333) Recently, we have applied a vortex fluidic device (VFD) to drive formation of thin films for continuous flow syntheses and process improvements, including single [7] and multistep transformations [8], protein folding [9], and biocatalysis [10]. The VFD confines reagents to a thin film (with ≈250 μM thickness) through rapid rotation of an angled reactor. VFD-mediated processing has several advantages over conventional processing including micro-mixing and vibrational effects [7c,7d] that can accelerate covalent and non-covalent bond formation.
(334) Results and Discussion.
(335) We report a simple, efficient, and rapid approach to immobilize and purify proteins in a VFD reactor. Our initial approach to immobilize proteins for continuous flow biocatalysis applied non-specific glutaraldehyde attachments to the reactor surface..sup.[11] Although this generated a highly efficient continuous flow system for individual proteins, the method proved unworkable for creating the distinct enzyme zones necessary for enzymatic assembly lines. Specifically, the relatively slow kinetics of this attachment method prevented confinement of each enzyme to a specific zone of the reactor. Yields of attached enzymes were around 1%, which is too low for applications requiring enzymes with low catalytic rates. Here, this problem is solved using the rapid kinetics of polyhistidine attachment to IMAC resin, allowing formation of distinct enzymatic zones for multistep biocatalysis with nearly quantitative yields of attached enzymes. Furthermore, all proteins fused to a polyhistidine tag are amenable to ten-minute purification from cell lysates and then direct use for biocatalysis in continuous flow.
(336) Telescoping protein immobilization, purification, and subsequent catalysis in a single reactor removes time consuming steps associated with biocatalysis. First, this approach does not require isolation of the pure protein before immobilization. Operating in non-clogging thin films allows the cell lysate to be applied directly to the sidewall of the reactor without centrifugation or other processing, which saves hours of time. An identical slurry of cell lysate immediately blocked conventional protein purification apparatus (FPLC) with cell debris (data not shown). Using centrifuged and non-centrifuged cell lysate provided consistently high levels of protein immobilization and protein purity of ˜96% and >76%, respectively, demonstrating that this system is not only rapid, but also efficient (
(337) The model proteins mCherry and enhanced green fluorescent protein (eGFP) allowed optimization of protein immobilization and their consequent purification. These fluorescent proteins allowed rapid quantification of several reaction parameters including optimal binding, purification conditions and protein stability in the reactor. Using 60 mg/cm.sup.2 of silica-based IMAC resin (100 cm.sup.2 reactor surface) resulted in high immobilization efficiencies for a wide range of protein concentrations (5-50 μM,
(338) Optimization allows reactor construction in only ten minutes with each reactor providing multiple days of reactivity (
(339) The protein bound to the reactor through the IMAC-polyhistidine complex exhibits remarkable stability. After five days of continuous flow processing with a 1.0 mL min.sup.−1 flow rate, only 0.34% of the protein bound to the surface of the reactor was leached away from the reactor. This percentage was determined through analysis of both the flow-through and the quantities of protein retained on the reactor (
(340) To demonstrate the generalizability of this approach, six proteins being used in our laboratory were purified and attached to VFD reactors. These proteins include esterase, phosphodiesterase, alkaline phosphatase, eGFP, mCherry and tobacco epi-aristolochene synthase (TEAS, a terpene cyclase)..sup.[12] Biosynthetic pathways often rely on enzymes with less than ideal properties for in vitro biochemical assays; TEAS, for example, is a poorly expressed and troublesome protein with questionable stability. The rapid and straightforward purification of TEAS demonstrates the generalizability of this approach. The expedience of a 10 min purification process is invaluable for balky proteins like TEAS, which readily aggregate and precipitate out of solution.
(341) Well-defined stripes containing different immobilized proteins can be applied to the reactor surface (
(342) Here, we report reactors immobilized with two different proteins coating either equal or unequal zone lengths (
(343) To illustrate the advantages of spatially segregated reaction zones, a multistep biosynthetic synthesis were developed that produced colorimetric responses at each step (
(344) The approach reported here opens possibilities for rapid implementation of biosynthetic catalysis in continuous flow. Retrosynthetic analysis of a target compound could suggest appropriate enzymes and their sequential configuration into reaction zones as illustrated here. Spatial segregation and the specific ordering of enzyme zones could facilitate such syntheses. Then, each enzyme could be synthesized in cells after transformation with the appropriate synthetic DNA before ordered coating onto the reactor surface as cell lysates.
(345) Our laboratory has now demonstrated two key fundamental concepts for in vitro, continuous flow multistep biocatalysis. First, the VFD can accelerate enzymatic activity via an increase in k.sub.cat/k.sub.M..sup.[11] Second, we here demonstrate near quantitative immobilization from complex cell lysate in ten minutes using continuous flow. Combining these advancements now allows us to explore biocatalytic assembly lines for generation of vital compounds such as polyketides in continuous flow. Such complex multi-domain enzymes are often sluggish in vitro. Combining high levels of immobilization and VFD-mediated acceleration could promote optimal reactivity. We foresee that this methodology could create efficient continuous flow systems for on-demand compound generation harnessing the power of nature. Ultimately, multi-day continuous flow could produce diverse compounds for customized therapeutics or research applications.
(346) Materials and Methods and Supplemental Data
(347) Unless otherwise indicated, all commercially available reagents and solvents were used directly from the supplier without further purification. The vortex fluid device (VFD) sample tubes were commercial quality borosilicate glass, with an internal diameter of 17.7 mm Prior to use, each sample tube was cleaned with piranha solution (4:1, sulfuric acid: H.sub.2O.sub.2), rinsed with diH.sub.2O, dried using acetone, and stored in an oven at 160° C. All buffered solutions were prepared with double-deionized water (diH.sub.2O, >18 MΩ) from a Milli-Q water system (Millipore, Bedford, Mass.).
(348) Enzymes, Buffers and Assays
(349) mCherry
(350) Buffer:
(351) 50 mM H.sub.2NaPO.sub.4 and 150 mM NaCl was prepared as follows: H.sub.2NaPO.sub.4 (5.999 g) and NaCl (8.766 g) were added to 1.0 L of deionized H.sub.2O and the pH of the solution adjusted to 8.0 at 25° C. with HCl. The buffer was filter-sterilized through a 0.22 μm filter (Corning), and stored at 25° C.
(352) Protein Solution:
(353) After dialyzing recombinant mCherry into the buffer described above, the protein concentration was determined by measuring its A.sub.280 using extinction of 34380 M.sup.−1cm.sup.−1 and a MW of 29257 g mol.sup.−1. Protein concentration was adjusted either by diluting with buffer or through concentrating with a 10 kDa cutoff concentrator (Sartorius). The purity of the protein was confirmed by 12% SDS-PAGE (
(354) eGFP
(355) Buffer:
(356) 50 mM Na.sub.2PO.sub.4, 300 mM NaCl and 10 mM β-mercaptoethanol was prepared as follows: H.sub.2NaPO.sub.4 (3.000 g), NaCl (8.766 g) and 350 μL of β-mercaptoethanol were added to 500 mL of deionized H.sub.2O and the pH of the solution adjusted to pH 8.0 at 25° C. with HCl. The buffer was filter-sterilized through a 0.22 μm filter and stored at 25° C.
(357) Protein Solution:
(358) After dialyzing recombinant eGFP into the buffer described above, protein concentration was determined by A.sub.280 using extinction of 20000 M.sup.−1 cm.sup.−1 and a MW of 30152.8 g mol.sup.−. Protein concentration was adjusted either by diluting with buffer or through concentrating with a 10 kDa cutoff concentrator. The purity of the protein was confirmed by 12% SDS-PAGE (
(359) Alkaline Phosphatase
(360) Reaction Buffer:
(361) 50 mM diethanolamine, 40 mM NaCl, 1 mM MgCl.sub.2.6H.sub.2O, 1 mM NiCl.sub.2.6H.sub.2O, at pH 9.8 buffer was prepared as follows: NaCl (2.324 g), MgCl.sub.2.6H.sub.2O (203 mg) and NiCl.sub.2.6H.sub.2O (237 mg) were dissolved in 800 mL of diH.sub.2O. Diethanolamine (5.257 g) was added to this solution, and the pH adjusted to 9.8 with 1 M NaOH at 25° C. The buffer was then filtered-sterilized through a 0.22 μm filter and stored at 4° C.
(362) Dialysis Buffer:
(363) 300 mM Tris-HCl, pH 8.0 buffer was prepared as follows: Tris-HCl (47.28 g) was dissolved in 1.0 L of diH.sub.2O. The pH of the solution was adjusted to 8.0 with 6 M NaOH at 25° C. The buffer was stored at 25° C.
(364) Assay:
(365) 1 mL of activity buffer containing 0.70 mM bis(p-nitrophenyl) phosphate sodium salt was added to glass LCMS vial. The solution was warmed to the required temperature for the specific reaction (25° C.-70° C.) in a heating block for two min. After this time, 50 μL of 6.15 μM alkaline phosphatase was added to the solution. The reactions were typically performed for five min. unless otherwise indicated. After the reaction had subsided, 200 μL of 4 M NaOH was added to quench the reaction and 200 μL of this solution was then transferred to a 96-well polystyrene plate (Costar) to measure its absorbance at 405 nm. The molar absorption coefficient of p-nitrophenol after the quench described above was 4242 M.sup.−1 cm.sup.−1.
(366) Enzyme Solution:
(367) After dialyzing recombinant alkaline phosphatase, the protein concentration was determined by A.sub.280 using extinction of 32890 M.sup.−1 cm.sup.−1 and a MW of 50212.3 g mol.sup.−1. Enzyme concentration was altered either by diluting with buffer or through concentration with a 10 kDa cutoff concentrator. The purity of the protein was confirmed by 12% SDS-PAGE (
(368) Phosphodiesterase
(369) Reaction Buffer:
(370) 50 mM diethanolamine, 40 mM NaCl, 1 mM MgCl.sub.2.6H.sub.2O, 1 mM NiCl.sub.2.6H.sub.2O, at pH 9.8 buffer was prepared as follows: NaCl (2.324 g), MgCl.sub.2.6H.sub.2O (203 mg) and NiCl.sub.2.6H.sub.2O (237 mg) were dissolved in 800 mL of diH.sub.2O. Diethanolamine (5.257 g) was added to this solution, and the pH adjusted to 9.8 with 1 M NaOH at 25° C. The buffer was then filtered-sterilized through a 0.22 μm filter and stored at 4° C.
(371) Dialysis Buffer:
(372) Phosphate-buffered saline (PBS, 137 mM NaCl, 2.7 mM KCl, 10 mM Na.sub.2HPO.sub.4, 1.8 mM KH.sub.2PO.sub.4, pH 7.2) buffer was prepared as follows: NaCl (8.00 g), KCl (0.20 g), Na2HPO.sub.4 (1.15 g) and KH.sub.2PO.sub.4 (0.20 g) were dissolved in 800 mL of diH.sub.2O. The pH of the solution was adjusted to 7.2 with 1 M HCl at 25° C. The volume of the buffer was then adjusted to 1.0 L and then filtered-sterilized through a 0.22 μm filter and stored at 25° C.
(373) Assay:
(374) To a 2 mL Eppendorf tube was added 1 mL of the buffer containing 0.01 M bis(p-nitrophenyl) phosphate sodium salt. The solution was warmed to the required temperature for the specific reaction (25° C.-70° C.) in a heating block for three min. After this time, 0.1 μL of the dialyzed phosphodiesterase was added to the solution and the reaction assayed for the indicated times. After the reaction time had subsided, 300 μL of 4 M NaOH was added to terminate the reaction. 100 μL of this sample was then transferred to a 96-well micro plate reader, and the solution's absorbance was measured at 405 nm. The molar absorption coefficient of p-nitrophenol after the quench described above was 4242 M.sup.−1 cm.sup.−1. Enzyme solution: After dialyzing the recombinant phosphodiesterase into the buffer described above, the protein concentration was determined by Bradford assay. A working solution of 2 mg mL.sup.−1 enzyme was prepared by diluting the enzyme with buffer or through concentration with a 10 kDa concentrator. The purity of the protein was confirmed by 12% SDS-PAGE (
(375) Esterase
(376) Reaction Buffer:
(377) 50 mM HPO.sub.4.sup.3− at pH 7.0 was prepared as follows: H.sub.2NaPO.sub.4 (1.459 g) and of HNa.sub.2PO.sub.4 (3.867 g) were dissolved in 500 mL of diH.sub.2O. The pH of the resulting solution was adjusted to 7.0 at 25° C. with 5.0 M HCl. The buffer was then filtered-sterilized through a 0.22 μm filter and stored at 10° C.
(378) Dialysis Buffer:
(379) PBS (137 mM NaCl, 2.7 mM KCl, 10 mM Na.sub.2HPO.sub.4, 1.8 mM KH.sub.2PO.sub.4, pH 7.2) buffer was prepared as follows: NaCl (8.00 g), KCl (0.20 g), Na.sub.2HPO.sub.4 (1.15 g) and KH.sub.2PO.sub.4 (0.20 g) were dissolved in 800 mL of diH.sub.2O. The pH of the solution was adjusted to pH 7.2 with 1 M HCl at 25° C. The volume of the buffer was then adjusted to 1.0 L and then filtered-sterilized through a 0.22 μm filter Immediately before dialysis, 10% v/v glycerol was added into the solution to maintain protein solubility.
(380) Assay:
(381) In a 15 mL falcon tube, 64 mg of p-nitrophenylacetate was re-suspended in 10 mL of ACS REAGENT SELECT™ grade methanol (Sigma) to generate a stable solution that was stored at 4° C. Then, 3.0 mL of this solution was added to 100 mL of H.sub.2O with rapid mixing before further dilution with 100 mL phosphate buffer (50 nM, pH 7.0) in generating a 0.052 mM stock solution. Esterase (1 μL, 0.038 mM) was diluted into 10 mL of phosphate buffer for testing the enzymatic activity at different temperatures using a heat block. The working enzyme stock (200 μL) was added to the substrate solution (1.10 mL), and the reaction was performed for five min. The reaction was quenched by addition of 1.00 mL of propanol, and 100 μL of the sample was transferred to a 96-well plate before measuring its absorbance at 405 nm. The molar absorption coefficient of p-nitrophenol in the solution described above was 6423 M.sup.−1 CM.sup.−1.
(382) Enzyme Solution:
(383) After dialyzing the recombinant esterase into PBS at pH 8.0, the protein concentration was determined by measuring its A.sub.280 using extinction 38390 M.sup.−1 cm.sup.−1 and a MW of 38293.2 g mol.sup.−1. A working stock of 8.33 μM enzyme solution was prepared by either diluting with buffer or through concentration with a 10 kDa concentrator. The purity of the protein was confirmed by 12% SDS-PAGE (
(384) Tobacco Epi-Aristolochene Synthase (TEAS)
(385) Buffer:
(386) PBS (137 mM NaCl, 2.7 mM KCl, 10 mM Na.sub.2HPO.sub.4, 1.8 mM KH.sub.2PO.sub.4, 10 mM β-mercaptoethanol, pH 7.2) buffer was prepared as follows: NaCl (8.00 g), KCl (0.20 g), Na.sub.2HPO.sub.4 (1.15 g) and KH.sub.2PO.sub.4 (0.20 g) were dissolved in 800 mL of diH.sub.2O. The pH of the solution was adjusted to pH 7.2 with 1 M HCl at 25° C. The volume of the buffer was then adjusted to 1.0 L and then filtered-sterilized through a 0.22 μm filter Immediately before dialysis, 7.5% v/v glycerol and β-mercaptoethanol (2.805 mL) were added to the solution to maintain protein solubility and stability.
(387) Enzymes
(388) Production of mCherry
(389) Since mCherry containing a polyhistidine tag is not commercially available, the enzyme was prepared using bacterial overexpression as follows:
(390) The gene mCherry from Discosoma sp. was purchased from Addgene (Plasmid #27705). The following PCR parameters and oligonucleotides (Integrated DNA Technologies) were used to amplify the mCherry gene. Iproof DNA Polymerase (BioRad) was used for all PCR amplification steps as directed in the manufacturer's instructions. Ten ng of plasmid #27705 was used as the template for one cycle at 95° C. for five min, 29 cycles at 95° C. for one min, 60° C. for one min, and 72° C. for one min, and one cycle at 72° C. for five min
(391) TABLE-US-00011 mCherryfwd: (SEQ ID NO: 3) 5′-GAC GAC GAC AAG GTA GTA GTA GTA GTA GTA ATG GTG AGC AAG GGC GAG GAG GAC AAC ATG GCC ATC-3′. mCherryrev: (SEQ ID NO: 4) 5′-GAG GAG AAG CCC GGT TCA CTT GTA CAG CTC GTC CAT GCC GCC GGT GGA GTG GCG GCC CTC-3′.
(392) The DNA was then extracted from a 1% agarose gel using a Zymoclean Gel DNA Recovery Kit. This DNA was then used with the pET46 Ek/LIC Vector Kit (EMD Mollipore Novagen, Billerica, Mass., USA) to generate the mCherry protein expression vector. To isolate the plasmid, E. coli NovaBlue cells were used (EMD Millipore, PureLink Quick Plasmid Miniprep Kit) prior to transforming into other heterologous hosts.
(393) Expression and Purification of mCherry
(394) The pET46-mCherry construct was transformed via heat shock into E. coli BL21 Mar (DE3) cells. The transformed cells were transferred to an LB agar plate supplemented with 50 μg/mL carbenicillin antibiotic, and incubated at 37° C. for 14-16 h. A seed culture was prepared by inoculating a single colony from the plate into 5 mL of LB medium with 50 μg/mL carbenicillin antibiotic before shaking at 220 rpm for 6-7 h at 37° C. in a 13 mL culture tube. The expression culture was then prepared by inoculating 5 mL of the seed culture per 1.0 L of LB media with 50 μg/mL carbenicillin and then shaking at 220 rpm at 37° C. When the optical density of the culture reached A.sub.600-0.6, overexpression of mCherry protein with an N-terminal His.sub.12 tag was induced through the addition of 0.1 mM IPTG. The induced expression culture was incubated at 20° C. for 18-20 h shaking at 220 rpm. The cells were harvested and resuspended in buffer (50 mM NaH.sub.2PO.sub.4, 100 mM NaCl pH 8.0, and 100 μL of Halt Protease Inhibitor Cocktail ((100×) from ThermoFisher (cat #78430, AEBSF (1 mM), aprotinin (800 nM), betastatin (50 uM), E64 (15 uM), leupeptin (20 uM), pepstatin A (10 uM)). The cell lysate was prepared by sonication (Digital Sonifier 450, Branson, USA; std. horn, T<8° C., 4×60 s pulses (1 s on, 2 off), 50% amplitude), and the supernatant purified by VFD-mediated purification as described below. Fractions containing purified protein identified by SDS-PAGE were pooled and concentrated in a 10 kDa concentrator. The purity of the protein was confirmed using 12% SDS-PAGE (
(395) Production, Expression and Purification of eGFP
(396) The eGFP gene was sub-cloned into a pET-28 vector using Ndel and EcoRI restriction enzymes for bacterial protein expression. The vector was first transformed via heat shock into E. coli BL21 Mar (DE3) cells. The transformed cells were transferred to an LB agar plate supplemented with 50 μg/mL kanamycin antibiotic, and incubated at 37° C. for 10-12 h. A seed culture was prepared by inoculating a single colony from the transformation plate into 5 mL of LB supplemented with 50 μg/mL kanamycin antibiotic, then shaking at 220 rpm for 6-7 h at 37° C. in a 15 mL culture tube. The expression culture was then prepared by inoculating 5 mL of the seed culture per 1.0 L of LB supplemented with 50 μg/mL kanamycin, then shaking at 220 rpm at 37° C. When the optical density of the culture reached A.sub.600-0.7, overexpression of eGFP protein with an N-terminal His.sub.6 tag was induced through the addition of 0.5 mM IPTG. The induced expression culture was incubated at 37° C. for 3 h shaking at 170 rpm. The cells were harvested and resuspended in buffer (50 mM NaH.sub.2PO.sub.4, 100 mM NaCl pH 8.0, 100 μL of Halt Protease Inhibitor Cocktail). The cell lysate was prepared by sonication (Digital Sonifier 450, Branson, USA; std. horn, T<8° C., 4×60 s pulses (1-sec on, 2-sec off), 50% amplitude), and the supernatant was purified by VFD-mediated purification as described below. Fractions containing purified protein identified by SDS PAGE were pooled and concentrated with a 5 kDa concentrator. The purity of the protein was confirmed using 12% SDS-PAGE (
(397) Production of Alkaline Phosphatase
(398) Since alkaline phosphatase containing a polyhistidine tag is not commercially available, the enzyme was prepared using bacterial overexpression as follows.
(399) The alkaline phosphatase gene was extracted from the genomic DNA of BL21 Mar (DE3) Escherichia coli as follows: 3.0 mL of BL21 Mar (DE3) cells were cultured overnight in LB at 37° C. with shaking at 220 rpm, and were then centrifuged at 14,000 rpm for two min. The supernatant was discarded and the resulting pellet resuspended in 600 μL of lysis buffer (4.67 mL TE buffer, 300 μL 10% SDS, 0.011 g proteinase K, and 10 μL RNAase), and incubated at 37° C. for one h. Following this, 300 μL of phenol and 300 μL of chloroform were added, and the sample was mixed via inversion until homogeneous. The mixture was then centrifuged for five min at 14 krpm, and the upper aqueous phase was extracted. Another 250 μL portion of both phenol and chloroform were added to the sample before mixing and centrifuging as before. After removing the aqueous phase, three volumes of −20° C. molecular biology grade ethanol were added to the sample. The sample was stored at −20° C. for 45 min, and then spun down at 14 krpm for ten min. Once the supernatant was discarded, 1 mL of 70% ethanol was added and the sample was spun at 14 krpm for two min. The supernatant was again discarded, and the DNA allowed to air dry before final resuspension in TE buffer (100 μL).
(400) The following PCR parameters and oligonucleotides were used to extract the alkaline phosphatase gene from the genomic DNA and subsequently clone it into a Novagen pET46 vector. Herculase ii Fusion DNA polymerase (Agilent Technologies) was used for all PCR amplification steps as directed in the manufacturer's instructions. Touchdown cycling was performed to carry out PCR amplification: one cycle at 98° C. for 30 s, 33 cycles at 98° C. for 10 s, 79.8° C. for 30 s (with a decrease of 0.5° C. every cycle), 72° C. for 30 s, 19 cycles at 98° C. for 10 s, 55.8° C. for 30 s, 72° C. for 3 min 30 s, one cycle at 72° C. for 5.5 min.
(401) TABLE-US-00012 EcoliAPForward: (SEQ ID NO: 5) 5′-GAC GAC GAC AAG ATG GTG AAA CAA AGC ACT ATT GCA CTG GCA CTC TTA CCG-3′. EcoliAP6HReverse: (SEQ ID NO: 6) 5′-GAG GAG AAG CCC GGT TCA TCA GTG GTG GTG GTG GTG GTG TTT CAG CCC CAG GGC-3′.
(402) The PCR amplification product was extracted from a 1% agarose gel and purified with the Zymoclean Gel DNA Recovery Kit. The gel-extracted DNA was then used with the pET46 Ek/LIC Vector Kit to generate the AP protein expression vector. E. coli NovaBlue cells were used to isolate the plasmid with the PureLink Quick Plasmid Miniprep Kit prior to transformation into other heterologous hosts.
(403) Expression and Purification of Alkaline Phosphatase
(404) The pET46-AP construct was transformed via heat shock into E. coli BL21 Mar (DE3) cells. The transformed cells were transferred to an LB agar plate supplemented with 50 μg/mL carbenicillin antibiotic, and incubated at 37° C. for 14-16 h. A seed culture was prepared by inoculating a single colony from the transformation plate into 5 mL of LB medium with 50 μg/mL carbenicillin antibiotic, then shaking at 220 rpm for 6-7 h at 37° C. in a 15 mL culture tube. The expression culture was then prepared by inoculating 5 mL of the seed culture per 1.0 L of LB media with 50 μg/mL carbenicillin, then shaking at 220 rpm at 37° C. When the optical density of the culture reached A.sub.600 0.6-0.7, overexpression of AP protein with a C-terminal His.sub.6 tag was induced through the addition of 0.5 mM IPTG. The induced expression culture was incubated at 30° C. for 18-20 h shaking at 220 rpm. The cells were harvested and resuspended in buffer (300 mM Tris-HCl, pH 8.0, 20% w/v sucrose, 0.1 mg/mL lysozyme and 100 μL protease inhibitor cocktail) and allowed to shake at 150 rpm at 4° C. for one h. The cell lysate was prepared by sonication as previously described, and the supernatant then purified by VFD-mediated purification as described below. Fractions containing purified protein identified by SDS PAGE were pooled and concentrated using a 10 kDa concentrator. The purity of the protein was confirmed using 12% SDS-PAGE (
(405) Production of Phosphodiesterase
(406) Since phosphodiesterase fused to a polyhistidine tag is not commercially available, the enzyme was prepared using bacterial overexpression and purification as follows.
(407) The open reading frame encoding phosphodiesterase from M. Jannashchii was amplified as follows from a plasmid purchased from Addgene in DH5α cells (Plasmid #11538).
(408) The QIAprep Spin Miniprep Kit was used as directed by the manufacturer to isolate plasmid DNA from an overnight culture of E. coli cells. The following PCR parameters and oligonucleotides were used to amplify the gene encoding phosphodiesterase. I-proof DNA polymerase was used for all PCR amplification steps as directed in the manufacturer's instructions. Here, plasmid (0.25 μL, #11538), 25 mM DNTP's (0.25 μL), 10×PFU buffer (2.50 μL), forward and reverse primers (0.25 μL), I proof enzyme (0.50 μL) and diH.sub.2O (21.0 μL) were subjected to the PCR conditions: one cycle at 98° C. for five min, 25 cycles at 98° C. for one min, 65° C. for one min, and 72° C. for one min, and one cycle at 72° C. for five min.
(409) TABLE-US-00013 Lig_Phosphodiesterase_Forward: (SEQ ID NO: 7) 5′-GAC-GAC-GAC-AAG-ATG-AAA-ATT-GGG- ATA-ATG-AGC-GAT-ACC-CAT-GAC-3′. Lig_Phosphodiesterase_Reverse: (SEQ ID NO: 8) 5′-GAG-GAG-AAG-CCC-GGT-TCA-TCA-TAA- CAC-TAT-CTC-CCT-ATA-CTC-CTT-3′..
(410) The resultant DNA fragment (≈498 base pairs) was excised from a 1% agarose gel and purified using the QIAquick Gel Extraction Kit. The purified PCR product was then used with the pET46 Ek/LIC Vector Kit to generate the phosphodiesterase recombinant protein expression vector. E. coli Nova blue cells were used to isolate the plasmid prior to transformation into other heterologous hosts.
(411) Expression and Purification of Phosphodiesterase
(412) The pET46-phosphodiesterse construct was transformed via heat shock into E. coli BL21 (DE3) cells. The transformed cells were transferred to an LB agar plate supplemented with 50 μg/mL carbenicillin antibiotic, and incubated at 28° C. for nine h. A seed culture was prepared by inoculating a single colony from the transformation plate into 90 mL of LB medium with 50 μg/mL carbenicillin antibiotic and shaking the culture at 225 rpm for 14-16 h at 37° C. in a 250 mL baffled flask. The expression culture was then prepared by inoculating 10 mL of the seed culture into 1.0 L of LB media with 50 μg/mL carbenicillin and shaking the culture at 225 rpm in 37° C. (2.0 L baffled flask). When the culture reached an A.sub.600 of 0.6, overexpression of phosphodiesterase protein with a C-terminal His.sub.6 tag was induced through addition of 0.50 mM IPTG and the mixture was incubated further for three h at 37° C. with shaking at 225 rpm. The cells were harvested and re-suspended in buffer A (50 mM NaH.sub.2PO.sub.4, pH 8.0, 300 mM NaCl, 10 mM β-mercaptoethanol, 100 μL protease inhibitor cocktail). The cell lysate was prepared by sonication as previously described, and the supernatant was purified by VFD-mediated purification as described below. Fractions containing purified protein identified by SDS-PAGE were pooled and concentrated using a 3 kDa concentrator. The purity of the protein was confirmed using 12% SDS-PAGE (
(413) Production of Esterase
(414) Since an esterase containing a polyhistidine tag is not commercially available, the enzyme was prepared using bacterial overexpression as follows.
(415) The genomic DNA of Lactobacillus plantarum was purchased from ATCC (#8014D-5). The following PCR parameters and oligonucleotides (IIDT) were used to amplify the esterase gene from the genomic DNA by touch down PCR. Touchdown cycling: one cycle at 98° C. for 30 s, 33 cycles at 98° C. for 10 s, 79.8° C. for 30 s (decreases 0.5° C. every cycle), 72° C. for 30 s, 19 cycles at 98° C. for 10 s, 55.8° C. for 30 s, 72° C. for three min. 30 s, one cycle at 72° C. for five min 30 s. Herculase ii Fusion DNA polymerase (Agilent Technologies) was used for the PCR amplification steps.
(416) TABLE-US-00014 EstLICNew_Forward: (SEQ ID NO: 9) 5′-GAC GAC GAC AAG ATG CCA ACA ATT AAT TCG ATT CAA ACA ACC GTC-3′. EstLICNew_Reverse: (SEQ ID NO: 10) 5′-GAG GAG AAG CCC GGT TCA TCA CTA AAT TAA CGC GGC CGC CAT CAC-3′.
(417) DNA excised from a 1% agarose gel and purified using the Zymo Gel DNA Extraction Kit. The purified PCR product was then used with the pET46 Ek/LIC Vector Kit to generate the esterase recombinant protein expression vector. E. coli TOP10 cells were used to isolate the plasmid prior to transformation into other heterologous hosts.
(418) Expression and Purification of Esterase
(419) The pET46-esterase construct was transformed via heat shock into E. coli BL21 (DE3) cells. The transformed cells were transferred to an LB agar plate supplemented with 50 μg/mL carbenicillin antibiotic, and incubated at 37° C. for 10-12 h. A seed culture was prepared by inoculating a single colony from the transformation plate in 25 mL of LB medium with 50 carbenicillin antibiotic and shaking the culture at 225 rpm for seven h at 37° C. in a 250 mL baffled flask. The expression culture was then prepared by inoculating 10 mL of the seed culture in 1.0 L of LB media with 50 μg/mL carbenicillin and shaking the culture at 225 rpm in 37° C. (3 L baffled flask). When the optical density of the culture reached A.sub.600 0.6, overexpression of esterase protein with a N-terminal His.sub.6 tag was induced through addition of 0.50 mM IPTG, and the culture was incubated further for 16 h at 18° C. with shaking at 170 rpm. The cells were harvested and re-suspended in buffer A (50 mM NaH.sub.2PO.sub.4, pH 8.0, 300 mM NaCl, 10 mM β-mercaptoethanol, 100 μL protease inhibitor cocktail). The cell lysate was prepared by sonication as previously described, and the supernatant was purified by VFD-mediated purification as described below. Fractions containing purified protein identified by SDS-PAGE were pooled and concentrated with a 3 kDa concentrator. The purity of the protein was confirmed using 12% SDS-PAGE (
(420) Expression and Purification of TEAS
(421) Our laboratory has previously published the plasmid containing the gene for TEAS, thus please refer to this publication for further details [S1]. The pET28-TEAS construct was transformed into E. coli BL21 Mar (DE3) cells. The transformed cells were transferred to an LB agar plate supplemented with 50 kanamycin antibiotic, and incubated at 37° C. for 14-16 h. A seed culture was prepared by inoculating a single colony from the plate into 5 mL of LB medium with 50 μg/mL carbenicillin antibiotic before shaking at 225 rpm for 6-7 h at 37° C. in a 15 mL culture tube. The expression culture was then prepared by inoculating 5 mL of the seed culture per 1.0 L of LB media with 50 kanamycin, then shaking at 220 rpm at 37° C. When the optical density of the culture reached A.sub.600-0.5, the cultures were transferred to an incubator set at 18° C. Once the cultures had reached A.sub.600-0.65 overexpression of TEAS protein with an N-terminal His.sub.6 tag was induced through the addition of 0.5 mM IPTG. The induced expression culture was incubated at 18° C. for 18-20 h shaking at 220 rpm. The cells were harvested and resuspended in buffer (50 mM NaH.sub.2PO.sub.4, 100 mM NaCl pH 8.0, and 100 μL of Halt Protease Inhibitor Cocktail. The cell lysate was prepared by sonication as previously described, and the supernatant was purified by VFD-mediated purification as described below. Fractions containing purified protein identified by SDS-PAGE were pooled and concentrated with a 3 kDa concentrator. The purity of the protein was confirmed using 12% SDS-PAGE (
(422) VFD Reactor Set-Up
(423) The vortex fluidic device (VFD) was set to a tilt angle of 45° relative to the horizontal, with the inclined sample tube rotating at 8 krpm. Below are the methods for continuous flow protein purification, immobilization and elution of the purified protein.
(424) Initial Optimization Studies for Protein Immobilization in Continuous Flow.
(425) For the immobilization process, a series of optimization steps were first performed to allow rapid and efficient protein immobilization. The figures herein detail each optimization step and the outcome.
(426) Initial Studies Protein Purification in Continuous Flow
(427) The VFD was fitted with a 17.7 mm internal diameter sample tube and rotated at 8 krpm at a 45° tilt angle. To the rotating tube was added 6.00 mL of homogenous IMAC-resin to create a thin layer evenly covering the sample tube. The sample tube is then rotated at 25° C. for ten min. At this point, the sample tube rotation is halted, and a jet feed is inserted down the center of the sample tube. The sample tube rotation is then started, and maintained at 8 krpm. The whole process is now performed in continuous flow by passing reagents through a peristaltic or syringe pump and down the jet feed. Once transported down the jet feed, the fluid enters the hemisphere of the sample tube, and then climbs the wall of the sample tube as more fluid is added. Once the fluid exits the sample tube, it is then channeled into a collection flask, or is recycled back into the device.
(428) First, a NiSO.sub.4.6H.sub.2O solution is flowed through the VFD (20 mL, 100 mM, 1 mL min.sup.−1) to charge the IMAC resin by creation of the nickel complex as depicted in
(429) If the reactor is to be used directly for biocatalysis in continuous flow, the reaction buffer is simply flowed through (30 mL, 1 mL min.sup.−1) in equilibrating the reactor for the transformation. The substrate can then be flowed through the reactor at a flow rate and concentration of choice. At the end of the experiment the protein can be eluted and stored as described above. After protein elution from the reactor, the IMAC can be purified in continuous flow ready for the next reaction. For this, a series of reagents are flowed through the reactor:
(430) 1. (6 M GuHCl, 0.2 M acetic acid, 20 mL)
(431) 2. H.sub.2O (20 mL)
(432) 3. SDS (2%, 20 mL)
(433) 4. Ethanol (20 mL, 25%)
(434) 5. Ethanol (20 mL, 75%)
(435) 6. Ethanol (20 mL, 100%)
(436) 7. Ethanol (20 mL, 25%)
(437) 8. H.sub.2O (20 mL)
(438) 9. EDTA (20 mL, 100 mM, pH 8.0)
(439) 10. H.sub.2O (20 mL)
(440) At this point, the column can be recharged with the NiSO.sub.4.6H.sub.2O solution as previously described.
(441) Rapid Protein Purification in Continuous Flow.
(442) Following purification of all the six proteins described above, the flow rate and quantity of reagents needed were optimized to afford a more rapid and efficient system requiring only ten min. For this optimization, TEAS protein was used, as it was most unstable protein. First to be explored was the flow rate of reagents through the VFD. Using the maximum flow rate of the peristaltic pump (13.30 mL min.sup.−1) allowed for rapid purification with no visual decrease in the purity of the protein. Furthermore, the quantity of NiSO.sub.4.6H.sub.2O flowed through the system was reduced to 10 mL, as previous optimization studies reveled that this quantity is sufficient to reach Ni.sup.2+ saturation on the reactor surface. Furthermore, the quantity of PBS flowed through after the NiSO.sub.4.6H.sub.2O solution was also reduced to 10 mL. As demonstrated in
(443) Continuous Flow Reactions for Testing Immobilization Longevity
(444) To test the longevity of the immobilized protein, a non-centrifuged cell lysate of mCherry was coated to the reactor surface as detailed above. A solution of PBS was then flowed through the reactor for five days, and the quantity of mCherry in the flow through solution quantified using UV visible spectroscopy as detailed above. To determining the percentage of mCherry lost from the surface of the reactor, the protein was eluted from the reactor after five days, and the concentration determined. A differences calculation between the amount of protein leached and the overall protein concentration determined the percentage of protein leached. The experiment was conducted for five days with only 0.34% loss of protein from the surface of the reactor, demonstrating that this approach to protein immobilization has the potential to be run for significantly longer reaction times.
(445) Creating Enzymatic Zones on the Reactor Surface.
(446) To create enzymatic zones on the surface of the reactor surface the following protocol is followed. IMAC solution (3.00 mL per half a reactor) and PBS (3.00 mL, pH 8.0) are added to a 15 mL tube. The tube is shaken vigorously for one min, and then centrifuge at 1 krpm for five min. The supernatant is discarded and NiSO.sub.4.6H.sub.2O solution is added (10 mL, 100 mM). The tube was then placed on a rotating bed at 4° C. for two h to charge the IMAC resin. After this time, the tube was then centrifuged at 1 krpm for five min. The supernatant was discarded and PBS (3.00 mL, pH 8.0) added. The tube was vigorously shaken for one min. and then centrifuged for five min. at 8 krpm. 95% of the supernatant was removed from the tube and the protein solution (4.00 mL, pH 8.0) added. For kinetic experiments using stripes, purified protein was used to gain accurate kinetic data. The solution is then mixed with a spatula, and then incubated at 4° C. on a rotating bed for two h. After this time, the tube is centrifuged at 1 krpm for five min and then 85% of the supernatant is then discarded.
(447) A sample tube is then inserted into the VFD and rotated at 8 krpm. The protein-bound IMAC was then added to the sample tube by a Pasteur pipette. The IMAC solution is added drop-by-drop to the required zone creating stripes down to a minimum of ˜1 cm in width. For every 1 cm zone width, around 250 mg of enzyme bound IMAC is used, as this creates sharp, distinguishable zones. However, for other patterns, a total of 6.00 g of IMAC coats a single sample tube. Once the stripes have been added to the surface of the reactor, the IMAC is left to set for around ten min. After this point, the rotation is stopped for the sample tube, and the jet feed is added down the center of the sample tube as detailed previously. The reactor is now ready for continuous flow biocatalysis.
(448) Phosphodiesterase Reactivity Data.
(449) To optimize reactivity for recombinant expressed phosphodiesterase, enzyme-substrate solutions were subjected to variable reaction conditions including: enzyme concentration, reaction temperature and solvent compatibility. Below each experimental set-up is detailed and the result highlighted.
(450) Phosphodiesterase Concentration Effects.
(451) Recombinant expressed phosphodiesterase (2.00 mg mL.sup.−1) was used to explore the enzymes activity (
(452) Phosphodiesterase Reaction Temperature Effects.
(453) Recombinant expressed phosphodiesterase (4.96 nMoles) was used to explore the enzymes activity at various temperatures (
(454) Phosphodiesterase Solvent Compatibility.
(455) Recombinant expressed phosphodiesterase (4.96 nMoles) was exposed to a range of organic solvents and the enzymes activity monitored (
(456) Phosphodiesterase Activity in Varying Levels of Acetonitrile.
(457) Recombinant expressed phosphodiesterase (4.96 nMoles) was used to explore the enzymes compatibility with a range of acetonitrile concentrations (
(458) Phosphodiesterase Reactivity Profiles in Varying Levels of Acetonitrile.
(459) Recombinant expressed phosphodiesterase (4.96 nMoles) was used to explore the enzymes reactivity profile with higher concentrations of acetonitrile (
(460) Alkaline Phosphatase Reactivity Data.
(461) To optimize reactivity for recombinant expressed alkaline phosphatase, enzyme-substrate solutions were subjected to variable reaction conditions including: enzyme concentration, reaction temperature and metal salt preference. Below each experimental set-up is detailed and the result highlighted.
(462) Alkaline Phosphatase and Phosphodiesterase Comparative Data.
(463) In achieving efficient multistep reactivity, reaction temperature and metal dependency of the two enzymes were taken into consideration. Below are graphical representations describing the effects of variable temperature and the effects of different metal ions on the activity of both alkaline phosphatase and phosphodiesterase.
(464) Michaelis-Menten Kinetics.
(465) To achieve effective multistep reactivity in continuous flow, both alkaline phosphatase and phosphodiesterase must be operating at the same rate. First, the catalytic perfection of each protein (k.sub.cat/k.sub.M) under theoretical limiting conditions was derived (
(466) Multistep Synthesis with Alkaline Phosphatase and Phosphodiesterase.
(467) To achieve the multistep reactivity as demonstrated herein, e.g.,
(468) First, homogenous IMAC resin (3.00 mL) was added to a 15 mL falcon tube. After centrifugation at 1 krpm for five min, the supernatant was removed and NiSO.sub.4.6H.sub.2O solution (3.00 mL, 100 mM) added. This tube was subjected to gentle agitation for two h at 4° C. at which point the tube was once again centrifuged at 1 krpm for five min. The supernatant was discarded and PBS was added (3.00 mL). The tube was inverted several times and then centrifuged. The supernatant was then removed and this process and was repeated three times per tube. After the last volume of PBS had been removed, this silica is now charged and ready to bind the protein of interest.
(469) To a smaller tube (5 mL) was added either phosphodiesterse (5 μL of a 635 μg/mL protein solution) and enzyme buffer (3.95 mL) to afford a 4.00 mL solution with a final concentration of 0.793 μg/mL, or alkaline phosphatase (2.80 mL of a 1638 μg/mL protein solution) and reaction buffer (1.20 mL) to afford a 4.00 mL solution with a final concentration of 1150 μg/mL. These concentrations were determined by the Michaelis-Menten kinetics as described above. The protein solution (4.00 mL) was added to the falcon tube containing the charged IMAC resin and then were subjected to gentle agitation for two h at 4° C. After this time, the falcon tubes were centrifuged at 1 krpm for five min, and 85% of the supernatant was discarded and the remaining slurry was stirred until homogenous. Depending upon how many zones were required for each enzyme (2, 4, 6 or 8), the reactor was split up into zones of equal length. The protein-IMAC solution was then applied to these zones as described above in
(470) To test the efficiency of the enzyme zones, bis(PNNP) (2.0 mM) was flowed through the reactor at a flow rate of 0.50 mL min.sup.−1 at a reactor temperature of 65° C. The first 6.8 mL exiting the reactor were discarded as the system is reaching a point of equilibrium. After this point, small aliquots (1.30 mL) are taken and quenched with the NaOH quench (300 μL). Ten aliquots are taken in total and analyzed as described above. Error is reported as standard deviation around the means (n=10)
References
Example 5
(471) [1] a) J. Staunton, K. J. Weissman, Nat. Prod. Rep. 2001, 18, 380-416; b) S. C. Wenzel, R. Muller, Nat. Prod. Rep. 2007, 24, 1211-1224; c) J. L. Meier, M. D. Burkart, Chem. Soc. Rev 2009, 38, 2012-2045; d) M. A. Fischbach, C. T. Walsh, Chem. Rev. 2006, 106, 3468-3496; e) C. C. Ladner, G. J. Williams, J Ind. Microbiol. Biot 2016, 43, 371-387; f) C. T. Walsh, Accounts Chem. Res 2008, 41, 4-10; [2] K. J. Weissman, Nat. Prod. Rep. 2015, 32, 436-453; [3] a) I. Wheeldon, S. D. Minteer, S. Banta, S. C. Barton, P. Atanassov, M. Sigman, Nat. Chem. 2016, 8, 299-309; b) R. N. Perham, Annu. Rev. Biochem. 2000, 69, 961-1004; c) J. Fu, Y. R. Yang, A. Johnson-Buck, M. Liu, Y. Liu, N. G. Walter, N. W. Woodbury, H. Yan, Nat. Nano. 2014, 9, 531-536; [4] a) A. Adamo, R. L. Beingessner, M. Behnam, J. Chen, T. F. Jamison, K. F. Jensen, J.-C. M. Monbaliu, A. S. Myerson, E. M. Revalor, D. R. Snead, T. Stelzer, N. Weeranoppanant, S. Y. Wong, P. Zhang, Science 2016, 352, 61-67; b) P. L. Heider, S. C. Born, S. Basak, B. Benyahia, R. Lakerveld, H. Zhang, R. Hogan, L. Buchbinder, A. Wolfe, S. Mascia, J. M. B. Evans, T. F. Jamison, K. F. Jensen, Org. Process Res. Dev. 2014, 18, 402-409; c) S. Newton, C. F. Carter, C. M. Pearson, L. de C. Alves, H. Lange, P. Thansandote, S. V. Ley, Angew. Chem. Int. Edit. 2014, 53, 4915-4920; d) A. R. Bogdan, S. L. Poe, D. C. Kubis, S. J. Broadwater, D. T. McQuade, Angew. Chem. Int. Edit. 2009, 48, 8547-8550; e) D. T. McQuade, P. H. Seeberger, J. Org. Chem 2013, 78, 6384-6389; f) T. Tsubogo, H. Oyamada, S. Kobayashi, Nature 2015, 520, 329-332; g) B. Gutmann, D. Cantillo, C. O. Kappe, Angew. Chem. Int. Edit. 2015, 54, 6688-6728; h) F. Levesque, P. H. Seeberger, Angew. Chem. Int. Edit. 2012, 51, 1706-1709; [5] P. Zhang, M. G. Russell, T. F. Jamison, Org. Process Res. Dev. 2014, 18, 1567-1570; [6] C. A. Correia, K. Gilmore, D. T. McQuade, P. H. Seeberger, Angew. Chem. Int. Edit. 2015, 54, 4945-4948; [7] a) L. Yasmin, X. Chen, K. A. Stubbs, C. L. Raston, Sci. Rep. 2013, 3, 2282; b) L. Yasmin, T. Coyle, K. A. Stubbs, C. L. Raston, Chem. Commun. 2013, 49, 10932-10934; c) J. Britton, S. B. Dalziel, C. L. Raston, Green Chem. 2016, 18, 2193-2200; d) J. Britton, S. B. Dalziel, C. L. Raston, RSC Adv. 2015, 5, 1655-1660; [8] a) J. Britton, J. M. Chalker, C. L. Raston, Chem. Eur. J. 2015, 21, 10660-10665; b) J. Britton, J. W. Castle, G. A. Weiss, C. Raston, Chem. Eur. J. 2016, DOI: 10.1002/chem.201602373; [9] T. Z. Yuan, C. F. G. Ormonde, S. T. Kudlacek, S. Kunche, J. N. Smith, W. A. Brown, K. M. Pugliese, T. J. Olsen, M. Iftikhar, C. L. Raston, G. A. Weiss, ChemBioChem 2015, 16, 393-396; [10] J. Britton, L. M. Meneghini, C. L. Raston, G. A. Weiss, Angew. Chem. Int. Edit. 2016; [11] J. Britton, C. L. Raston, G. A. Weiss, Chem. Commun. 2016, 52, 10159-10162; [12] J. E. Diaz, C.-S. Lin, K. Kunishiro, B. K. Feld, S. K. Avrantinis, J. Bronson, J. Greaves, J. G. Saven, G. A. Weiss, Protein Sci. 2011, 20, 1597-1606; [S1] J. E. Diaz, C.-S. Lin, K. Kunishiro, B. K. Feld, S. K. Avrantinis, J. Bronson, J. Greaves, J. G. Saven, G. A. Weiss, Protein Science 2011, 20, 1597-1606.
Example 6—Rapid Protein Immobilization for Thin Film Continuous Flow Biocatalysis
(472) Abstract.
(473) A versatile enzyme immobilization strategy for thin film continuous flow processing is disclosed. Here, non-covalent and glutaraldehyde bioconjugation are used to immobilize enzymes on the surfaces of borosilicate reactors. This approach requires only ng of protein per reactor tube, with the stock protein solution readily recycled to sequentially coat >10 reactors. Confining reagents to thin films during immobilization reduced the amount of protein, piranha-cleaning solution, and other reagents by ˜96%. Through this technique, there was no loss of catalytic activity over 10 h processing. The results reported here combines the benefits of thin film flow processing with the mild conditions of biocatalysis.
(474) Introduction.
(475) Nature builds diverse and complex natural products through assembly line biosynthesis. Polyketide synthases for example, are multi-domain proteins that perform iterative processes to synthesize a large range of secondary metabolites [1,2]. Continuous flow has emerged as an analogous, in vitro process, for synthesizing compounds through multistep processes.
(476) Enzymes can perform a wide range of transformations including reductions [3,4], oxidations [5,6], cyclization [7,8], aziridinations[9] and nitration reactions [10]. Improving the performance of these enzymes typically relies on directed evolution [11,12] and computational design [13,14]. These widely used techniques can improve reaction rates and enzyme promiscuity to accept non-natural substrates. Although such approaches can increase the utility and adoption of biocatalyzed transformations, scaling up enzyme-catalyzed reactions can be challenging.
(477) Translating reactions into continuous flow can increase reaction yields and safety [15,16], aid multistep transformations [17,18], and decrease human effort and waste [19,20]. Furthermore, enzymes in synthetic pathways can improve sustainability metrics by avoiding hazardous solvents and toxic metals. Combining the benefits of continuous flow and biocatalysis offers numerous advantages such as processing with immobilized enzymes and rapid scale-up. Continuous flow biocatalysis has thus increasingly become a focus of many laboratories, as shown in a few examples [21,24].
(478) Immobilizing enzymes can increase their industrial viability by creating reusable biocatalysts with potentially improved reactivity, purity, specificity, selectivity, thermal stability and pH tolerance [25-30]. Given this importance, many immobilization strategies have been described, including attachment to magnetic nanoparticles and nanomaterials [31,32], supports through antibody-specific epitopes and crosslinking [33], and also entrapment within a polymer network [34]. Glutaraldehyde crosslinking was chosen here due to its simplicity, commercial availability, and success in previous immobilization studies [35,36].
(479) Results and Discussion.
(480) Recently, we have focused on utilizing thin films to mediate protein folding [37], biocatalysis [38] and molecular assembly line processes [39]. This involves processing in a vortex fluidic device (VFD) which confines reagents to a ≈250 μM thin film. Here, micro-mixing, shear stress and mechanical vibrations [40,41] can operate upon reagents to increase reaction yields and efficiencies. Processing in a single VFD with a 20 mm external diameter reactor can achieve flow rates up to 20 mL min.sup.−1. Larger scale processing is possible by applying multiple VFDs. In pursuing new multistep transformations, we have recently embarked on exploring thin film continuous flow biocatalysis. In future experiments, using enzymes alone, or in conjunction with organic reagents will require immobilization of minute quantities of protein for efficient continuous flow reactors.
(481) Unlike other continuous flow systems, the VFD reactor is made from borosilicate glass. This material can simplify bioconjugation, as explored systematically here. APTES (3-aminopropyl triethoxysilane) was coupled to the reactor surface to create a layer of nucleophilic amines (
(482) Coating the reactor with APTES required optimizing a three-step process. First, treatment with piranha solution exposes high concentrations of silinols on the reactor surface. Although the reactor can be filled with piranha solution (50 mL), confining 3 mL to a thin film for one min. offers the same cleaning efficiency, whilst reducing the volume of this highly hazardous fluid by 94%. After washing and drying, the reactor surface is then derivatized with a dilute APTES solution (79.5 mM, 60 μL in 3 mL MeOH). Again, confining reagents to a thin film reduced the quantities of MeOH and APTES required by 94%. Lastly, the APTES-modified surface is heated to 160° C. to drive the condensation reaction to completion (
(483) Non-covalent immobilization is sometimes preferred to covalent immobilization as introducing random covalent bonds can distort enzymes' structures [28]. For testing a large number of non-covalent immobilization variables, a colorimetric enzyme-substrate assay was used, β-glucosidase and 4-nitrophenyl β-D-glucopyranoside, respectively. This assay offers high throughput conditions (5 min per reaction), an effective quench solution, and stability to vortexing conditions (
(484) β-Glucosidase and buffer salt concentrations play an integral role in non-covalent immobilization efficiency and activity. Varying both of these variables simultaneously generated a contour plot (
(485) Next we examined the conditions required for covalent immobilization. Covalent immobilization can increase enzyme stability greatly through the addition of short spacers off the reactor surface [27]. Reacting glutaraldehyde with the APTES-coated reactor, followed by the sequential addition of β-glucosidase solution afforded an imine linker for immobilization (
(486) Switching to covalent immobilization increased the yields of conjugated enzyme with a concomitant increase in the rates of substrate conversion. Although a slight increase in enzyme immobilization efficiency and reaction rate results from switching to covalent immobilization, the reduction of imine to amine provides a dramatic improvement. This reduction prevents hydrolysis of the imine, thus increasing the concentration of protein on the surface of the reactor tube (
(487) Our second requirement for this immobilization strategy was to make it general. Given that proteins have a hydrophilic surface, most enzymes have a surface-exposed lysine residue for immobilization. As small quantities of protein are used in this immobilization strategy (0.9 mg), we were able to explore phosphodiesterase, a poorly overexpressing recombinant protein. Immobilizing phosphodiesterase and a commercially available alkaline phosphatase via amine-glutaraldehyde immobilization (
(488) The final criterion for this immobilization method was to increase immobilization efficiency. This process already uses a low quantity of protein, but, to address efficiency further, it would be useful to know how much of protein is on the surface of the reactor. Two complimentary experiments revealed that 15.4 to 69.8 ng of β-glucosidase are present on the surface of the reactor after covalent immobilization (
(489) Lastly, sample tube storage was investigated, which was deemed important given that sample tubes are often transported to other laboratories. Surprisingly, a dry sample tube bearing surface bound β-glucosidase provided reasonable substrate conversion after one month of storage (4° C. storage, 19 μM min.sup.−1 conversion,
(490) In conclusion, a rapid and general technique for protein immobilization onto a thin film continuous flow reactor has been developed. Importantly, using thin films for reagent confinement reduced the volume of protein solution, piranha solution, APTES, MeOH, glutaraldehyde, NaBH.sub.3CN and a range of buffers by an average of 95%. The ability to use a small amount of protein (900 μg) to coat >10 sample tubes provides a general strategy to increase the efficiency of enzyme-mediated transformations in continuous flow. Incorporating biocatalysts into multistep processes offers the potential to create complex molecules using nature's machinery. The findings reported here will facilitate biocatalysts by allowing low expressing proteins to be used in complex substrate transformations such as natural products and pharmaceutical ingredients.
Supplemental Experimental
Example 6
(491) All immobilizations and substrate transformations experiments were performed at 8 krpm rotational speed with a tilt angle of 45° relative to the horizontal position. To test the immobilization efficiency, the confined mode of operation was used with β-glucosidase as the model enzyme. For immobilization efficiency experiments, the following analysis was performed: first, β-D-glucopyranoside (1.50 mL, 0.01 M) was added to the sample tube by pipette, the sample tube was then capped and rotated for 5 min. Thereafter, the substrate solution was removed and added to an Eppendorf tube (2 mL) containing a quenching solution (NaOH-glycine buffer, 0.7 M glycine, pH 10.8, 200 μL). To analyze substrate conversion levels, 100 μL of this solution was then transferred to a UV transparent, 96-well microtiter plate (Costar), and the absorption at 405 nm recorded. Each sample tube was tested six consecutive times, with each set of reaction conditions tested on two individual sample tubes. The error reported indicates the standard deviation around the mean (n=12).
(492) Preparation of the APTES Coated Sample Tube.
(493)
(494) Non-covalent immobilization.
(495) Imine-Glutaraldehyde Cross-Linker Immobilization.
(496)
(497) Amine-Glutaraldehyde Cross-Linker Immobilization.
(498)
(499) Enzymes, Buffers and Assays
(500) Enzymes.
(501) Alkaline phosphatase was purchased from Life Technologies (Fast thermosensitive alkaline phosphatase, 1 U/μL, 0.11 mM, 4.4 mg/mL). β-glucosidase was purchased from Sigma and Aldrich (Lyophilized powder, 2 U/mg). These enzymes were used without further purification. Phosphodiesterase (2 mg/mL) was prepared using bacteria expression as previously described [S3] and purified using immobilized metal affinity chromatography to 95% purity. Quantitates and concentrations for the enzymes and substrates used in the continuous flow experiments as detailed herein. The flow rate used for this experiment was 1.0 mL/min with the continuous flow set up detailed previously [S4].
(502) Alkaline Phosphatase Conditions.
(503) The reaction is depicted following.
(504) ##STR00002##
(505) The p-nitrophenol phosphate substrate solution (0.01 M in 1.0 M diethanolamine) was prepared as follows: 140 g of diethanolamine was added to 1.0 L of H.sub.2O, then the pH of the solution was adjusted to pH 9.8 using 5 M HCl. This buffer was further diluted to 1 M diethanolamine, and then 500 μL of 1 M MgCl.sub.2 was added. The resulting buffer was filtered-sterilized through a 0.22 μm filter (Corning), and stored wrapped in aluminum foil at 4° C. In creating the active substrate solution, p-nitrophenol phosphate (3.714 g, 0.01 M) was added to this buffer and this solution was then immediately used. The enzyme solution (0.25 mg/mL) was formulated by adding alkaline phosphatase (170 μL) to PBS (3.00 mL, pH 8.0) and then used immediately for immobilization. Sampling occurred at the times indicated in
(506) β-Glucosidase Conditions.
(507) The reaction is depicted following.
(508) ##STR00003##
(509) The 4-nitrophenyl β-D-glucopyranoside substrate solution (0.01 M in 50 mM sodium acetate) was prepared as follows: 4.37 g sodium acetate was dissolved in 1.0 L diH.sub.2O and ≈1.1 mL of glacial acetic acid to generate a buffer of pH 5.0. The buffer was then filtered-sterilized through a 0.22 μm filter and stored at 23±2° C. To formulate the active substrate solution, 4-nitrophenyl β-D-glucopyranoside (3.125 g, 0.01 M) was added to this buffer, and was used immediately. The enzyme solution (0.30 mg/mL) composed of β-glucosidase (3 mg) added to 10 mL of PBS (3.00 mL) was immediately used for immobilization. Sampling occurred at the times indicated in
(510) Phosphodiesterase Conditions.
(511) The reaction is depicted following.
(512) ##STR00004##
(513) The bis(p-nitrophenyl)phosphate substrate solution (0.7 mM in 50 mM diethanolamine) was prepared as follows: diethanolamine (5.257 g, 50 mM) and NaCl (2.320 g, 40 mM) were added to 1.0 L of H.sub.2O. The pH of the solution was adjusted to pH 9.8 with 5 M HCl. Following this, NiCl.6H.sub.2O (237 mg, 1.0 mM) was added to the solution and the resulting buffer was then filtered-sterilized through a 0.22 μm filter (Corning), and stored wrapped in aluminum foil at 4° C. To create the active substrate solution, sodium bis(p-nitrophenyl)phosphate (237 mg, 0.7 mM) was added to this buffer, and the solution was used immediately. The enzyme solution (0.30 mg/mL) was formulated by adding phosphodiesterase (450 μL) to PBS (3.00 mL), and the solution used immediately for immobilization. Sampling occurred at the times indicated in
(514) Determination of the Amount of β-Glucosidase Attached to the Reactor Surface.
(515) To determine the quantity of β-glucosidase on the surface of the reactor, two complimentary methods were used. The first method quantified the enzyme removed during the wash steps; thus, estimation of quantities of β-glucosidase adhering to the surface was simply the difference between enzyme levels in the initial and the wash solutions. The second method determines the amount of β-glucosidase present by monitoring substrate conversion rates for the modified surface. A calibration plot with substrate conversion rates allowed determination of quantities of enzyme. Both methods provided similar and complementary results.
(516) Method 1: Comparing Initial and Wash Solutions of Enzyme Concentrations.
(517) This method quantifies the amount of β-glucosidase washed out of the tube after immobilization with a simple difference calculation used to determine enzyme immobilization on the reactor surface. This method assumes that no enzyme is lost to unfolding during the half hour for this experiment.
(518) The calibration curve required enzyme solutions at three different concentrations, which were prepared as follows. β-glucosidase at the indicated quantities (0.90, 0.60 or 0.3 mg) was added to PBS (3 mL, pH 8.0). Each solution was then added to a separate 500 mL volumetric flask. The 500 mL volumetric flasks were then filled with PBS (50 mL, pH 8.0) and then sodium acetate buffer (447 mL, 50 mM, pH 5.0).
(519) The amount of β-glucosidase washed out of the tube after immobilization by non-covalent and imine-glutaraldehyde cross-linking was determined with the following procedure. First, the sample tube was rinsed with PBS (50 mL, pH 8.0) and the wash solutions added to a 500 mL volumetric flask. The contents of the volumetric flask were then diluted to 500 mL with sodium acetate buffer (50 mM, pH 5.0). The pH for the wash steps can maximize enzyme immobilization during this processing (pH 8.0), and switching to pH 5.0 allows the enzyme catalysis assay to proceed at its optimal pH.
(520) The following protocol quantified enzyme activities and therefore enzyme concentration. Each enzyme solution (500 μL) was added to 4-nitrophenyl β-D-glucopyranoside solution (500 μL, 0.01 M). The reactions were incubated at RT for 10 min. Thereafter, NaOH-glycine quenching solution (200 μL) as described above was added to halt the reaction. The solutions were then analyzed using absorption spectroscopy as detailed above. The error is reported as standard deviation around the mean (n=3,
(521) Method 2. Determination of β-Glucosidase Quantity by Enzyme Activity.
(522) This method looks at the amount of β-glucosidase present on the VFD reactor surface by direct monitoring of the catalytic rates for enzyme attached to the VFD reactor. Such rates were compared to identical control solutions with specified amounts of enzyme, and not subjected to VFD processing. This method assumes that the enzyme rate remains unchanged by attachment to the VFD reactor.
(523) For this experiment, the protocol above was used with the following changes. The concentration of enzyme was varied as indicated in
References
Example 6
(524) [1] M. A. Fischbach and C. T. Walsh, Chem. Rev., 2006, 106, 3468-3496; [2] A. T. Keatinge-Clay, Nat. Prod. Rep., 2016, 33, 141-149; [3] H. Sato, W. Hummel and H. Gröger, Angew. Chem. Int. Edit., 2015, 54, 4488-4492; [4] N. G. Turrini, M. Hall and K. Faber, Adv. Synth. Catal., 2015, 357, 1861-1871; [5] A. Ilie, R. Agudo, G.-D. Roiban and M. T. Reetz, Tetrahedron, 2015, 71, 470-475; [6] S. Sirajuddin and A. C. Rosenzweig, Biochemistry-US, 2015, 54, 2283-2294; [7] G. K. T. Nguyen, A. Kam, S. Loo, A. E. Jansson, L. X. Pan and J. P. Tam, J. Am. Chem. Soc., 2015, 137, 15398-15401; [8] E. Oueis, M. Jaspars, N. J. Westwood and J. H. Naismith, Angew. Chem. Int. Edit., 2016, 128, 5936-5939; [9] C. C. Farwell, R. K. Zhang, J. A. McIntosh, T. K. Hyster and F. H. Arnold, ACS Central Sci., 2015, 1, 89-93; [10] S. C. Dodani, G. Kiss, J. K. B. Cahn, Y. Su, V. S. Pande and F. H. Arnold, Nat. Chem., 2016, 8, 419-425; [11] P. A. Romero and F. H. Arnold, Nat. Rev. Mol. Cell. Biol., 2009, 10, 866-876; [12] N. J. Turner, Nat. Chem. Biol., 2009, 5, 567-573; [13] C. E. Tinberg, S. D. Khare, J. Dou, L. Doyle, J. W. Nelson, A. Schena, W. Jankowski, C. G. Kalodimos, K. Johnsson, B. L. Stoddard and D. Baker, Nature, 2013, 501, 212-216; [14] J. B. Siegel, A. L. Smith, S. Poust, A. J. Wargacki, A. Bar-Even, C. Louw, B. W. Shen, C. B. Eiben, H. M. Tran, E. Noor, J. L. Gallaher, J. Bale, Y. Yoshikuni, M. H. Gelb, J. D. Keasling, B. L. Stoddard, M. E. Lidstrom and D. Baker, P. Natl. Acad. Sci. USA, 2015, 112, 3704-3709; [15] A. Herath, R. Dahl and N. D. P. Cosford, Org. Lett., 2010, 12, 412-415; [16] D. Obermayer, T. N. Glasnov and C. O. Kappe, J. Org. Chem., 2011, 76, 6657-6669; [17] A. Adamo, R. L. Beingessner, M. Behnam, J. Chen, T. F. J amison, K. F. Jensen, J.-C. M. Monbaliu, A. S. Myerson, E. M. Revalor, D. R. Snead, T. Stelzer, N. Weeranoppanant, S. Y. Wong and P. Zhang, Science, 2016, 352, 61-67; [18] A. R. Bogdan, S. L. Poe, D. C. Kubis, S. J. Broadwater and D. T. McQuade, Angew. Chem. Int. Edit., 2009, 48, 8547-8550; [19] S. Newton, C. F. Carter, C. M. Pearson, L. de C. Alves, H. Lange, P. Thansandote and S. V. Ley, Angew. Chem. Int. Edit., 2014, 53, 4915-4920; [20] S. V. Ley, D. E. Fitzpatrick, R. J. Ingham and R. M. Myers, Angew. Chem. Int. Edit., 2015, 54, 3449-3464; [21] L. H. Andrade, W. Kroutil and T. F. Jamison, Org. Lett., 2014, 16, 6092-6095; [22] J.-M. Choi, S.-S. Han and H.-S. Kim, Biotechnol. Adv., 2015, 33, 1443-1454; [23] R. Porcar, V. Sans, N. Ríos-Lombardía, V. Gotor-Fernández, V. Gotor, M. I. Burguete, E. García-Verdugo and S. V. Luis, ACS Catal., 2012, 2, 1976-1983; [24] D. Zhao and K. Ding, ACS Catal., 2013, 3, 928-944; [25] C. Garcia-Galan, Á. Berenguer-Murcia, R. Fernandez-Lafuente and R. C. Rodrigues, Adv. Synth. Catal., 2011, 353, 2885-2904; [26] U. Guzik, K. Hupert-Kocurek and D. Wojcieszyńiska, Molecules, 2014, 19, 8995; [27] C. Mateo, J. M. Palomo, G. Fernandez-Lorente, J. M. Guisan and R. Fernandez-Lafuente, Enzyme Microb. Tech., 2007, 40, 1451-1463; [28] R. C. Rodrigues, C. Ortiz, A. Berenguer-Murcia, R. Torres and R. Fernandez-Lafuente, Chem. Soc. Rev, 2013, 42, 6290-6307; [29] F. Secundo, Chem. Soc. Rev., 2013, 42, 6250-6261; [30] V. Stepankova, S. Bidmanova, T. Koudelakova, Z. Prokop, R. Chaloupkova and J. Damborsky, ACS Catal., 2013, 3, 2823-2836; [31] H. Vaghari, H. Jafarizadeh-Malmiri, M. Mohammadlou, A. Berenjian, N. Anarjan, N. Jafari and S. Nasiri, Biotechnol. Lett., 2016, 38, 223-233; [32] K. Min and Y. J. Yoo, Biotechnol. Bioproc. E., 2014, 19, 553-567; [33] O. Barbosa, C. Ortiz, Á. Berenguer-Murcia, R. Torres, R. C. Rodrigues and R. Fernandez-Lafuente, Biotechnol. Adv., 2015, 33, 435-456; [34] R. A. Sheldon and S. van Pelt, Chem. Soc. Rev., 2013, 42, 6223-6235; [35] O. Barbosa, C. Ortiz, A. Berenguer-Murcia, R. Torres, R. C. Rodrigues and R. Fernandez-Lafuente, RSC Adv., 2014, 4, 1583-1600; [36] I. Migneault, C. Dartiguenave, M. J. Bertrand and K. C. Waldron, BioTechniques, 2004, 37, 790-802; [37] T. Z. Yuan, C. F. G. Ormonde, S. T. Kudlacek, S. Kunche, J. N. Smith, W. A. Brown, K. M. Pugliese, T. J. Olsen, M. Iftikhar, C. L. Raston and G. A. Weiss, ChemBioChem, 2015, 16, 393-396; [38] J. Britton, L. M. Meneghini, C. L. Raston and G. A. Weiss, Angew. Chem. Int. Edit., 2016, In Press; [39] J. Britton, J. M. Chalker and C. L. Raston, Chem. Eur. J., 2015, 21, 10660-10665; [40] J. Britton, S. B. Dalziel and C. L. Raston, RSC Adv., 2015, 5, 1655-1660; [41] J. Britton, S. B. Dalziel and C. L. Raston, Green Chem., 2016, 18, 2193-2200; [42] B. C. C. Pessela, M. Fuentes, C. Mateo, R. Munilla, A. V. Carrascosa, R. Fernandez-Lafuente and J. M. Guisan, Enzyme Microb. Tech., 2006, 39, 909-915; [43] A. W. Miller and J. F. Robyt, Biotechnol. Bioeng., 1983, 25, 2795-2800; [44] F. Rusmini, Z. Zhong and J. Feijen, Biomacromolecules, 2007, 8, 1775-1789; [S1] H.-S. Jung, D.-S. Moon and J.-K. Lee, J. Nanomaterials, 2012, 2012, 8; [S2] C. J. Stanford, M. Dagenaid, J.-H. Park and P. Deshong, Curr. Anal. Chem., 2008, 4, 356-361; [S3] S. Chen, A. F. Yakunin, E. Kuznetsova, D. Busso, R. Pufan, M. Proudfoot, R. Kim and S.-H. Kim, J. Bio. Chem., 2004, 279, 31854-31862; [S4] J. Britton, S. B. Dalziel and C. L. Raston, Green Chem., 2016, 18, 2193-2200.
EMBODIMENTS
(525) Embodiments disclosed herein include embodiments P1 to P13 following.
Embodiment P1
(526) A method for reacting an enzyme and a substrate, the method including contacting an enzyme with a substrate of the enzyme in a solution in a vortex fluid device (VFD) under conditions suitable to enhance reaction of the substrate with the enzyme relative to a reaction not conducted in a VFD.
Embodiment P2
(527) The method of embodiment P1, wherein the VFD includes a thin film tube reactor, the reactor including a tube having a longitudinal axis, an inner cylindrical surface, a close and an open end, wherein the tube is rotatable about the longitudinal axis, and wherein the angle of the longitudinal axis relative to the horizontal is variable between about 0 degrees and about 90 degrees.
Embodiment P3
(528) The method of embodiment P2, wherein the thin film tube reactor is substantially cylindrical or includes at least a portion that is tapered.
Embodiment P4
(529) The method of embodiment P2, wherein the thin film tube includes a lip adjacent to the open end.
Embodiment P5
(530) The method of embodiment P2, wherein the speed of rotation of the thin film tube about the longitudinal axis is variable.
Embodiment P6
(531) The method of embodiment P1, wherein the VFD is operated at constant volume of solution.
Embodiment P7
(532) The method of embodiment P1, wherein the VFD is operated for continuous flow of substrate contacting the enzyme.
Embodiment P8
(533) The method of embodiment P2, wherein the enzyme is uniformly disposed along the longitudinal axis of the thin film tube reactor.
Embodiment P9
(534) The method of embodiment P2, wherein the enzyme is disposed along the longitudinal axis of the thin film tube reactor in regions, the regions not contiguous.
Embodiment P10
(535) The method of embodiment P1, wherein the enzyme includes a plurality of enzymes.
Embodiment P11
(536) The method of embodiment P1, wherein said substrate comprises a plurality of substrates.
Embodiment P12
(537) The method of embodiment P1, wherein said method is conducted at room temperature.
Embodiment P13
(538) The method of embodiment P1, wherein said method is conducted at atmospheric pressure.
(539) Further embodiments disclosed herein include embodiments 1 to 55 following.
Embodiment 1
(540) A method for reacting an enzyme and a substrate, the method including: a. combining an enzyme and a substrate of the enzyme to form an enzyme-substrate mixture; b. mechanically mixing the enzyme mixture; and c. applying a vibrational energy to the enzyme-substrate mixture, thereby reacting the enzyme and said substrate.
Embodiment 2
(541) The method of embodiment 1, wherein the enzyme-substrate mixture is a liquid enzyme-substrate mixture.
Embodiment 3
(542) The method of any one of embodiments 1-2, wherein the mechanically mixing said enzyme mixture forms an enzyme-substrate mixture thin film and wherein the vibrational energy is sufficient to produce a vibrational response within the enzyme-substrate mixture thin film.
Embodiment 4
(543) The method of any one of embodiments 1-3, wherein the vibrational response is a Faraday wave.
Embodiment 5
(544) The method of any one of embodiments 1-4, wherein the vibrational energy is sufficient to reduce reaction time of the enzyme at least 2 fold relative to reaction time of the enzyme in the absence of the vibrational energy.
Embodiment 6
(545) The method of any one of embodiments 1-5, wherein the vibrational energy produces a harmonic vibrational frequency.
Embodiment 7
(546) The method of any one of embodiments 1-6, wherein the mechanically mixing is rotationally mixing.
Embodiment 8
(547) The method of any one of embodiments 1-7, wherein the rotational speed is about 3 krpm to about 10 krpm.
Embodiment 9
(548) The method of any one of embodiments 1-8, wherein the enzyme-substrate mixture is within a glass container.
Embodiment 10
(549) The method of any one of embodiments 1-9, wherein the glass container has a tilt angle of about 20 degree to about 90 degree.
Embodiment 11
(550) The method of any one of embodiments 1-10, wherein the enzyme is a water soluble enzyme.
Embodiment 12
(551) The method of any one of embodiments 1-11, wherein the water soluble enzyme is an esterase, a lipase, deoxyribose-5-phosphate aldolase (DERA), β-glucosidase, or an alkaline phosphatase.
Embodiment 13
(552) A method for purifying a protein, said method comprising: a. contacting a protein mixture comprising said protein with a protein binding film, wherein said protein binding film is immobilized to a solid support, thereby forming a protein binding film complex; and b. separating said protein from said protein binding film complex, thereby obtaining a purified protein.
Embodiment 14
(553) The method of embodiment 13, wherein said contacting comprises mechanically mixing.
Embodiment 15
(554) The method of any one of embodiments 13-14, wherein said protein mixture is within a cell lysate.
Embodiment 16
(555) The method of any one of embodiments 13-15, wherein said protein binding film is covalently immobilized to said solid support.
Embodiment 17
(556) The method of any one of embodiments 13-16, wherein said protein binding film is non-covalently immobilized to said solid support.
Embodiment 18
(557) The method of any one of embodiments 13-17, wherein said protein is covalently bound to said protein binding film.
Embodiment 19
(558) The method of any one of embodiments 13-18, wherein said protein is non-covalently bound to said protein binding film.
Embodiment 20
(559) The method of any one of embodiments 13-19, wherein said protein comprises a binding moiety.
Embodiment 21
(560) The method of any one of embodiments 13-20, wherein said binding moiety is an expression tag.
Embodiment 22
(561) The method of any one of embodiments 13-21, wherein said expression tag is a His-tag.
Embodiment 23
(562) The method of any one of embodiments 13-22, wherein said protein binding film comprises a binding partner of said binding moiety.
Embodiment 24
(563) The method of any one of embodiments 13-23, wherein said binding partner is nickel, cobalt or copper.
Embodiment 25
(564) The method of any one of embodiments 13-24, wherein said solid support is an inner surface of a reactor.
Embodiment 26
(565) The method of any one of embodiments 13-25, wherein said reactor comprises a closed end and an open end.
Embodiment 27
(566) The method of any one of embodiments 13-26, wherein said reactor is cylindrical.
Embodiment 28
(567) The method of any one of embodiments 13-27, wherein said reactor is a glass reactor.
Embodiment 29
(568) The method of any one of embodiments 13-28, wherein said protein mixture is contacted with said protein binding film by continuous flow.
Embodiment 30
(569) The method of any one of embodiments 13-29, wherein said mechanically mixing is rotationally mixing.
Embodiment 31
(570) The method of any one of embodiments 13-30, wherein said rotationally mixing has a rotational speed of about 3 krpm to 10 krpm.
Embodiment 32
(571) An enzyme reactor comprising a first enzyme, a protein binding film and a solid support, wherein said first enzymes is immobilized to said protein binding film in a first zone, and wherein said protein binding film is immobilized to said solid support.
Embodiment 33
(572) The enzyme reactor of embodiment 32, wherein said enzyme reactor comprises one or more additional enzymes.
Embodiment 34
(573) The enzyme reactor of any one of embodiments 32-33, wherein said one or more additional enzymes are immobilized to said protein binding film in said first zone.
Embodiment 35
(574) The enzyme reactor of any one of embodiments 32-34, wherein at least one of said one or more additional enzymes are immobilized to said protein binding film in one or more zones that are different from said first zone.
Embodiment 36
(575) The enzyme reactor of any one of embodiments 32-35, wherein said enzyme reactor comprises one or more additional zones.
Embodiment 37
(576) The enzyme reactor of any one of embodiments 32-36, wherein said protein binding film is covalently immobilized to said solid support.
Embodiment 38
(577) The enzyme reactor of any one of embodiments 32-37, wherein said protein binding film is non-covalently immobilized to said solid support.
Embodiment 39
(578) The enzyme reactor of any one of embodiments 32-38, wherein said first enzyme or said one or more additional enzymes are covalently bound to said protein binding film.
Embodiment 40
(579) The enzyme reactor of any one of embodiments 32-39, wherein said first enzyme or said one or more additional enzymes are non-covalently bound to said protein binding film.
Embodiment 41
(580) The enzyme reactor of any one of embodiments 32-40, wherein said first enzyme or said one or more additional enzymes comprise a binding moiety.
Embodiment 42
(581) The enzyme reactor of any one of embodiments 32-41, wherein said binding moiety is an expression tag.
Embodiment 43
(582) The enzyme reactor of any one of embodiments 32-42, wherein said expression tag is a His-tag.
Embodiment 44
(583) The enzyme reactor of any one of embodiments 32-43, wherein said protein binding film comprises a binding partner of said binding moiety.
Embodiment 45
(584) The enzyme reactor of any one of embodiments 32-44, wherein said binding partner is nickel, cobalt or copper.
Embodiment 46
(585) The enzyme reactor of any one of embodiments 32-45, wherein said protein binding film comprises an amine group.
Embodiment 47
(586) The enzyme reactor of any one of embodiments 32-46, wherein said solid support is an inner surface of a reactor.
Embodiment 48
(587) The enzyme reactor of any one of embodiments 32-47, wherein said reactor comprises a closed end and an open end.
Embodiment 49
(588) The enzyme reactor of any one of embodiments 32-48, wherein said reactor is cylindrical.
Embodiment 50
(589) The enzyme reactor of any one of embodiments 32-49, wherein said reactor is a glass reactor.
Embodiment 51
(590) The enzyme reactor of any one of embodiments 32-50, wherein said first and said one or more additional zones are along the longitude axis of said solid support.
Embodiment 52
(591) A method for reacting an enzyme and a substrate, said method comprising: a. contacting said protein binding film of said enzyme reactor of embodiment 32 with a substrate of said first enzyme; and b. allowing said substrate to react with said first enzyme.
Embodiment 53
(592) The method of embodiment 52, wherein said substrate is contacted with said protein binding film by continuous flow.
Embodiment 54
(593) The method of any one of embodiments 52-53, further comprising applying a vibrational energy to said enzyme reactor.
Embodiment 55
(594) The method of any one of embodiments 52-54, wherein said substrate is a plurality of substrates.