THERAPEUTIC AND PROPHYLACTIC AGENT FOR GLIOMA, BRAIN TUMOR MALIGNANCY MARKER, BRAIN TUMOR PROGNOSTIC MARKER, METHOD FOR DETERMINING MALIGNANCY AND PROGNOSIS OF BRAIN TUMOR AND ANTIBODY INHIBITING TUMOR PROLIFERATION
20220105122 · 2022-04-07
Inventors
- Kohei Miyazono (Tokyo, JP)
- Ryo TANABE (Tokyo, JP)
- Masato MORIKAWA (Tokyo, JP)
- Carl-Henrik HELDIN (Tokyo, JP)
- Bengt WESTERMARK (Tokyo, JP)
- Koji Tamada (Yamaguchi, JP)
Cpc classification
G01N33/57484
PHYSICS
C07K2317/76
CHEMISTRY; METALLURGY
A61K31/7088
HUMAN NECESSITIES
A61K31/7105
HUMAN NECESSITIES
C07K2317/569
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
C07K16/2878
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
A61K31/7088
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
A novel agent is for treating or preventing a glioma. A marker for malignancy of a brain tumor and a prognostic marker for a brain tumor can be used in a method for determining malignancy of a brain tumor and a method for determining a prognosis for a brain tumor patient. The agent for treating or preventing a glioma can include an HVEM inhibitor as an active ingredient. The marker for malignancy of a brain tumor and the prognostic marker for a brain tumor can each include an HVEM protein or an HVEM gene. The method for determining malignancy of a brain tumor and the method for determining a prognosis for a brain tumor patient can each include measuring an HVEM expression amount in a biological sample of a subject.
Claims
1-14. (canceled)
15. An immunoglobulin single variable domain which binds to HVEM at an EC50 value of less than 80 nM, and suppresses tumor growth.
16. The immunoglobulin single variable domain according to claim 15, which comprises complementarity determining regions 1 to 3 (CDR1, CDR2 and CDR3), wherein amino acid sequences of CDR1, CDR2 and CDR3 are the following (i), (ii), (iii), (iv), (v), (vi) or (vii): (i) CDR1 comprising an amino acid sequence represented by SEQ ID NO: 36, CDR2 comprising an amino acid sequence represented by SEQ ID NO: 37, and CDR3 comprising an amino acid sequence represented by SEQ ID NO: 38; (ii) CDR1 comprising an amino acid sequence represented by SEQ ID NO: 39, CDR2 comprising an amino acid sequence represented by SEQ ID NO: 40, and CDR3 comprising an amino acid sequence represented by SEQ ID NO: 41; (iii) CDR1 comprising an amino acid sequence represented by SEQ ID NO: 42, CDR2 comprising an amino acid sequence represented by SEQ ID NO: 43, and CDR3 comprising an amino acid sequence represented by SEQ ID NO: 44; (iv) CDR1 comprising an amino acid sequence represented by SEQ ID NO: 45, CDR2 comprising an amino acid sequence represented by SEQ ID NO: 46, and CDR3 comprising an amino acid sequence represented by SEQ ID NO: 47; (v) CDR1 comprising an amino acid sequence represented by SEQ ID NO: 48, CDR2 comprising an amino acid sequence represented by SEQ ID NO: 49, and CDR3 comprising an amino acid sequence represented by SEQ ID NO: 50; (vi) CDR1 comprising an amino acid sequence represented by SEQ ID NO: 51, CDR2 comprising an amino acid sequence represented by SEQ ID NO: 52, and CDR3 comprising an amino acid sequence represented by SEQ ID NO: 53; or (vii) CDR1 comprising an amino acid sequence represented by SEQ ID NO: 54, CDR2 comprising an amino acid sequence represented by SEQ ID NO: 55, and CDR3 comprising an amino acid sequence represented by SEQ ID NO: 56.
17. The immunoglobulin single variable domain according to claim 16, which comprises framework regions (FR1, FR2, FR3 and FR4), wherein amino acid sequences of FR1, FR2, FR3 and FR4 are the following (viii), (ix), (x), (xi), (xii), (xiii) or (xiv): (viii) FR1 comprising an amino acid sequence represented by SEQ ID NO: 57, FR2 comprising an amino acid sequence represented by SEQ ID NO: 58, FR3 comprising an amino acid sequence represented by SEQ ID NO: 59, and FR4 comprising an amino acid sequence represented by SEQ ID NO: 60; (ix) FR1 comprising an amino acid sequence represented by SEQ ID NO: 61, FR2 comprising an amino acid sequence represented by SEQ ID NO: 62, FR3 comprising an amino acid sequence represented by SEQ ID NO: 63, and FR4 comprising an amino acid sequence represented by SEQ ID NO: 64; (x) FR1 comprising an amino acid sequence represented by SEQ ID NO: 65, FR2 comprising an amino acid sequence represented by SEQ ID NO: 66, FR3 comprising an amino acid sequence represented by SEQ ID NO: 67, and FR4 comprising an amino acid sequence represented by SEQ ID NO: 68; (xi) FR1 comprising an amino acid sequence represented by SEQ ID NO: 69, FR2 comprising an amino acid sequence represented by SEQ ID NO: 70, FR3 comprising an amino acid sequence represented by SEQ ID NO: 71, and FR4 comprising an amino acid sequence represented by SEQ ID NO: 72; (xii) FR1 comprising an amino acid sequence represented by SEQ ID NO: 73, FR2 comprising an amino acid sequence represented by SEQ ID NO: 74, FR3 comprising an amino acid sequence represented by SEQ ID NO: 75, and FR4 comprising an amino acid sequence represented by SEQ ID NO: 76; (xiii) FR1 comprising an amino acid sequence represented by SEQ ID NO: 77, FR2 comprising an amino acid sequence represented by SEQ ID NO: 78, FR3 comprising an amino acid sequence represented by SEQ ID NO: 79, and FR4 comprising an amino acid sequence represented by SEQ ID NO: 80; or (xiv) FR1 comprising an amino acid sequence represented by SEQ ID NO: 81, FR2 comprising an amino acid sequence represented by SEQ ID NO: 82, FR3 comprising an amino acid sequence represented by SEQ ID NO: 83, and FR4 comprising an amino acid sequence represented by SEQ ID NO: 84.
18. The immunoglobulin single variable domain according to claim 15, which comprises the following polypeptide (xv), (xvi) or (xvii): (xv) a polypeptide having an amino acid sequence of any of SEQ ID NOs: 29 to 35; (xvi) a polypeptide comprising an amino acid sequence having at least 80% identity to the amino acid sequence of any of SEQ ID NOs: 29 to 35, and having HVEM binding ability and tumor growth suppression ability; or (xvii) a polypeptide comprising an amino acid sequence in which one or more amino acids is/are deleted, substituted, inserted and/or added in the amino acid sequence of any of SEQ ID NOs: 29 to 35, and having HVEM binding ability and tumor growth suppression ability.
19. An antibody or an immunoglobulin single variable domain multimer, each comprising the immunoglobulin single variable domain according to claim 15.
20. A polynucleotide encoding the immunoglobulin single variable domain according to claim 15 or the antibody or multimer according to claim 19.
21. A pharmaceutical composition comprising the immunoglobulin single variable domain according to claim 15 or the antibody or multimer according to claim 19.
22. The pharmaceutical composition according to claim 21 which is for use in the treatment or prevention of a glioma.
23. A method for treating or preventing a glioma, comprising the step of administering an effective amount of an HVEM inhibitor to a subject in need thereof.
24. The method according to claim 23, wherein the glioma is any one of oligodendroglioma, oligoastrocytoma, astrocytoma and glioblastoma multiforme.
25. The method according to claim 24, wherein the glioblastoma multiforme belongs to any of proneural subtype, neural subtype, classical subtype and mesenchymal subtype.
26. The method according to claim 23, wherein the HVEM inhibitor is an antibody or nucleic acid against HVEM.
27. The method according to claim 26, wherein the antibody against HVEM is an antibody which inhibits binding between HVEM and a ligand.
28. The method according to claim 23, wherein the glioma is HVEM expression-dependent glioma or HVEM ligand-dependent glioma.
29. The method according to claim 27, wherein the ligand is APRIL.
30. The method according to claim 23, wherein the subject is whose HVEM expression amount exceeds an HVEM expression amount in a healthy subject or an HVEM expression amount in a normal tissue sample.
31. A method for treating malignant tumor or a glioma, comprising the steps of: carrying out a method for determining malignancy of a brain tumor, the method comprising the step of measuring an HVEM expression amount in a biological sample of a subject, and administering an effective amount of an anticancer agent to a subject determined to suffer from, or to be highly likely to suffer from, a highly malignant brain tumor, or a subject determined to suffer from, or to be highly likely to suffer from, a glioma.
32. The method according to claim 31, wherein the anticancer agent is an HVEM inhibitor.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
DETAILED DESCRIPTION OF THE INVENTION
Agent for Treating or Preventing Glioma
[0082] The agents and compositions of the present invention each comprise an HVEM inhibitor as an active ingredient. As used herein, the “HVEM” is an abbreviation for Herpes Virus entry mediator, and refers to a type I transmembrane protein belonging to the TNF/NGF receptor superfamily. HVEM is also referred to as TNFRSF14 (tumor necrosis factor (TNF) receptor superfamily member 14), CD270, LIGHTR or ATAR. That is, the “HVEM” in the present invention is synonymous with “HVEM/TNFRSF14.”
[0083] HVEM is expressed on a variety of tissues and cells including T cells, B cells, natural killer cells, dendritic cells, hematopoietic cells and non-hematopoietic cells (parenchymal cells) (Pasero C et al., Curr Opin Pharmacol., 12: 478-485 (2012)). A plurality of ligands are known to bind to HVEM, including TNF-related cytokines such as LIGHT and LTα and non-TNF-related cytokines such as BTLA, CD160 and SALM5.
[0084] In the present invention, the human HVEM gene is based on the base sequence published in HGNC:11912, and the mouse HVEM gene is based on the base sequence published in MGI:2675303. Also, in the present invention, the human HVEM protein is based on the amino acid sequence published in GenBank Accession No. NP_003811.2, and the mouse HVEM protein is based on the amino acid sequence published in GenBank Accession No. NP_849262.1. Further, in the present invention, mRNA of human HVEM is based on GenBank Accession No. NM_003820.3, and mRNA of mouse HVEM is based on GenBank Accession No. NM_178931.2.
[0085] In the present invention, the HVEM inhibitor is used in the meaning including a substance which inhibits expression of HVEM and a substance which inhibits the function of HVEM. Examples of the substance which inhibits expression of HVEM include nucleic acids against HVEM (e.g., nucleic acids targeting HVEM such as antisense nucleic acids, siRNAs, shRNAs, microRNAs, gRNAs, and ribozymes). The substance which inhibits the function of HVEM is, for example, a substance which inhibits binding between HVEM and a ligand, in addition to a substance which interacts with HVEM to inhibit the function, and examples thereof include antibodies and aptamers.
[0086] APRIL is indicated as the ligand for HVEM. Since signal transduction from APRIL via HVEM was confirmed to promote formation of a tumor (especially, a highly malignant brain tumor such as glioma) as will be presented in the Examples below, a substance which inhibits binding between HVEM and APRIL can be used to efficiently suppress the formation of the tumor. The “APRIL,” as used herein, is an abbreviation for “a proliferation-inducing ligand,” and is also referred to as TNFSF13 (tumor necrosis factor (TNF) superfamily member 13). That is, the “APRIL” in the present invention is synonymous with “APRIL/TNFSF13.”
[0087] Antisense nucleic acids are nucleic acids complementary to a target sequence. The antisense nucleic acid can suppress expression of the target gene, for example, through inhibition of transcription initiation by triple-strand formation, suppression of transcription by hybrid formation with a site where an open loop structure is locally formed by RNA polymerase, inhibition of transcription by hybrid formation with RNA which is being synthesized, suppression of splicing by hybrid formation at a junction point between an intron and an exon, suppression of splicing by hybrid formation with a spliceosome formation site, suppression of migration from the nucleus to the cytoplasm by hybrid formation with mRNA, suppression of splicing by hybrid formation with a capping site and a poly (A) addition site, inhibition of translation initiation by hybrid formation with a translation initiation factor binding site, suppression of translation by hybrid formation with a ribosome binding site near the initiation codon, inhibition of peptide chain elongation by hybrid formation with a translation region or polysome binding site of mRNA, suppression of gene expression by hybrid formation with a nucleic acid-protein interaction site, or the like.
[0088] The antisense nucleic acid against HVEM refers to, for example, a single-stranded nucleic acid complementary to some of base sequences selected from the gene sequence of HVEM described above, the base sequence encoding the amino acid sequence of HVEM described above, and the mRNA sequence of HVEM describe above. The nucleic acid may be a naturally occurring nucleic acid or an artificial nucleic acid, and may be based on either DNA or RNA. The length of the antisense nucleic acid usually ranges from about 15 bases to about the full length of mRNA, preferably from about 15 bases to about 30 bases. The complementarity of the antisense nucleic acid does not necessarily have to be 100%, and may be such that the antisense nucleic acid can complementarily bind to DNA or RNA encoding HVEM in vivo.
[0089] The siRNA (small interfering RNA) is an artificially-synthesized low-molecular-weight double-stranded RNA which is used for gene silencing through RNA interference (degradation of mRNA), and is used in the meaning including an siRNA expression vector which can supply the double-stranded RNA in vivo. The siRNA introduced into cells binds to an RNA-induced silencing complex (RISC). This complex binds to and cleaves mRNA having a sequence complementary to siRNA, thereby making it possible to sequence-specifically suppress gene expression. The siRNA can be prepared by synthesizing each of sense strand and antisense strand oligonucleotides using a DNA/RNA automatic synthesizer, and denaturing the oligonucleotides in appropriate annealing buffer at 90 to 95° C. for about 1 minute, and then annealing the denatured oligonucleotides at 30 to 70° C. for about 1 to 8 hours. The length of the siRNA is preferably 19 to 27 base pairs, more preferably 21 to 25 base pairs, or 21 to 23 base pairs.
[0090] The siRNA against HVEM can be designed based on its base sequence so as to cause degradation of mRNA transcribed from the HVEM gene (RNA interference). Examples of the siRNA which inhibits the expression of HVEM include siRNA which targets the mRNA sequence of HVEM described above.
[0091] The shRNA (short hairpin RNA) is an artificially-synthesized hairpin-type RNA sequence used for gene silencing through RNA interference (degradation of mRNA). The shRNA may be introduced into cells by a vector and expressed by a U6 promoter or H1 promoter, or may be prepared by synthesizing oligonucleotides having an shRNA sequence using a DNA/RNA automatic synthesizer and allowing the oligonucleotides to self-anneal by the same method as siRNA. The hairpin structure of the siRNA introduced into cells is cleaved into siRNA, which binds to an RNA-induced silencing complex (RISC). This complex binds to and cleaves mRNA having a sequence complementary to siRNA, thereby making it possible to sequence-specifically suppress gene expression.
[0092] The shRNA against HVEM can be designed based on its base sequence so as to cause degradation (RNA interference) of mRNA transcribed from the HVEM gene. Examples of the shRNA which inhibits the expression of HVEM include shRNA which targets the mRNA sequence of HVEM described above.
[0093] The miRNA (microRNA) is a functional nucleic acid which is encoded on the genome, undergoes a multi-step production process, and eventually becomes a microRNA of about 20 bases. The miRNA is classified as functional ncRNA (non-coding RNA: a general term for RNAs which are not translated into proteins), and plays an important role, in life phenomena, of regulating expression of other genes. In the present invention, the expression of the HVEM gene can be suppressed by introducing an miRNA having a specific base sequence into cells by a vector and administering the cells to a living body.
[0094] The gRNA (guide RNA) is an RNA molecule used in the genome editing technology. In the genome editing technology, the gRNA specifically recognizes a target sequence, guides binding of Cas9 protein to the target sequence, and enables knockout and knockin of a gene. In the present invention, the expression of the HVEM gene can be suppressed in vivo by administering a gRNA targeting the HVEM gene to a living body. The gRNA is used in the meaning including sgRNA (single guide RNA). Methods for designing gRNAs in the genome editing technology are widely known and can be appropriately designed by referring to, for example, Benchmarking CRISPR on-target sgRNA design, Yan et al., Brief Bioinform, 15 Feb. 2017.
[0095] The ribozyme is an RNA which has catalytic activity. While some of ribozymes have various activities, research on ribozymes as enzymes that cleave an RNA has made it possible to design ribozymes for the purpose of site-specific cleavage of RNAs. The ribozyme may have a size of 400 nucleotides or more, such as group I intron type or M1RNA included in RNase P, or may be a ribozyme having a size of about 40 nucleotides, which is called hammerhead type or hairpin type.
[0096] The aptamer includes a nucleic acid aptamer and a peptide aptamer. The nucleic acid aptamer and peptide aptamer used in the present invention can be obtained by using an in vitro molecular evolution method of forming complexes of library molecules and a target molecule in vitro and then screening them based on affinity, which is typified by the SELEX method (Systematic Evolution of Ligands by Exponential enrichment) or the mRNA display method.
[0097] The antisense nucleic acid, siRNA, shRNA, miRNA, ribozyme and nucleic acid aptamer may include various chemical modifications to improve stability and activity. For example, in order to prevent degradation by a hydrolase such as nuclease, their phosphate residues may be replaced with chemically modified phosphate residues such as phosphorothioate (PS), methylphosphonate, and phosphorodithionate. Alternatively, at least part of them may be composed of a nucleic acid analog such as a peptide nucleic acid (PNA).
[0098] The antibody against HVEM refers to an antibody which specifically binds to HVEM and inhibits the function of HVEM upon binding. In the present invention, any of a monoclonal antibody, a polyclonal antibody, a chimeric antibody, a humanized antibody, a human antibody, a mouse antibody, a rat antibody, a camel antibody, antibody fragments (for example, Fab, Fv, Fab′, F (ab′).sub.2, and ScFv) and the like may be used as the antibody, and these antibodies can be prepared according to a technique known to those skilled in the art. Usable antibodies against HVEM include the immunoglobulin single variable domain of the present invention, the antibody of the present invention and the immunoglobulin single variable domain multimer of the present invention, which will be described later.
[0099] The antibody against HVEM can be manufactured by using an HVEM protein or a part thereof as an antigen according to a known method for manufacturing an antibody or antiserum. The HVEM protein or a part thereof can be prepared by known protein expression method and purification method. Examples of the HVEM protein include, but are not limited to, human HVEM defined by the sequence information of HVEM described above. HVEM proteins derived from various organisms may be used as immunogens. The antibodies against HVEM which can be used in the present invention can also be prepared via a phage display method (see, for example, FEBS Letter, 441:20-24 (1998)).
[0100] The agents and compositions of the present invention are intended for use in treatment or prevention of a glioma. As used herein, the “glioma” is a general term for tumors developed from the neuroectodermal tissue of the brain parenchyma, accounts for 30 to 40% of primary intracranial tumors, and is the most frequent brain tumor. Examples of the glioma include oligodendroglioma, oligoastrocytoma, astrocytoma and glioblastoma multiforme. The “glioblastoma multiforme”, which is also referred to as glioblastoma or anaplastic glioma, is a glioma composed mainly of undifferentiated cells derived from stellate cells. Glioblastoma multiforme exhibits prominent nuclear pleomorphism, and necrosis and vascular endothelial growth are found. Glioblastoma multiforme grows fast, infiltrates extensively, and is often developed in the adult cerebrum. Glioblastoma multiforme has been reported to be classified into four subtypes: proneural, neural, classical and mesenchymal (Verhaak R G et al., Cancer Cell, 17: 98-110 (2010)). As will be presented in the Examples below, HVEM is highly expressed in glioblastoma multiforme of the mesenchymal subtype, and thus the agents and compositions of the present invention can be preferably used in reduction of the risk of developing a glioma as will be described below (especially, glioblastoma multiforme of the mesenchymal subtype), in addition to treatment and prevention of glioblastoma multiforme (especially, glioblastoma multiforme of the mesenchymal subtype).
[0101] As will be prevented in the Examples below, proliferation of glioblastoma multiforme cells and neurosphere formation could be suppressed by inhibiting the expression of HVEM and the function of HVEM in the glioblastoma multiforme cells. In addition, signal transduction from APRIL via HVEM was observed to promote formation of a highly malignant brain tumor such as glioma. Therefore, the HVEM inhibitor, which is the active ingredient of the present invention, can be administered to a subject (for example, a brain tumor patient) whose HVEM expression amount exceeds an HVEM expression amount in a healthy subject or an HVEM expression amount in a normal tissue sample, particularly, a brain tumor patient in which HVEM is highly expressed in the brain. In addition, the target for treatment and prevention of the present invention can be an HVEM expression-dependent glioma or an HVEM ligand-dependent glioma. Whether the subject highly expresses HVEM, whether the glioma is HVEM-dependent, and whether the glioma is HVEM ligand-dependent can be evaluated, for example, for brain tissue excised during the brain surgery performed on the brain tumor patient, and details thereof can be determined according to the determining methods of the present invention which will be described below and the procedures which will be described in the Examples.
[0102] The agents and compositions of the present invention can also be administered to a subject at risk of developing a glioma (especially, glioblastoma multiforme), thereby reducing the risk of developing a glioma. As used herein, the “subject at risk of developing a glioma” means a subject who notices no symptoms of a glioma or who has not been diagnosed as having a glioma but is in danger of developing a glioma in the future. Examples of the subject includes brain tumor patients who have not been diagnosed as having a glioma and brain tumor patients who have undergone resection of brain tumor tissue. In addition, the “reduction of the risk of developing a glioma” means that the probability of developing a glioma is reduced, and the prognosis of a malignant brain tumor can be improved by reducing the probability of developing a glioma.
[0103] That is, according to another aspect of the present invention, there are provided an agent for reducing the risk of developing a glioma and a composition for use in reduction of the risk of developing a glioma, each comprising an HVEM inhibitor as an active ingredient, and also provided an agent for improving a prognosis in treatment of a malignant brain tumor and a composition for use in improvement of a prognosis in treatment of a brain tumor, each comprising an HVEM inhibitor as an active ingredient.
[0104] The agents and compositions of the present invention can be provided as pharmaceutical products or pharmaceutical compositions. The pharmaceutical products and pharmaceutical compositions of the present invention each comprise an HVEM inhibitor and a pharmaceutically acceptable carrier. The pharmaceutical products and pharmaceutical compositions of the present invention also include pharmaceutical products and pharmaceutical compositions intended for gene therapy. Such pharmaceutical products and pharmaceutical compositions comprise a nucleic acid targeting HVEM, such as an antisense nucleic acid, siRNA, shRNA, microRNA, gRNA, or a ribozyme as an active ingredient.
[0105] The pharmaceutical products and pharmaceutical compositions of the present invention may comprise an active ingredient other than the HVEM inhibitor, or may be used in combination with an active ingredient other than the HVEM inhibitor or a pharmaceutical product or pharmaceutical composition comprising the active ingredient. Examples of the active ingredient other than the HVEM inhibitor include anticancer agents (especially, anticancer agents intended for treatment of malignant brain tumors).
[0106] When the HVEM inhibitor, which is the active ingredient of the present invention, is administered to a subject, the administration route is not particularly limited as long as the effect for treating or preventing a glioma (especially, glioblastoma multiforme) can be obtained, but is preferably parenteral administration (for example, intravenous administration, local administration (including local administration using a catheter), subcutaneous administration, or intraperitoneal administration).
[0107] As a preparation for parenteral administration, an appropriate dosage form can be selected according to the specific administration form, and examples thereof include injections and suppositories. These formulations can be prepared using a pharmaceutically acceptable carrier by a technique commonly used in the art (for example, the known method described in the Japanese Pharmacopoeia, 15th Edition, General Regulations for Preparations). The pharmaceutically acceptable carrier includes excipients, binders, diluents, additives, perfumes, buffers, thickeners, colorants, stabilizers, emulsifiers, dispersants, suspending agents, and preservatives.
[0108] The dose of the HVEM inhibitor in the present invention can be determined depending on the type of active ingredient, the sex, age and body weight of the subject to which the HVEM inhibitor is administered, symptoms, dosage form, administration route, and the like. In the present invention, when the HVEM inhibitor is administered for the purpose of treating or preventing a glioma (especially, glioblastoma multiforme), the single dose of the HVEM inhibitor for an adult can be determined, for example, in the range of from 0.0001 mg to 1000 mg/kg of body weight, but is not limited thereto. The daily dose of the HVEM inhibitor for an adult can be determined depending on the type of active ingredient, the sex, age and body weight of the subject to which the HVEM inhibitor is administered, symptoms, dosage form, administration route, and the like. For example, the dose of the active ingredient can be administered once daily or divided into 2 to 4 parts. The agents and compositions of the present invention can be administered not only to humans in need thereof, but also to non-human mammals (e.g., mice, rats, rabbits, dogs, cats, cows, horses, pigs, sheep, goats, and monkeys).
Marker for Malignancy of Brain Tumor and Prognostic Marker for Brain Tumor
[0109] As will be described in the Examples below, it was shown that high expression of HVEM correlates with a brain tumor, especially glioblastoma multiforme belonging to the mesenchymal subtype, and that high expression of HVEM correlates with a poor prognosis for a glioblastoma patient. It was also confirmed that overexpression of HVEM promotes proliferation of glioblastoma multiforme cells, neurosphere formation and in vivo tumor growth. Thus, according to the present invention, there are provided a marker for malignancy of a brain tumor consisting of an HVEM protein or an HVEM gene and a prognostic marker for a brain tumor consisting of an HVEM protein or an HVEM gene. The marker for malignancy of a brain tumor of the present invention can be used to determine malignancy of a brain tumor in a brain tumor patient, and can also be used to determine a glioma (especially, glioblastoma multiforme). The prognostic marker for a brain tumor of the present invention can be used to predict or estimate a prognosis for a brain tumor patient in treatment of a brain tumor. Therefore, these markers of the present invention are useful as indicators in determining the treatment policy for a brain tumor.
[0110] In order to use the markers of the present invention in diagnosis of human patients, the HVEM protein or HVEM gene is preferably derived from a human. Further, in the markers of the present invention, the HVEM gene may be a DNA consisting of the genome sequence of the HVEM gene, or may be the mRNA of the HVEM gene or a cDNA obtained by reverse transcription of the mRNA of the HVEM gene. The markers of the present invention can be implemented according to the method for determining malignancy of a brain tumor of the present invention and the method for determining a prognosis for a brain tumor patient of the present invention.
Methods for Determining Malignancy and Prognosis of a Brain Tumor
[0111] According to another aspect of the present invention, there is provided a method for determining malignancy of a brain tumor, the method comprising the step of measuring an HVEM expression amount in a biological sample of a subject (especially, brain tumor patient).
[0112] In the present invention, the “biological sample” means a sample separated from a living body, and examples thereof include brain tissue excised during brain surgery.
[0113] In the method for determining the malignancy of the present invention, first, the step (A) of measuring an HVEM expression amount in a biological sample of a subject to be tested is carried out. The HVEM expression amount can be measured in vitro by a known method.
[0114] For example, the HVEM expression amount in a biological sample can be measured based on the expression amount of the HVEM protein. In this case, the expression amount of the HVEM protein can be measured by a known detection means using a specific binding substance to the HVEM protein, and can be measured by, for example, ELISA, Western blotting, immunohistochemical staining or the like. Examples of the specific binding substance to the HVEM protein include antibodies, and those described for the agents and compositions of the present invention and the antibodies of the present invention can be used.
[0115] The HVEM expression amount in a biological sample can also be measured based on the expression amount of the HVEM gene. In this case, the expression amount of the HVEM gene can be measured by a known method such as RT-PCR, quantitative RT-PCR, DNA microarray analysis, Northern blotting or the like. The probe and primer set used in measurement of the expression amount of the HVEM gene can be prepared based on the sequence information of the HVEM gene described above with reference to the Examples described later.
[0116] In the method for determining the malignancy of the present invention, the step of determining a degree of malignancy of the tumor cell contained in the biological sample based on the HVEM expression amount measured in the step (A) can further be carried out. In this step, when the HVEM expression amount in the biological sample of the subject exceeds the HVEM expression amount in a biological sample of a healthy subject or in a normal tissue sample (preferably, with a significant difference), it is shown that the biological sample contains a highly malignant tumor cell population (for example, glioma cells, especially, glioblastoma multiforme cells). That is, the method for determining the malignancy of the present invention may further comprise the step (B1) of, when the HVEM expression amount in the biological sample of the subject exceeds the HVEM expression amount in a biological sample of a healthy subject or in a normal tissue sample (preferably, with a significant difference), determining that the biological sample contains a highly malignant tumor cell population.
[0117] In the method for determining the malignancy of the present invention, the step of determining malignancy of a brain tumor for the subject from which the biological sample has been collected, based on the HVEM expression amount measured in the step (A) can further be carried out. In this step, it is indicated that the subject suffers from a highly malignant brain tumor (for example, glioma, especially, glioblastoma multiforme) if the HVEM expression amount in the biological sample of the subject exceeds the HVEM expression amount in a biological sample of a healthy subject or in a normal tissue sample (preferably, with a significant difference). That is, the method for determining the malignancy of the present invention may further comprise the step (B2) of, when the HVEM expression amount in the biological sample of the subject exceeds the HVEM expression amount in a biological sample of a healthy subject or in a normal tissue sample (preferably, with a significant difference), determining that the subject suffers from a highly malignant brain tumor.
[0118] In the present invention, the HVEM expression amount in a biological sample of a healthy subject or in a normal tissue sample (cutoff value) can be an average value calculated by measuring HVEM expression amounts in biological samples preliminarily collected from a plurality of healthy subjects or in normal tissues preliminarily collected from a plurality of subjects (including brain tumor patients), or can be a value calculated according to the following equation (1).
Cutoff value=(average value of HVEM expression amount in biological sample of healthy subject or in normal tissue sample)±k×(standard deviation of HVEM expression amount in biological sample of healthy subject or in normal tissue sample) Equation (1)
wherein k is a constant of 0 to 3, preferably k=1 to 3, and, particularly, can be 2.
[0119] According to the method for determining the malignancy of the present invention, a highly malignant tumor cell population such as glioma cells can be detected in the biological sample to be tested. According to the method for determining the malignancy of the present invention, a highly malignant brain tissue such as a glioma can be detected in the subject. Therefore, the method for determining the malignancy of the present invention is useful in that the method provides a material for judging the treatment policy for a brain tumor. That is, the method for determining the malignancy of the present invention can be adjunctively used in diagnosis and/or differentiation of a glioma (especially, glioblastoma multiforme), and whether the subject suffers from a glioma can be ultimately judged, by the doctor, in combination with other findings.
[0120] According to another aspect of the present invention, there is provided a method for determining a prognosis for a brain tumor patient, the method comprising the step of measuring an HVEM expression amount in a biological sample of a subject (especially, brain tumor patient).
[0121] In the method for determining the prognosis of the present invention, first, the step (C) of measuring an HVEM expression amount in a biological sample of a subject to be tested is carried out. The HVEM expression amount can be measured in the same manner as the method for determining the malignancy of the present invention.
[0122] In the method for determining the prognosis of the present invention, the step of determining a prognosis for the subject from which the biological sample has been collected, based on the HVEM expression amount measured in the step (C), can further be carried out. In this step, it is indicated that the subject has a poor prognosis if the HVEM expression amount in the biological sample of the subject exceeds the HVEM expression amount in a biological sample of a healthy subject or in a normal tissue sample (preferably, with a significant difference). That is, the method for determining the malignancy of the present invention may further comprise the step (D) of, when the HVEM expression amount in the biological sample of the subject exceeds the HVEM expression amount in a biological sample of a healthy subject or in a normal tissue sample (preferably, with a significant difference), determining that the subject has a poor prognosis. The HVEM expression amount in a biological sample of a healthy subject or in a normal tissue sample (cutoff value) can be an average value calculated by measuring HVEM expression amounts in biological samples preliminarily collected from a plurality of healthy subjects or in normal tissues preliminarily collected from a plurality of subjects (including brain tumor patients), or can be a value calculated according to the above equation (1). In addition, in the method for determining the malignancy of the present invention, poor prognosis means that the survival rate within a predetermined period is lower and that there is a high probability of developing a highly malignant brain tumor (for example, glioma, particularly, glioblastoma multiforme).
[0123] The method for determining the prognosis of the present invention can be used to predict or estimate a prognosis for a brain tumor patient in treatment of a brain tumor. Therefore, the method for determining the prognosis of the present invention is useful in that the method provides a material for judging the treatment policy for a brain tumor. That is, the method for determining the prognosis of the present invention can be adjunctively used in diagnosis and/or differentiation of a glioma (especially, glioblastoma multiforme), and whether the prognosis for the subject is poor or good can be ultimately judged, by the doctor, in combination with other findings.
Single Variable Domain and Antibody
[0124] According to the present invention, there is provided an immunoglobulin single variable domain which specifically binds to HVEM and suppresses tumor growth (especially, proliferation of malignant tumor cells). The single variable domain of the present invention can bind to HVEM at an EC50 value of less than 80 nM.
[0125] The single variable domain of the present invention can be characterized by complementarity determining regions 1 to 3 (CDR1, CDR2 and CDR3), and CDR1, CDR2 and CDR3 can be identified by a combination of CDR1, CDR2 and CDR3 selected from the group consisting of the above (i), (ii), (iii), (iv), (v), (vi) and (vii).
[0126] The single variable domain of the present invention can also be characterized by framework regions 1 to 4 (FR1, FR2, FR3 and FR4), and FR1, FR2, FR3 and FR4 can be identified by a combination of FR1, FR2, FR3 and FR4 selected from the group consisting of the above (viii), (ix), (x), (xi), (xii), (xiii) and (xiv). The single variable domain of the present invention can be identified by the complementarity determining regions 1 to 3 and the framework regions 1 to 4, and, in this case, the single variable domain of the present invention can be composed of FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 linked from the N-terminal side in this order.
[0127] When CDR1, CDR2 and CDR3 of the single variable domain of the present invention are the above combination (i), the above combination (viii) can be selected as the combination of FR1, FR2, FR3 and FR4. When CDR1, CDR2 and CDR3 of the single variable domain of the present invention are the above combination (ii), the above combination (ix) can be selected as the combination of FR1, FR2, FR3 and FR4. When CDR1, CDR2 and CDR3 of the single variable domain of the present invention are the above combination (iii), the above combination (x) can be selected as the combination of FR1, FR2, FR3 and FR4. When CDR1, CDR2 and CDR3 of the single variable domain of the present invention are the above combination (iv), the above combination (xi) can be selected as the combination of FR1, FR2, FR3 and FR4. When CDR1, CDR2 and CDR3 of the single variable domain of the present invention are the above combination (v), the above combination (xii) can be selected as the combination of FR1, FR2, FR3 and FR4. When CDR1, CDR2 and CDR3 of the single variable domain of the present invention are the above combination (vi), the above combination (xiii) can be selected as the combination of FR1, FR2, FR3 and FR4. When CDR1, CDR2 and CDR3 of the single variable domain of the present invention are the above combination (vii), the above combination (xiv) can be selected as the combination of FR1, FR2, FR3 and FR4.
[0128] The single variable domain of the present invention can also be identified by the single variable domain sequenced in the Examples (the above polypeptide (xv)), but, in the present invention, in addition to this, a polypeptide which is substantially identical with the above polypeptide (xv) is also included in the single variable domain of the present invention.
[0129] An example of the polypeptide which is substantially identical with the single variable domain of the present invention is a humanized single variable domain. A method for humanizing a single variable domain is known. For example, a humanized single variable domain can be obtained by comparing the sequences of the framework regions of the amino acid sequence of a naturally occurring single variable domain with the corresponding framework sequences of the amino acid sequences of one or more closely-related human single variable domains to confirm potentially useful humanization replacements, and then introducing the one or more potentially useful humanization replacements thus determined into the amino acid sequence of the single variable domain of the present invention. The humanized single variable domain thus obtained can be subjected to confirmatory tests for affinity for the target, stability and other desired properties to determine the amino acid sequence of an appropriate humanized single variable domain.
[0130] The polypeptide which is substantially identical with the single variable domain of the present invention can be represented by a polypeptide selected from the above (xvi) and (xvii).
[0131] In the above (xvi), the “identity” is used in the meaning including “homology”. As used herein, the “identity” is, for example, a degree of identity when the sequences to be compared are appropriately aligned, and means the appearance rate (%) of an accurate amino acid match between the sequences. For identity, for example, the presence of gaps in the sequences and the properties of the amino acids are considered (Wilbur, Natl. Acad. Sci. U.S.A. 80:726-730 (1983)). The alignment can be performed, for example, by using an arbitrary algorithm, and specifically, BLAST (Basic local alignment search tool) (Altschul et al., J. Mol. Biol. 215:403-410 (1990)), FASTA (Peasron et al., Methods in Enzymology 183:63-69 (1990)), Smith-Waterman (Meth. Enzym., 164, 765 (1988)) and other homology search software can be used. In addition, the identity can be calculated using, for example, a known homology search program as indicated above, and, for example, can be calculated using default parameters in the homology algorithm BLAST (https://blast.ncbi.nlm.nih.gov/Blast.cgi) of the National Center for Biotechnology Information (NCBI).
[0132] The identity in the above (xvi) can be 80% or more, 85% or more, 90% or more, 95% or more, 96% or more, 97% or more, 98% or more, or 99% or more.
[0133] In the above (xvii), the sentence that “one or more amino acids is/are deleted, substituted, inserted and/or added in the amino acid sequence” means that a number of amino acids produced by a known method such as site mutagenesis, or a number of naturally occurring amino acids have been modified by deletion, substitution, insertion and/or addition. The number of amino acids modified by the substitution or the like is, for example, 1 to 20, 1 to 15, 1 to 10, 1 to 5, 1 to 4, 1 to 3, 1 to 2, or 1. In the amino acid sequence, the modifications may occur continuously or discontinuously, for example.
[0134] Examples of the insertion of an amino acid in the above (xvii) include an insertion into the amino acid sequence. Further, the addition of an amino acid in the (xvii) may be, for example, an addition to the N-terminal or C-terminal of the amino acid sequence, or an addition to both the N-terminal and the C-terminal.
[0135] The substitution of an amino acid in the above (xvii) means that an amino acid residue constituting the amino acid sequence is substituted with another type of amino acid residue. The substitution of an amino acid in the above (xvii) may be, for example, a conservative substitution. The “conservative substitution” means substituting one or more amino acids with another/other amino acid(s) and/or amino acid derivative(s) so as not to substantially modify the function of the protein. In the conservative substitution, the amino acid to be substituted and the amino acid after substitution are preferably similar, for example, in properties and/or function. Specifically, they are preferably similar in chemical properties such as indicators of hydrophobicity and hydrophilicity, polarity and charge, or physical properties such as secondary structure. Thus, amino acids or amino acid derivatives having similar properties and/or functions are known in the art. Examples of non-polar amino acids (hydrophobic amino acids) include alanine, valine, isoleucine, leucine, proline, tryptophan, phenylalanine, and methionine. Examples of polar amino acids (neutral amino acids) include glycine, serine, threonine, tyrosine, glutamine, asparagine, and cysteine. Examples of positively-charged amino acids (basic amino acids) include arginine, histidine, and lysine, and examples of negatively-charged amino acids (acidic amino acids) include aspartic acid and glutamic acid.
[0136] A preferred amino acid modification in the above (xvii) is, for example, one amino acid substitution, two amino acid substitution, three amino acid substitution, four amino acid substitution, five amino acid substitution, six amino acid substitution, or seven amino acids substitution, and a modification in which the substitution is a conservative substitution is more preferred. A preferred amino acid modification in the above (xvii) is, for example, a modification which has occurred in the framework regions 1 to 4, and a modification which has occurred only in the framework regions 1 to 4 is more preferred. A preferred amino acid modification in the above (xvii) is, for example, a modification which is one amino acid substitution, two amino acid substitution, three amino acid substitution, four amino acid substitution, five amino acid substitution, six amino acid substitution, or seven amino acids, and has occurred in the framework regions 1 to 4. A modification which is one amino acid substitution, two amino acid substitution, three amino acid substitution, four amino acid substitution, five amino acid substitution, six amino acid substitution, or seven amino acids, and has red only in the framework regions 1 to 4 is more preferred.
[0137] According to another aspect of the present invention, there are provided an antibody and an immunoglobulin single variable domain multimer, each comprising the immunoglobulin single variable domain of the present invention. Such an antibody includes a so-called heavy chain antibody (or VHH antibody) composed only of two heavy chains as variable regions. Further, the multimer includes a complex in which a plurality of the single variable domains of the present invention bind to each other directly or via a linker, and one or more optional components (e.g., a physiologically active peptide and a stabilizing substance) other than the single variable domain of the present invention may be further linked to such a complex.
[0138] The single variable domain, antibody and multimer of the present invention can be manufactured, for example, by expressing polynucleotides encoding them in a host and recovering expression products. Thus, according to yet another aspect of the present invention, there are provided a polynucleotide encoding the single variable domain, antibody or multimer of the present invention, and a host cell obtained by introducing the polynucleotide of the present invention or a vector to which the polynucleotide of the present invention is operably linked. The “polynucleotide encoding the single variable domain or the like” can be identified based on the genetic code (that is, codon) based on the amino acid sequence of the single variable domain or the like. In the present invention, the “polynucleotide” includes DNA and RNA, and further includes modified products thereof and artificial nucleic acids, but DNA is preferred. Also, the DNA includes cDNA, genomic DNA and chemically-synthesized DNA.
[0139] The polynucleotide of the present invention is not particularly limited as long as it can be expressed in the host to be used and is composed of codons encoding the single variable domain or the like having HVEM binding activity. In order to enable expression of the polynucleotide in the host to be used or to increase the expression amount, the codons may be optimized. The codons can be optimized by a known method commonly used in the art.
[0140] The single variable domain or the like of the present invention can be expressed in various host cells such as bacterial cells, molds, animal cells, plant cells, baculovirus/insect cells or yeast cells. An expression vector for expressing the single variable domain or the like of the present invention is known, and vectors suitable for various host cells can be used.
[0141] When the single variable domain or the like expressed in the host is extracted from cultured bacterial cells or cultured cells, after culturing, the bacterial cells or cultured cells are collected by a known method, suspended in appropriate buffer, destroyed by ultrasonic waves, lysozyme and/or freeze thawing, and then subjected to centrifugation or filtration to obtain a soluble extract, and the target single variable domain or the like can be obtained from the obtained extract using an appropriate combination of known separation and purification methods. As known separation and purification methods, there can be used a method of utilizing solubility, such as salting-out or solvent precipitation; a method of mainly utilizing a difference in molecular weight, such as dialysis, ultrafiltration, gel filtration or SDS-PAGE; a method of utilizing a difference in charge, such as ion exchange chromatography; a method of utilizing a specific affinity, such as affinity chromatography; a method of utilizing a difference in hydrophobicity, such as reverse phase high performance liquid chromatography; and a method of utilizing a difference in isoelectric point, such as an isoelectric point electrophoresis.
[0142] The single variable domain, antibody or multimer of the present invention has HVEM binding activity and can suppress tumor growth. Since substances which inhibit the expression of HVEM and substances which inhibit the function of HVEM can be used in treatment or prevention of a glioma as described above, the single variable domain, antibody or multimer of the present invention can be used as an active ingredient of a pharmaceutical composition, and, in particular, can be used as an active ingredient of the agents and compositions of the present invention (that is, agents for treating and preventing a glioma).
Other Aspects of the Present Invention
[0143] According to another aspect of the present invention, there is provided a method for treating or preventing a glioma, comprising the step of administering an effective amount of an HVEM inhibitor to a subject in need thereof. Also, according to another aspect of the present invention, there is provided a method for reducing the risk of developing a glioma, comprising the step of administering an effective amount of an HVEM inhibitor to a subject in need thereof. Also, according to another aspect of the present invention, there is provided a method for improving a prognosis in treatment of a malignant brain tumor, comprising the step of administering an effective amount of an HVEM inhibitor to a subject in need thereof. The methods of the present invention can be carried out according to the descriptions regarding the agents and compositions of the present invention.
[0144] According to another aspect of the present invention, there is provided a method for treating a malignant tumor or glioma, comprising: carrying out the method for determining the malignancy of the present invention; and administering an effective amount of an anticancer agent (for example, an anticancer agent intended for treatment of a malignant brain tumor, preferably an HVEM inhibitor, especially, a substance which inhibits binding between HVEM and APRIL) to a subject determined to suffer from, or to be highly likely to suffer from, a highly malignant brain tumor (or a subject determined to suffer from, or to be highly likely to suffer from, a glioma). The method of the present invention can be carried out according to the descriptions regarding the method for determining the malignancy of the present invention and the descriptions regarding the agents and compositions of the present invention.
[0145] According to another aspect of the present invention, there is provided use of an HVEM inhibitor, for manufacture of an agent for treating or preventing a glioma, or as an agent for treating or preventing a glioma. Also, according to another aspect of the present invention, there is provided use of an HVEM inhibitor, for manufacture of an agent for reducing the risk of developing a glioma, or as an agent for reducing the risk of developing a glioma. Also, according to another aspect of the present invention, there is provided use of an HVEM inhibitor, for manufacture of an agent for improving a prognosis in treatment of a malignant brain tumor, or as an agent for improving a prognosis in treatment of a malignant brain tumor. The uses of the present invention can be carried out according to the descriptions regarding the agents and compositions of the present invention.
[0146] According to another aspect of the present invention, there is provided an HVEM inhibitor, as an agent for treating or preventing a glioma, for use in treatment or prevention of a glioma, or for use in the treating or preventing method of the present invention. Also, according to another aspect of the present invention, there is provided an HVEM inhibitor, as an agent for reducing the risk of developing a glioma, for use in reduction of the risk of developing a glioma, or for use in the risk reducing method of the present invention. Also, according to another aspect of the present invention, there is provided an HVEM inhibitor, as an agent for improving a prognosis in treatment of a malignant brain tumor, or for use in improvement of a prognosis in treatment of a malignant brain tumor, or for use in the prognosis improving method of the present invention. The HVEM inhibitor can be carried out according to the descriptions regarding the agents and compositions of the present invention.
[0147] The methods and uses of the present invention may be uses in mammals including humans, and are intended to involve both of therapeutic use and non-therapeutic use. The “non-therapeutic,” as used herein, means elimination of operating, treating or diagnosing activities to a human (i.e., medical activities to a human), and specifically means elimination of a method of performing operation or treatment of, or diagnosis involving, a human by a doctor or a person who receives an instruction from the doctor.
EXAMPLES
[0148] Hereinafter, the present invention will be described in more detail by way of the following examples, but is not limited thereto.
Database
[0149] Repository for Molecular Brain Neoplasia Data (REMBRANDT) and The Cancer Genome Atlas (TCGA) were extracted from Project Betastasis (http://www.betastasis.com), TCGA data portal (https://tcga-data.nci.nih.gov), and NIH's Genome Data Commons (https://api.gdc.cancer.gov).
Statistical Analysis
[0150] Statistical analyses (Welch's t-test, Student's t-test, two-way analysis of variance, Kruskal-Wallis test, and logrank test) were performed by statistical software R (http://www.R-project.org).
Example 1: Inhibitory Effect of BMP-4 on Proliferation of GBM Cell Strain and Neurosphere Formation
(1) Culture Conditions for Human Glioblastoma Cell
[0151] Human glioblastoma multiforme cells, i.e., U3024MG, U3031MG and U3054MG cell strains, were obtained from the Human Glioblastoma Cell Culture resource (http://www.hgcc.se/#, sometimes referred to simply as “HGCC” herein), and maintained under conditions for maintaining characteristics (Xie Y et al., EBioMedicine, 2:1351-63(2015)) of glioma-initiating cells (sometimes referred to simply as “GIC” herein). Specifically, the cell strains were cultured in DMEM/F12 (manufactured by Thermo Fisher Scientific Inc.) and Neurobasal media (manufactured by Thermo Fisher Scientific Inc.) which were enriched with B-27 supplement (manufactured by Thermo Fisher Scientific Inc.), N-2 supplement (manufactured by Thermo Fisher Scientific Inc.), 20 ng/mL of epidermal growth factor (EGF, manufactured by PeproTech, Inc.), and Fibroblast Growth Factor-basic (bFGF, manufactured by PeproTech, Inc.).
(2) BMP-4 Treatment
[0152] To the cells prepared in the above item (1), 30 ng/mL of recombinant human BMP-4 (manufactured by R & D Systems, Inc.) was added. In addition, a group to which the BMP-4 was not added was prepared as a control.
(3) In Vitro Cell Proliferation Assay
[0153] The cells prepared in the above item (2) were cultured for 7 days, and an in vitro cell proliferation assay was performed. Cell Count Kit-8 (manufactured by Nacalai Tesque, Inc.) was used according to the manufacturer's instructions. The number of cells was measured by measuring the absorbances at 450 nm and 595 nm using a microplate reader (Model 680, manufactured by Bio-Rad Laboratories, Inc.) or Enspire (manufactured by PerkinElmer, Inc.).
(4) Sphere Formation Assay
[0154] The cells prepared in the above item (2) were seeded on an ultra-low adhesion microplate (manufactured by Corning Inc.) at a density of 1 to 100 cells/well, and cultured for 7 days. Cell clusters having a diameter of 20 μm or more were regarded as spheres. Wells without spheres were counted in each condition.
(5) Results
[0155] The results were as shown in
Example 2: Search for BMP-4 Target Gene
(1) RNA Sequence Analysis
[0156] RNA sequence analysis was performed to identify BMP target genes using human glioblastoma cells TGS-04 (Raja E. et al., Oncogene, 36:4963-4974 (2017)). Expression amounts of genes controlled by BMP-4 stimulation in the RNA sequence data were analyzed based on their FPKM value (fragments per kilobase of exon per million fragments), and genes whose FPKM value was suppressed to ½ or less by BMP-4 stimulation were extracted. Furthermore, genes encoding transmembrane proteins were searched from among the extracted genes. As a result, it was confirmed that the expression of HVEM was suppressed to ½ or less by BMP-4 in the TGS-04 cells (data not shown).
(2) Quantitative Real-Time (RT)-PCR Analysis
[0157] Total RNA was extracted from the GBM cells prepared in Example 1 (2) (U3024MG cells or U3031MG cells) using RNeasy Mini Kit (manufactured by Qiagen), and the expression of human HVEM and human GAPDH (used for standardization of relative expression amounts) was analyzed. The primers used for quantitative RT-PCR are indicated in Table 1. Complementary DNA was synthesized using PrimeScript II 1st Strand cDNA Synthesis Kit (manufactured by Takara Bio Inc.). The gene expression level was quantified by Step One Plus Real-Time PCR Systems (manufactured by Applied Biosystems) using FastStart Universal SYBR Green Master Mix (manufactured by Roche).
TABLE-US-00001 TABLE 1 Primer set used in quantitative RT-PCR SEQ Target Forward/ ID Species gene reverse Sequence (5′ .fwdarw. 3′) NO: Homo sapiens GAPDH Forward GAAGGTGAAGGTCGGAGTC 1 Homo sapiens GAPDH Reverse GAAGATGGTGATGGGATTTC 2 Homo sapiens HVEM Forward GTGTCTGCAGTGCCAAATGT 3 Homo sapiens HVEM Reverse CCACACACGGCGTTCTCT 4
[0158] The results were as shown in
Example 3: Correlation Between HVEM Expression and Poor Prognosis for GBM Patient
[0159] The following expressions (1) to (4) were analyzed using The National Cancer Institute Genomic Data Commons (sometimes referred to simply as “GDC” herein) TCGA brain tumor data set.
(1) Expression of HVEM in GBM
[0160] To investigate the function of HVEM in brain tumors, the expression level of HVEM mRNA was analyzed using the GDC TCGA dataset. The results were as shown in
(2) Survival of Brain Tumor Patient and Expression of HVEM
[0161] Survival of brain tumor patients was analyzed using the GDC TCGA dataset. The results were as shown in
(3) Expression of HVEM in GBM Subtype
[0162] The expression of HVEM in four subtypes of GBM (proneural, neural, classical and mesenchymal, based on the classification of Verhaak et al., Cancer Cell, 17:98-110 (2010)) was analyzed. The results were as shown in
(4) Expression of HVEM in GBM Subtype
[0163] The expression of HVEM in 13 different GBM cell strains (obtained from HGCC resource (Xie Y et al., EBioMedicine, 2:1351-63 (2015)) and H9 hESC-derived human neural stem cells (hNSC, manufactured by Thermo Fisher Scientific Inc.) was analyzed by quantitative RT-PCR. In addition, hNSC was cultured in KnockOut DMEM/F12 (manufactured by Thermo Fisher Scientific Inc.) supplemented with StemPro nerve supplement (manufactured by Thermo Fisher Scientific Inc.), EGF (20 ng/mL) and bFGF (20 ng/mL). For the cells, the primers used were SEQ ID NOs: 1 to 4 shown in Table 1, and RT-PCR was performed according to the method described in Example 2 (2). The results were as shown in
Example 4: Suppression of Proliferation of GBM Cell and Neurosphere Formation by Inhibition of HVEM
[0164] (1) Inhibition of HVEM by shRNA
[0165] The DNA sequences encoding the short hairpin RNAs (shRNAs) indicated in Table 2 were each inserted into the pENTR4-H1 or pENTR4-mU6 vector. An LR reaction between the pENTR4-H1 and CS-RfA-CMV-PuroR vectors or between pENTR4-mU6 and CS-RfA-CG was catalyzed by LR Clonase (manufactured by Thermo Fisher Scientific Inc.). The vector plasmids pCAG-HIVgp and pCMV-VSV-G-Rev were transduced into HEK293FT cells using Lipofectamine 2000 (manufactured by Thermo Fisher Scientific Inc.). Lentivirus particles were concentrated with Lenti-X concentrator (manufactured by Takara Bio Inc.) and then reconstituted with serum-free buffer.
TABLE-US-00002 TABLE 2 shRNA sequence SEQ Target sequence of ID Species shRNA shRNA (5′ .fwdarw. 3′) NO: Control GUGGUUUACAUGUCGACUAA 5 shRNA #1 Control AUGGUUUACAUGUUGUGUGA 6 shRNA #2 Homo sapiens HVEM shRNA #1 GUGCAGUCCAGGUUAUCGUGU 7 Homo sapiens HVEM shRNA #2 GAGCUGACGGGCACAGUGUGU 8
[0166] Each of the prepared shRNAs was introduced into the mesenchymal subtype cells (U3024MG cells, U3031MG cells or U3054MG cells) cultured under the conditions described in Example 1 (1). Next, the HVEM expression in the GBM cells (U3024MG cells, U3031MG cells or U3054MG cells) into which each shRNA was introduced was analyzed by quantitative RT-PCR. Specifically, the primers used were SEQ ID NOs: 1 to 4 shown in Table 1, and RT-PCR was performed according to the method described in Example 2 (2).
(2) Inhibition of HVEM by Antibody
[0167] An antibody against human HVEM (MAB356, manufactured by R & D Systems, Inc.) or a mouse IgG1 antibody (MAB002, manufactured by R & D Systems, Inc.) as a control was used to suppress the function of HVEM on the surface of GBM cells (U3024MG cells, U3031MG cells or U3054MG cells), for investigating the proliferation of the GBM cells. Specifically, 10 μg/mL of the human HVEM antibody or mouse IgG1 isotype control antibody was added to a culture solution, and the GBM cells were treated with the anti-human HVEM antibody or control antibody.
(3) In Vitro Cell Proliferation Assay
[0168] For the cells prepared in the above items (1) and (2), an in vitro cell proliferation assay was performed according to the method described in Example 1 (3).
(4) Sphere Formation Assay
[0169] For the cells prepared in the above item (1), a sphere formation assay was performed according to the method described in Example 1 (4).
(5) Results
[0170] The results were as shown in
Example 5: Suppression of In Vivo Tumor Growth of GBM Cell by Silencing of HVEM
[0171] (1) Inhibition of HVEM by shRNA in GBM Cell
[0172] Firefly luciferase (Luc2, manufactured by Promega Corporation, the same applies hereinafter) was introduced into the mesenchymal subtype cells (U3031MG cells or U3054MG cells) to prepare mesenchymal subtype cells expressing firefly luciferase, in the same manner as described in Example 4 (1) except that firefly luciferase Luc2 was cloned into the pENTR201 vector (manufactured by Thermo Fisher Scientific Inc.), and that recombination between the pENTR201-Luc2 and CS-CMV-RfA vectors was catalyzed by LR Clonase (Thermo Fisher Scientific Inc.). Control shRNA #1 (SEQ ID NO: 5) or HVEMSHRNA #1 or #2 (SEQ ID NO: 7 or 8) indicated in Table 2 was introduced into the mesenchymal subtype cells according to the method described in Example 4 (1), thereby preparing mesenchymal subtype cells expressing firefly luciferase and control shRNA or HVEMshRNA.
(2) Intracranial Transplantation of GBM Cell
[0173] The tumorigenic activity of HVEM was investigated by intracranial orthotopic transplantation of the GBM cells prepared in the above item (1) into nude mice. Specifically, 1×10.sup.5 surviving cells, in total, were transplanted 2 mm to the right of the sagittal suture from the bregma of the skull of BALB/c nu/nu and 3 mm below the surface of the skull. After intraperitoneal injection of firefly luciferin (manufactured by Promega Corporation) into mice, in vivo bioluminescence imaging was performed with NightOWL LB981 NC100T (manufactured by Berthold Technologies). The mice were monitored until they lost 20% or more of body weight or showed a neurological sign such as hemiparesis, according to the rules of the Animal Ethics Committee of the University of Tokyo.
(3) Results
[0174] The results were as shown in
Example 6: Promotion of GBM Cell Proliferation, Neurosphere Formation and In Vivo Tumor Growth by Overexpression of HVEM
(1) In Vitro Overexpression of HVEM
[0175] Enhanced green fluorescent protein (EGFP) or HVEM was expressed in GBM non-mesenchymal subtype cells (U3047MG, U3085MG and U3017MG cells) cultured under the conditions described in Example 1 (1) in the same manner as described in Example 4 (1), except that EGFP, HVEM or Luc2 cDNA was cloned into the pENTR201 vector (manufactured by Thermo Fisher Scientific Inc.), and that recombination between the pENTR201 and CSII-EF-RfA or CS-CMV-RfA vectors was catalyzed by LR Clonase (manufactured by Thermo Fisher Scientific Inc.).
(2) In Vitro Cell Proliferation Assay
[0176] For the cells prepared in the above item (1), an in vitro cell proliferation assay was performed according to the method described in Example 1 (3).
(3) Sphere Formation Assay
[0177] For the cells prepared in the above item (1), a sphere formation assay was performed according to the method described in Example 1 (4).
(4) In Vivo Overexpression of HVEM
[0178] The in vivo tumorigenic activity was examined for the EGFP- or HVEM-overexpressing U3047MG cells prepared in the above item (1). Specifically, the U3047MG cells were orthotopically transplanted into the skull of nude mice (BALB/c nu/nu) according to the method described in Example 5 (2), and in vivo bioluminescence imaging was performed.
(5) Results
[0179] The results were as shown in
Example 7: Suppression of Tumorigenicity of Murine Glioma Cells by HVEM Inhibition
(1) HVEM Expression and Serum
[0180] The function of HVEM was analyzed using a murine glioma cell strain GL261 (manufactured by PerkinElmer, Inc.). GL261 cells were cultured in a DMEM (manufactured by Thermo Fisher Scientific Inc.) medium added with 10% fetal bovine serum (fetal bovine serum-containing differentiation medium) or the serum-free stem cell medium described in Example 1 (1). Quantitative RT-PCR was performed using the primers indicated in Table 3 according to the method described in Example 2 (2).
TABLE-US-00003 TABLE 3 Primer set used in quantitative RT-PCR SEQ Target Forward/ Sequence ID Species gene reverse (5′ .fwdarw. 3′) NO: Mus GAPDH Forward TGCAGTGGCAAAGTGGAGATT 9 musculus Mus GAPDH Reverse TGCCGTTGAATTTGCCGT 10 musculus Mus HVEM Forward AATGGAACCTCTCCCAGGAT 11 musculus Mus HVEM Reverse AGGAAGACACAAGGCACCA 12 musculus
[0181] The results were as shown in
(2) Tumorigenic Activity of HVEM
[0182] A vector having a DNA sequence and an EGFP sequence encoding HVEMshRNA #1 or #2 (SEQ ID NO: 13 or 14) or control shRNA #1 (SEQ ID NO: 5) indicated in Table 4 was introduced into GL261 cells according to the method described in Example 4 (1). By orthotopic transplantation of the GL261 cells into the skull of C57BL/6J mice, the tumorigenic activity of HVEM in the GL261 cells after suppressing the expression of HVEM was examined Specifically, 1×10.sup.5 surviving cells, in total, were transplanted 2 mm to the right of the sagittal suture from the bregma of the skull and 3 mm below the surface of the skull. Mice transplanted with glioma cells were transcardially perfused with 4% paraformaldehyde. The brain tissue of the mice was cryoprotected with 10 to 20% sucrose, and tissue sections were stained with hematoxylin and eosin. The results were as shown in
TABLE-US-00004 TABLE 4 shRNA sequence SEQ Target sequence of ID Species shRNA shRNA (5′ .fwdarw. 3′) NO: Control GUGGUUUACAUGUCGACUAA 5 shRNA #1 Mus musculus HVEM shRNA #1 GCAACCCAGGUUACCAUGUGA 13 Mus musculus HVEM shRNA #2 GUGAGCAUACAGGCACAGUGU 14
(3) Increase of Survival Probability by Anti-HVEM Antibody
[0183] Through orthotopic transplantation of GL261 cells (BW134246V, manufactured by PerkinElmer, Inc.) expressing firefly luciferase (RedFLuc) into the skull of C57BL/6J mice, the function of HVEM was investigated in vivo using an anti-HVEM antibody. Specifically, 5 days after intracranial transplantation of the GL261 cells according to the method described in the above item (2), the mice were equally divided into two groups (an anti-mouse HVEM antibody group and an isotype control IgG1 group) based on the luminescence intensity of firefly luciferase, based on in vivo bioluminescence imaging. Then, 5 days after intracranial transplantation of the GL261 cells, 7.5 mg/kg of an anti-mouse HVEM hamster monoclonal IgG antibody (prepared according to LBH1, Xu Y et al., Blood, 109:4097-4104 (2007)) or a hamster isotype IgG antibody as a control (I-140, manufactured by Leinco Technologies, Inc.) was intraperitoneally injected, and the injection was performed 5 times, in total, every five days. The results were as shown in
Example 8 Expression of Ligand for HVEM in GBM
(1) Expression of Ligand for HVEM in GBM
[0184] To investigate the function of a ligand for HVEM in brain tumors, the expression levels of mRNAs of APRIL and known ligands (LIGHT, LTA, BTLA, CD160 and SALM5) for HVEM were analyzed using the GDC TCGA dataset. The results were as shown in
(2) Expression of Ligand for HVEM in GBM Subtype
[0185] The amounts of APRIL and the known ligands for HVEM (LTA and LIGHT) in culture supernatants of 13 different GBM cell strains and H9 hESC-derived human neural stem cells (hNSCs) were measured by sandwich ELISA. Specifically, human APRIL, LTA and LIGHT in the cell supernatants were quantified by immunoassay using the following reagents: human APRIL/TNFSF13 DuoSet ELISA (DY884B, R & D Systems, Inc.), human Lymphotoxin-alpha/TNF-beta DuoSet ELISA (DY211, R & D Systems, Inc.), human LIGHT/TNSF14 Quantikine ELISA Kit (DLIT00, R & D Systems, Inc.), and Auxiliary Reagent Kit 2 (DY008, R & D Systems, Inc.). The absorbances at 450 nm and 570 nm were measured with a Model 680 microplate reader (Bio-Rad Laboratories, Inc.) or Enspire (PerkinElmer, Inc.). The results were as shown in
[0186] From these results, it was clarified that none of the known ligands for HVEM were highly expressed in GBM, and that APRIL, which had not been reported as a ligand for HVEM, was highly expressed. APRIL is a ligand of the TNF superfamily, and BCMA/TNFRSF17 and TACI/TNFRSF13B are known as receptors for APRIL. It had not been reported so far that APRIL binds to HVEM and transduces signals.
Example 9: Suppression of Proliferation of GBM Cell and Neurosphere Formation by Inhibition of APRIL
[0187] (1) Inhibition of APRIL by shRNA
[0188] Short hairpin RNAs (shRNAs) were used to inhibit APRIL according to the method described in Example 4 (1), except that DNA sequences encoding the shRNAs indicated in Table 5, mesenchymal subtype cells (U3054MG cells) and the primers for APRIL indicated in Table 6 were used (
[Table 5]
[0189]
TABLE-US-00005 TABLE 5 shRNA sequence SEQ Target sequence of ID Species shRNA shRNA (5′ .fwdarw. 3′) NO: Homo Control GUGGUUUACAUGUCGACUAA 5 sapiens shRNA #1 Homo Control AUGGUUUACAUGUUGUGUGA 6 sapiens shRNA #2 Homo APRIL shRNA #1 GAGACUCUAUUCCGAUGUAUA 15 sapiens Homo APRIL shRNA #2 GGCAAGGGCGAAACUUAACCU 16 sapiens
TABLE-US-00006 TABLE 6 Primer set used in quantitative RT-PCR Target Forward/ Sequence SEQ ID Species gene reverse (5′ .fwdarw. 3′) NO: Homo GAPDH Forward GAAGGTGAAGGTCGGAGTC 1 sapiens Homo GAPDH Reverse GAAGATGGTGATGGGATTTC 2 sapiens Homo APRIL Forward TATAGCGCAGGTGTCTTCCA 17 sapiens Homo APRIL Reverse ACAGTTTCACAAACCCCAGGA 18 sapiens
(2) Inhibition of APRIL by Antibody
[0190] The proliferation of GBM cells by suppressing the function of APRIL on the surface of the GBM cells was investigated according to the description of Example 4 (2), except that an antibody against human APRIL (anti-human APRIL/TNFSF13, MAB5860, manufactured by R & D Systems, Inc., the same applies hereinafter) was used (
(3) In Vitro Cell Proliferation Assay
[0191] For the cells prepared in the above items (1) and (2), an in vitro cell proliferation assay was performed according to the method described in Example 1 (3) (
(4) Sphere Formation Assay
[0192] For the cells prepared in the above item (1), a sphere formation assay was performed according to the method described in Example 1 (4) (
(5) Expression of Receptor for APRIL in GBM
[0193] In order to investigate the functions of ligands for HVEM in brain tumors, the expression levels of mRNAs, in normal brain tissue and GBM, of HVEM and known receptors for APRIL (BCMA/TNFRSF17 and TACI/TNFRSF13B) were analyzed using the GDC TCGA dataset (
(6) Results
[0194] The results were as shown in
Knockdown of HVEM by shRNA attenuated the proliferation of the cell strain of the mesenchymal subtype (
Effect of APRIL as Ligand for HVEM
(1) Identification of Ligand for HVEM
[0195] pCS-NF-κB-RE-minP-Luc2-CMV-hRluc in which the firefly luciferase gene (Luc2, Promega Corporation) was cloned downstream of the minimal promoter having the NF-κB responsive element and the Renilla luciferase gene (hRluc, Promega Corporation) was cloned downstream of the CMV promoter was prepared. After introduction of human-derived HVEM into HEK293T cells using Lipofectamine 2000 (manufactured by Thermo Fisher Scientific Inc., the same applies hereinafter), the NF-κB responsive Luc2 gene and the constantly-expressed hRluc gene were introduced (HVEM-expressing cells). On the other hand, human-derived LIGHT, APRIL and SALM5 genes were cloned into the pENTR4-CMV vector, and recombination between pENTR4-CMV and CS-RfA-EF-PuroR was catalyzed by LR Clonase (manufactured by Thermo Fisher Scientific Inc.). Next, LIGHT, APRIL and SALM5 were each expressed in HEK293T cells which were different from those described above using Lipofectamine 2000 to prepare cells expressing soluble ligands (ligand-expressing cells). As control cells, cells expressing the NF-κB reporter gene but not expressing either HVEM or the ligands were prepared (Empty). The HVEM-expressing cells and the ligand-expressing cells were co-cultured, and the activity of NF-κB in the HVEM-expressing cells was evaluated using Dual Luciferase Reporter Assay Kit (Promega Corporation, the same applies hereinafter).
(2) Effect of Commercial APRIL and SALM5
[0196] The HVEM-expressing cells prepared in the above item (1) were stimulated with the recombinant APRIL (PeproTech, Inc.), recombinant human IgG1 Fc (Control-Fc, R & D Systems, Inc.) or recombinant SALM5-Fc (chimeric protein with the Fc site of an immunoglobulin, R & D Systems, Inc.), and the activity of NF-κB in the HVEM-expressing cells was evaluated using Dual Luciferase Reporter Assay Kit.
(3) Results
[0197] The results were as shown in
Example 11: Effect of Knockout Using CRISPR/Cas9 of HVEM Gene
(1) CRISPR/Cas9 System
[0198] LentiCRISPR v2 vectors encoding the gRNAs, as indicated in Table 8, targeting the DNA sequences indicated in Table 7 were prepared, and hCas9 and each gRNA were introduced into mesenchymal subtype cells (U3054MG cells) or murine glioma cell strain GL261 (PerkinElmer, Inc.) using Lipofectamine 2000. Each cell was cloned by the limiting dilution method. The gRNA sequences were selected by free software (CHOP: http://chopchop.cbu.uib.no/).
TABLE-US-00007 TABLE 7 Target sequence of CRISPR/Cas9 SEQ Target ID Species gene gRNA Sequence (5′ .fwdarw. 3′) NO: Control Control GTATTACTGATATTGGTGGGN 19 gRNA GG Homo TNFRSF14 TNFRSF14 AGCAGTTCCGGCTCGCGCGC 20 sapiens gRNA #1 AGG Homo TNFRSF14 TNFRSF14 CCCTCCGGACGTCACCACGG 21 sapiens gRNA #2 TGG Mus Tnfrsf14 Tnfrsf14 TGCGCTGCAGCAAGTTCAAA 22 musculus gRNA #1 AGG Mus Tnfrsf14 Tnfrsf14 GCGGAGTCTGTGATCCAGGT 23 musculus gRNA #2 AGG
[0199] The underlined parts indicate PAM sequences recognized by hCas9. Since no target sequence of control gRNA theoretically exists on the human genome or the mouse genome, a general PAM sequence is indicated.
TABLE-US-00008 TABLE 8 Base sequence of gRNA full length used in CRISPR/Cas9 system SEQ ID Species gRNA Sequence (5′ .fwdarw. 3′) NO: Control GGUAUUACUGAUAUUGGUGGGGUUUUA 24 gRNA GAGCUAGAAAUAGCAAGUUAAAAUAAG GCUAGUCCGUUAUCAACUUGAAAAAGU GGCACCGAGUCGGUGCU Homo TNFRSF14 GAGCAGUUCCGGCUCGCGCGCGUUUUAG 25 sapiens gRNA #1 AGCUAGAAAUAGCAAGUUAAAAUAAGG CUAGUCCGUUAUCAACUUGAAAAAGUG GCACCGAGUCGGUGCU Homo TNFRSF14 GCCCUCCGGACGUCACCACGGGUUUUAG 26 sapiens gRNA #2 AGCUAGAAAUAGCAAGUUAAAAUAAGG CUAGUCCGUUAUCAACUUGAAAAAGUG GCACCGAGUCGGUGCU Mus Tnfrsf14 GUGCGCUGCAGCAAGUUCAAAGUUUUA 27 musculus gRNA #1 GAGCUAGAAAUAGCAAGUUAAAAUAAG GCUAGUCCGUUAUCAACUUGAAAAAGU GGCACCGAGUCGGUGCU Mus Tnfrsf14 GGCGGAGUCUGUGAUCCAGGUGUUUUA 28 musculus gRNA #2 GAGCUAGAAAUAGCAAGUUAAAAUAAG GCUAGUCCGUUAUCAACUUGAAAAAGU GGCACCGAGUCGGUGCU
(3) In Vitro Cell Proliferation Assay
[0200] For the cells prepared in the above item (1), an in vitro cell proliferation assay was performed according to the method described in Example 1 (3). GL261 cells were cultured in a serum-free stem cell medium according to the description of Example 1 (1).
(4) Sphere Formation Assay
[0201] For the cells prepared in the above item (1), a sphere formation assay was performed according to the method described in Example 1 (4).
(5) Results
[0202] The results were as shown in
Example 12: Preparation of HVEM Antibody Using Alpaca
(1) Preparation of Antibody in Alpaca
[0203] HEK293T cells expressing a human HVEM gene (GenBank Accession No. NM_003820.3 or HGNC:11912) were immunized under the skin of an alpaca to prepare an anti-human HVEM alpaca VHH antibody. VHH antibodies having the amino acid sequences indicated in Table 9 were obtained. The complementarity determining regions (CDRs) were identified according to Kabat's classification. The results were as shown in
TABLE-US-00009 TABLE 9 Amino acid sequence of anti-human HVEM alpaca VHH antibody VHH SEQ antibody ID No. NO: #1 QVQLVESGGGLVQPGGSLRLSCAASGFTFSTHAMSWYRQ 29 APGKERELVAHISSTGGSTNYADSVKGRFTISRDNAKNT VYLQMNSLKPEDTAVYRCNARDWYEYWGRGTQVTVSS #2 QVQLVESGGGLVQPGGSLRLSCVASGRLFDTYTMAWYRL 30 PPGKQRELVADISRTGFTNYADSVKGRFTISRDNAKNTV YLQMNSLKPDDTAHYRCKVREPATMYEYWGQGTQVTVSS #3 QVQLVESGGGSVQPGGSLRLSCAASGSIGSIHRWDWYRL 31 CPGKQREWVATLNSEGGPTYADSVEGRFTISRDNAKNMV YLQMNSLKPEDTAVYRCSARTVPFEYWGRGTQVTVSS #4 QVQLVESGGGLVQPGGSLRLSCAAAESMLSPYSMGWYRL 32 PPGKQRELVASLGSGGRTTYADSVKGRFTISRDNAKNTA YLQMNSLKPEDTAVYRCNIRELLGRRYEYWSQGTQVTVS S #5 QVQLVESGGGLVQPGGSLRLSCAASGFTFSSSHMTWVRQ 33 APGKGLEWVSLINSSGRTAYVDSVAGRFTISRDNAKNTL YLQMTNLKPEDTAVYYCSKGGWDGLPSSSIRGQGTQVTV SS #6 QVQLVESGGGLVPIGGSLRLSCAVSGLAFDRYTFNWYRQ 34 APGKGREWVASIDSTSAVIDYEDTVKGRFTISRDNTKNT VYLQMNSLKPEDTAVYFCGRGGYYGQGTQVTVST #7 QVQLVESGGGLVQPGGSLKLSCVASGFTDKPTYWSWYRQ 35 PPGKDRELVARMHTGGLGTAYPDSVAGRFTISTVNDKNT VYLQMNSLKPEDTAVYYCNAEISGGPDYWGQGTQVTVSS
(2) Binding of HVEM Antibody to Antigen
[0204] The VHH antibodies prepared in the above item (1) were used to measure whether the VHH antibodies were detected in HVEM on the surface of the HVEM-expressing HEK293T cell membrane. Specifically, the HEK293T cells introduced with HVEM and the HEK293T cells not expressing HVEM as a negative control were each seeded at 1×10.sup.4 cells/well, fixed with 4% paraformaldehyde, and then reacted with the VHH antibodies added with 6×His tag. The horseradish peroxidase HRP-labeled anti-histidine tag antibody anti-His-tag mAb-HRP-DirecT (MBL) was reacted, and ELISA POD Substrate TMB Kit (Nacalai Tesque, Inc.) was used to measure an enzyme reaction of HRP with the substrate. The effect size data obtained for the antibody concentration was subjected to non-linear regression to a sigmoid curve based on the following formula:
Effect size=background+maximum effect size/(1+10{circumflex over ( )}(Hill coefficient×(log EC50−log(antibody concentration))))
to determine the 50% effect concentration EC50.
[0205] As a result, the EC50 values of VHH #1 to 5 were all less than 80 nM. Clones of VHH #6 and VHH #7 were obtained by antibody screening using the phage display method.
(3) Proliferation Inhibitory Effect of VHH Antibody
[0206] The mesenchymal subtype cell strain (U3054MG cells) was treated with VHH(I) (VHH #3) and VHH(II) (VHH #2) at a concentration of 100 to 300 nM, and the U3054MG cells were cultured under the conditions: 37° C. and 5% CO2 for 7 days. As a negative control, the cell strain was treated with PBS. Cell proliferation was quantified using Cell Count Reagent SF (Nacalai Tesque, Inc.) to measure cell proliferation for the PBS-treated group. The results were as shown in