HIGH AFFINITY MONOCLONAL ANTIBODIES TARGETING GLYPICAN-1 AND METHODS OF USE
20220098323 · 2022-03-31
Assignee
Inventors
Cpc classification
C07K2317/569
CHEMISTRY; METALLURGY
C07K2319/33
CHEMISTRY; METALLURGY
A61K47/6829
HUMAN NECESSITIES
C07K2317/73
CHEMISTRY; METALLURGY
C07K2317/30
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
C07K2317/22
CHEMISTRY; METALLURGY
A61K47/6929
HUMAN NECESSITIES
International classification
A61K47/68
HUMAN NECESSITIES
A61K47/69
HUMAN NECESSITIES
Abstract
Monoclonal antibodies that specifically bind glypican-1 (GPC1) are described. Chimeric antigen receptor (CAR) T cells, immunotoxins and other antibody conjugates based on the GPC1-specific antibodies are also described. The disclosed CAR T cells, immunotoxins, GPC1-specific antibodies and conjugates thereof can be used, for example, in the diagnosis or treatment of GPC1-positive pancreatic cancer and other cancers.
Claims
1. A monoclonal antibody that specifically binds glypican 1 (GPC1), wherein: (i) the monoclonal antibody comprises a variable heavy (VH) domain and a variable light (VL) domain, wherein the VH domain comprises the complementarity determining region 1 (CDR1), CDR2 and CDR3 sequences of SEQ ID NO: 2 and the VL domain comprises the CDR1, CDR2 and CDR3 sequences of SEQ ID NO: 4; or (ii) the monoclonal antibody is a single-domain antibody comprising the CDR1, CDR2 and CDR3 sequences of SEQ ID NO: 6.
2. The monoclonal antibody of claim 1, wherein the CDR sequences are defined using the Kabat, IMGT or Paratome numbering schemes, or a combination of the Kabat, IMGT and Paratome numbering schemes.
3. The monoclonal antibody of claim 1(i), wherein the VH domain CDR1, CDR2 and CDR3 sequences respectively comprise: residues 31-35, 50-66 and 99-103 of SEQ ID NO: 2; residues 26-33, 51-58 and 97-103 of SEQ ID NO: 2; or residues 27-35, 47-61 and 97-103 of SEQ ID NO: 2.
4. The monoclonal antibody of claim 1(i), wherein the VL domain CDR1, CDR2 and CDR3 sequences respectively comprise: residues 24-39, 55-61 and 94-102 of SEQ ID NO: 4; residues 27-37, 55-57 and 94-101 of SEQ ID NO: 4; or residues 28-39, 51-61 and 94-102 of SEQ ID NO: 4.
5. The monoclonal antibody of claim 3, wherein: the amino acid sequence of the VH domain is at least 90% identical to SEQ ID NO: 2 and comprises the CDR1, CDR2 and CDR3 sequences of SEQ ID NO: 2; and the amino acid sequence of the VL domain is at least 90% identical to SEQ ID NO: 4 and comprises the CDR1, CDR2 and CDR3 sequences of SEQ ID NO: 4.
6. The monoclonal antibody of claim 3, wherein: the amino acid sequence of the VH domain comprises or consists of SEQ ID NO: 2; and the amino acid sequence of the VL domain comprises or consists of SEQ ID NO: 4.
7. The monoclonal antibody of claim 3, wherein the antibody comprises an antigen-binding fragment selected from an Fab fragment, an Fab′ fragment, an F(ab)′.sub.2 fragment, a single chain variable fragment (scFv) and a disulfide stabilized variable fragment (dsFv).
8. (canceled)
9. The monoclonal antibody of claim 3, wherein the monoclonal antibody is a mouse antibody, a humanized antibody or a chimeric antibody.
10-11. (canceled)
12. The monoclonal antibody of claim 1(ii), wherein the CDR1, CDR2 and CDR3 sequences respectively comprise: residues 31-35, 50-66 and 99-109 of SEQ ID NO: 6; residues 26-33, 51-58 and 97-108 of SEQ ID NO: 6; or residues 27-33, 47-61 and 97-108 of SEQ ID NO: 6.
13. The monoclonal antibody of claim 12, wherein the amino acid sequence of the monoclonal antibody is at least 90% identical to SEQ ID NO: 6 and comprises the CDR1, CDR2 and CDR3 sequences of SEQ ID NO: 6.
14. The monoclonal antibody of claim 12, wherein the amino acid sequence of the monoclonal antibody comprises or consists of SEQ ID NO: 6.
15. The monoclonal antibody of claim 12, wherein the monoclonal antibody is a camel antibody a humanized antibody or a chimeric antibody.
16-17. (canceled)
18. A chimeric antigen receptor (CAR) comprising the monoclonal antibody of claim 1.
19. The CAR of claim 18, further comprising a hinge region, a transmembrane domain, a costimulatory signaling moiety, a signaling domain, or any combination thereof.
20. The CAR of claim 19, wherein: the hinge region comprises a CD8α hinge region; the transmembrane domain comprises a CD8α transmembrane domain; the costimulatory signaling moiety comprises a 4-1BB signaling moiety; and/or the signaling domain comprises a CD3ζ signaling domain.
21-23. (canceled)
24. An isolated cell expressing the CAR of claim 18.
25. The isolated cell of claim 24, which is a cytotoxic T lymphocyte (CTL) or a natural killer (NK) cell.
26. An immunoconjugate comprising the monoclonal antibody of claim 1 and an effector molecule.
27. The immunoconjugate of claim 26, wherein the effector molecule is a toxin.
28. The immunoconjugate of claim 27, wherein the toxin is Pseudomonas exotoxin or a variant thereof.
29. The immunoconjugate of claim 28, wherein the Pseudomonas exotoxin variant is PE-LR.
30. The immunoconjugate of claim 26, wherein the amino acid sequence of the immunoconjugate comprises SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19 or SEQ ID NO: 21.
31-32. (canceled)
33. An antibody-drug conjugate (ADC) comprising a drug conjugated to the monoclonal antibody of claim 1.
34-35. (canceled)
36. A multi-specific antibody comprising the monoclonal antibody of claim 1 and at least one additional monoclonal antibody or antigen-binding fragment thereof.
37-39. (canceled)
40. An antibody-nanoparticle conjugate, comprising a nanoparticle conjugated to the monoclonal antibody of claim 1.
41-42. (canceled)
43. A fusion protein comprising the monoclonal antibody of claim 1 and a heterologous protein or peptide.
44. (canceled)
45. An isolated nucleic acid molecule encoding the monoclonal antibody of claim 1.
46. The isolated nucleic acid molecule of claim 45, comprising: the nucleotide sequence of SEQ ID NO: 1, or a degenerate variant thereof; the nucleotide sequence of SEQ ID NO: 3, or a degenerate variant thereof; the nucleotide sequences of SEQ ID NO: 1 and SEQ ID NO: 3, or degenerate variants thereof; the nucleotide sequence of SEQ ID NO: 5, or a degenerate variant thereof; the nucleotide sequence of SEQ ID NO: 14, or a degenerate variant thereof; the nucleotide sequence of SEQ ID NO: 16, or a degenerate variant thereof; the nucleotide sequence of SEQ ID NO: 18, or a degenerate variant thereof; or the nucleotide sequence of SEQ ID NO: 20, or a degenerate variant thereof.
47-48. (canceled)
49. A vector comprising the nucleic acid molecule of claim 45.
50. A nucleic acid molecule encoding a chimeric antigen receptor (CAR), comprising in the 5′ to 3′ direction: a nucleic acid encoding a first granulocyte-macrophage colony stimulating factor receptor signal sequence (GMCSFRss); a nucleic acid encoding the monoclonal antibody of claim 1; a nucleic acid encoding an extracellular hinge region; a nucleic acid encoding a transmembrane domain; a nucleic acid encoding an intracellular co-stimulatory domain; a nucleic acid encoding a intracellular signaling domain; a nucleic acid encoding a self-cleaving 2A peptide; a nucleic acid encoding a second GMCSFRss; and a nucleic acid encoding a truncated human epidermal growth factor receptor (huEGFRt).
51. The nucleic acid molecule of claim 50, further comprising a human elongation factor 1α (EF1α) promoter sequence 5′ of the nucleic acid encoding the first GMCSFRss.
52. A vector comprising the nucleic acid molecule of claim 50.
53. (canceled)
54. An isolated host cell comprising the nucleic acid molecule of claim 45.
55. A composition comprising a pharmaceutically acceptable carrier and the monoclonal antibody of claim 1.
56. A method of treating a GPC1-positive cancer in a subject, comprising administering to the subject the monoclonal antibody of claim 1.
57. A method of inhibiting tumor growth or metastasis of a GPC1-positive cancer in a subject, comprising administering to the subject the monoclonal antibody of claim 1.
58. The method of claim 56, wherein the GPC1-positive cancer is a solid tumor.
59. The method of claim 56, wherein the GPC1-positive cancer is a pancreatic cancer, colorectal cancer, liver cancer, glioma, lung cancer, head and neck cancer, thyroid cancer, endometrial cancer, breast cancer or ovarian cancer.
60. A method of detecting expression of GPC1 in a sample, comprising: contacting the sample with the monoclonal antibody of claim 1; and detecting binding of the antibody to the sample, thereby detecting expression of GPC1 in the sample.
61-64. (canceled)
65. A method of diagnosing a subject as having a GPC1-positive cancer, comprising: contacting a sample obtained from the subject with the monoclonal antibody of claim 1; and detecting binding of the antibody to the sample, thereby diagnosing the subject as having a GPC1-positive cancer.
66-69. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
SEQUENCE LISTING
[0034] The nucleic and amino acid sequences listed in the accompanying sequence listing are shown using standard letter abbreviations for nucleotide bases, and three letter code for amino acids, as defined in 37 C.F.R. 1.822. Only one strand of each nucleic acid sequence is shown, but the complementary strand is understood as included by any reference to the displayed strand. The Sequence Listing is submitted as an ASCII text file, created on Dec. 30, 2019, 34.0 KB, which is incorporated by reference herein. In the accompanying sequence listing:
[0035] SEQ ID NO: 1 is the nucleotide sequence of the VH domain of the HM2 antibody.
[0036] SEQ ID NO: 2 is the amino acid sequence of the VH domain of the HM2 antibody.
[0037] SEQ ID NO: 3 is the nucleotide sequence of the VL domain of the HM2 antibody.
[0038] SEQ ID NO: 4 is the amino acid sequence of the VL domain of the HM2 antibody.
[0039] SEQ ID NO: 5 is the nucleotide sequence of the D4 antibody.
[0040] SEQ ID NO: 6 is the amino acid sequence of the D4 antibody.
[0041] SEQ ID NO: 7 is an exemplary GMCSFRss amino acid sequence.
[0042] SEQ ID NO: 8 is an exemplary CD8α hinge region amino acid sequence.
[0043] SEQ ID NO: 9 is an exemplary CD8α transmembrane region amino acid sequence.
[0044] SEQ ID NO: 10 is an exemplary 4-1BB amino acid sequence.
[0045] SEQ ID NO: 11 is an exemplary CD3ζ amino acid sequence.
[0046] SEQ ID NO: 12 is an exemplary self-cleaving T2A peptide amino acid sequence.
[0047] SEQ ID NO: 13 is an exemplary huEGFRt amino acid sequence.
[0048] SEQ ID NO: 14 is the nucleotide sequence encoding the D4-LR immunotoxin.
[0049] SEQ ID NO: 15 is the amino acid sequence of the D4-LR immunotoxin.
[0050] SEQ ID NO: 16 is the nucleotide sequence encoding the HM2-LR immunotoxin.
[0051] SEQ ID NO: 17 is the amino acid sequence of the HM2-LR immunotoxin.
[0052] SEQ ID NO: 18 is the nucleotide sequence encoding the D4-AAA-D4-LR immunotoxin.
[0053] SEQ ID NO: 19 is the amino acid sequence of the D4-AAA-D4-LR immunotoxin.
[0054] SEQ ID NO: 20 is the nucleotide sequence encoding the D4-GGS-D4-LR immunotoxin.
[0055] SEQ ID NO: 21 is the amino acid sequence of the D4-GGS-D4-LR immunotoxin.
DETAILED DESCRIPTION
I. Abbreviations
[0056] ADC antibody-drug conjugate [0057] ADCC antibody-dependent cell-mediated cytotoxicity [0058] CAR chimeric antigen receptor [0059] CDR complementarity determining region [0060] CTL cytotoxic T lymphocyte [0061] E:T effector to target [0062] EGF epidermal growth factor [0063] EGFR epidermal growth factor receptor [0064] ELISA enzyme-linked immunosorbent assay [0065] FACS fluorescence activated cells sorting [0066] GMCSFRss granulocyte-macrophage colony stimulating factor receptor signal sequence [0067] GPC1 glypican-1 [0068] GPI glycosyl phosphatidylinositol [0069] HSPG heparan sulfate proteoglycan [0070] huEGFRt human truncated epidermal growth factor receptor [0071] Ig immunoglobulin [0072] NK natural killer [0073] PE Pseudomonas exotoxin [0074] PET positron emission tomography
II. Summary of Terms
[0075] Unless otherwise noted, technical terms are used according to conventional usage. Definitions of common terms in molecular biology may be found in Benjamin Lewin, Genes X, published by Jones & Bartlett Publishers, 2009; and Meyers et al. (eds.), The Encyclopedia of Cell Biology and Molecular Medicine, published by Wiley-VCH in 16 volumes, 2008; and other similar references.
[0076] As used herein, the singular forms “a,” “an,” and “the,” refer to both the singular as well as plural, unless the context clearly indicates otherwise. For example, the term “an antigen” includes single or plural antigens and can be considered equivalent to the phrase “at least one antigen.” As used herein, the term “comprises” means “includes.” It is further to be understood that any and all base sizes or amino acid sizes, and all molecular weight or molecular mass values, given for nucleic acids or polypeptides are approximate, and are provided for descriptive purposes, unless otherwise indicated. Although many methods and materials similar or equivalent to those described herein can be used, particular suitable methods and materials are described herein. In case of conflict, the present specification, including explanations of terms, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting. To facilitate review of the various embodiments, the following explanations of terms are provided:
[0077] 4-1BB: A co-stimulatory molecule expressed by T cell receptor (TCR)-activated lymphocytes, and by other cells including natural killer cells. Ligation of 4-1BB induces a signaling cascade that results in cytokine production, expression of anti-apoptotic molecules and an enhanced immune response. An exemplary amino acid sequence of 4-1BB is set forth herein as SEQ ID NO: 10.
[0078] Administration: To provide or give a subject an agent, such as an anti-GPC1 antibody provided herein, by any effective route. Exemplary routes of administration include, but are not limited to, oral, injection (such as subcutaneous, intramuscular, intradermal, intraperitoneal, intravenous, and intratumoral), sublingual, rectal, transdermal, intranasal, vaginal and inhalation routes.
[0079] Antibody: A polypeptide ligand comprising at least one variable region that recognizes and binds (such as specifically recognizes and specifically binds) an epitope of an antigen. Mammalian immunoglobulin molecules are composed of a heavy (H) chain and a light (L) chain, each of which has a variable region, termed the variable heavy (V.sub.H) region and the variable light (V.sub.L) region, respectively. Together, the V.sub.H region and the V.sub.L region are responsible for binding the antigen recognized by the antibody. There are five main heavy chain classes (or isotypes) of mammalian immunoglobulin, which determine the functional activity of an antibody molecule: IgM, IgD, IgG, IgA and IgE. Antibody isotypes not found in mammals include IgX, IgY, IgW and IgNAR. IgY is the primary antibody produced by birds and reptiles, and is functionally similar to mammalian IgG and IgE. IgW and IgNAR antibodies are produced by cartilaginous fish, while IgX antibodies are found in amphibians.
[0080] Antibody variable regions contain “framework” regions and hypervariable regions, known as “complementarity determining regions” or “CDRs.” The CDRs are primarily responsible for binding to an epitope of an antigen. The framework regions of an antibody serve to position and align the CDRs in three-dimensional space. The amino acid sequence boundaries of a given CDR can be readily determined using any of a number of well-known numbering schemes, including those described by Kabat et al. (Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 1991; the “Kabat” numbering scheme), Chothia et al. (see Chothia and Lesk, J Mol Biol 196:901-917, 1987; Chothia et al., Nature 342:877, 1989; and Al-Lazikani et al., JMB 273,927-948, 1997; the “Chothia” numbering scheme), Kunik et al. (see Kunik et al., PLoS Comput Biol 8:e1002388, 2012; and Kunik et al., Nucleic Acids Res 40(Web Server issue):W521-524, 2012; “Paratome CDRs”) and the ImMunoGeneTics (IMGT) database (see, Lefranc, Nucleic Acids Res 29:207-9, 2001; the “IMGT” numbering scheme). The Kabat, Paratome and IMGT databases are maintained online.
[0081] A “single-domain antibody” refers to an antibody having a single domain (a variable domain) that is capable of specifically binding an antigen, or an epitope of an antigen, in the absence of an additional antibody domain. Single-domain antibodies include, for example, V.sub.H domain antibodies, V.sub.NAR antibodies, camelid V.sub.HH antibodies, and V.sub.L domain antibodies. V.sub.NAR antibodies are produced by cartilaginous fish, such as nurse sharks, wobbegong sharks, spiny dogfish and bamboo sharks. Camelid V.sub.HH antibodies are produced by several species including camel, llama, alpaca, dromedary, and guanaco, which produce heavy chain antibodies that are naturally devoid of light chains.
[0082] A “monoclonal antibody” is an antibody produced by a single clone of lymphocytes or by a cell into which the coding sequence of a single antibody has been transfected. Monoclonal antibodies are produced by known methods. Monoclonal antibodies include humanized monoclonal antibodies.
[0083] A “chimeric antibody” has framework residues from one species, such as human, and CDRs (which generally confer antigen binding) from another species.
[0084] A “humanized” antibody is an immunoglobulin including a human framework region and one or more CDRs from a non-human (for example a mouse, rabbit, rat, shark or synthetic) immunoglobulin. The non-human immunoglobulin providing the CDRs is termed a “donor,” and the human immunoglobulin providing the framework is termed an “acceptor.” In one embodiment, all CDRs are from the donor immunoglobulin in a humanized immunoglobulin. Constant regions need not be present, but if they are, they must be substantially identical to human immunoglobulin constant regions, i.e., at least about 85-90%, such as about 95% or more identical. Hence, all parts of a humanized immunoglobulin, except possibly the CDRs, are substantially identical to corresponding parts of natural human immunoglobulin sequences. A humanized antibody binds to the same antigen as the donor antibody that provides the CDRs. Humanized or other monoclonal antibodies can have additional conservative amino acid substitutions which have substantially no effect on antigen binding or other immunoglobulin functions.
[0085] Antibody-drug conjugate (ADC): A molecule that includes an antibody (or antigen-binding fragment of an antibody) conjugated to a drug, such as a cytotoxic agent (such as covalently attached). ADCs can be used to specifically target a drug to cancer cells through specific binding of the antibody to a tumor antigen expressed on the cell surface. Exemplary drugs for use with ADCs include anti-microtubule agents (such as maytansinoids, auristatin E and auristatin F) and interstrand crosslinking agents (for example, pyrrolobenzodiazepines; PDBs). In some cases, the ADC is a bi-specific ADC, which is comprised of two monoclonal antibodies or antigen-fragments thereof, each directed to a different antigen or epitope, conjugated to a drug.
[0086] Anti-microtubule agent: A type of drug that blocks cell growth by stopping mitosis. Anti-microtubule agents, also referred to as “anti-mitotic agents,” are used to treat cancer.
[0087] Binding affinity: Affinity of an antibody for an antigen. In one embodiment, affinity is calculated by a modification of the Scatchard method described by Frankel et al., Mol. Immunol., 16:101-106, 1979. In another embodiment, binding affinity is measured by an antigen/antibody dissociation rate. In another embodiment, a high binding affinity is measured by a competition radioimmunoassay. In another embodiment, binding affinity is measured by ELISA. In other embodiments, antibody affinity is measured by flow cytometry or by surface plasmon reference. An antibody that “specifically binds” an antigen (such as GPC1) is an antibody that binds the antigen with high affinity and does not significantly bind other unrelated antigens.
[0088] In some examples, an antibody or fragment thereof (such as an anti-GPC1 antibody provided herein) specifically binds to a target (such as a GPC1) with a binding constant that is at least 10.sup.3 M.sup.−1 greater, 10.sup.4M.sup.−1 greater or 10.sup.5 M.sup.−1 greater than a binding constant for other molecules in a sample or subject. In some examples, an antibody (e.g., monoclonal antibody) or fragments thereof, has an equilibrium constant (Kd) of 10 nM or less, such as 9 nM or less, 8.1 nM or less, 8 nM or less, 7 nM or less, 6 nM or less, 6.5 nM or less, 6.3 nM or less, 5 nM or less, 4.3 nM or less, 4 nM or less, 3 nM or less, 2 nM or less, 1.5 nM or less, 1.5 nM or less, 1.4 nM or less, 1.3 nM or less, or 1.2 nM or less. For example, an antibody or fragment thereof binds to a target, such as GPC1 with a binding affinity of at least about 0.1×10.sup.−8 M, at least about 0.3×10.sup.−8 M, at least about 0.5×10.sup.−8 M, at least about 0.75×10.sup.−8 M, at least about 1.0×10.sup.−8 M, at least about 1.3×10.sup.−8 M at least about 1.5×10.sup.−8 M, or at least about 2.0×10.sup.−8 M, at least about 2.5×10.sup.−8, at least about 3.0×10.sup.−8, at least about 3.5×10.sup.−8, at least about 4.0×10.sup.−8, at least about 4.5×10.sup.−8, at least about 5.0×10.sup.−8 M, at least about 1×10.sup.−9 M, at least about 1.3×10.sup.−9 M, at least about 1.5×10.sup.−9 M, at least about 2×10.sup.−9 M, at least about 3×10.sup.−9 M, at least about 4×10.sup.−9 M, at least about 4.3×10.sup.−9 M, at least about 5×10.sup.−9 M, at least about 6×10.sup.−9 M, at least about 6.3×10.sup.−9 M, at least about 6.9×10.sup.0.9M, at least about 7×10.sup.−9 M, at least about 8×10.sup.−9 M, at least about 8.1×10.sup.−9 M, or at least about 10×10.sup.−9 M. In certain embodiments, a specific binding agent that binds to its target has a dissociation constant (Kd) of ≤100 nM, ≤10 nM, ≤9 nM, ≤8 nM, ≤7 nM, ≤6.9 nM, ≤6.5 nM, ≤6.3 nM, ≤5 nM, ≤4 nM, ≤4.5 nM, ≤3 nM, ≤2 nM, ≤1.5 nM, ≤1 nM, ≤0.1 nM, ≤0.01 nM, or ≤0.001 nM (e.g., 10.sup.−8M or less, e.g., from 10.sup.−8M to 10.sup.−13M, e.g., from 10.sup.−9 M to 10.sup.−13 M). In one embodiment, Kd is measured by a radiolabeled antigen binding assay (RIA) performed with the Fab version of an antibody of interest and its antigen (see, e.g., Chen et al., J. Mol. Biol. 293:865-881, 1999). In another example, Kd is measured using surface plasmon resonance assays using a BIACORES-2000 or a BIACORES-3000 (BIAcore, Inc., Piscataway, N.J.) at 25° C. with immobilized antigen CMS chips at about 10 response units (RU).
[0089] Bispecific antibody: A recombinant protein that includes antigen-binding fragments of two different monoclonal antibodies and is thereby capable of binding two different antigens. In some embodiments, bispecific antibodies are used for cancer immunotherapy by simultaneously targeting, for example, both CTLs (such as a CTL receptor component such as CD3) or effector natural killer (NK) cells, and a tumor antigen (such as GPC1). Similarly, a multi-specific antibody is a recombinant protein that includes antigen-binding fragments of at least two different monoclonal antibodies, such as two, three or four different monoclonal antibodies.
[0090] Breast cancer: A type of cancer that forms in tissues of the breast, usually the ducts and lobules. Types of breast cancer include, for example, ductal carcinoma in situ, invasive ductal carcinoma, triple negative breast cancer, inflammatory breast cancer, metastatic breast cancer, medullary carcinoma, tubular carcinoma and mucinous carcinoma. Triple negative breast cancer refers to a type of breast cancer in which the cancer cells do not express estrogen receptors, progesterone receptors or significant levels of HER2/neu protein. Triple negative breast cancer is also called ER-negative PR-negative HER2/neu-negative breast cancer.
[0091] Chemotherapeutic agent: Any chemical agent with therapeutic usefulness in the treatment of diseases characterized by abnormal cell growth. Such diseases include tumors, neoplasms, and cancer. In one embodiment, a chemotherapeutic agent is an agent of use in treating a GPC1-positive tumor. In one embodiment, a chemotherapeutic agent is a radioactive compound. Exemplary chemotherapeutic agents that can be used with the methods provided herein are disclosed in Slapak and Kufe, Principles of Cancer Therapy, Chapter 86 in Harrison's Principles of Internal Medicine, 14th edition; Perry et al., Chemotherapy, Ch. 17 in Abeloff, Clinical Oncology 2.sup.nd ed., © 2000 Churchill Livingstone, Inc; Baltzer, L., Berkery, R. (eds.): Oncology Pocket Guide to Chemotherapy, 2nd ed. St. Louis, Mosby-Year Book, 1995; Fischer, D. S., Knobf, M. F., Durivage, H. J. (eds): The Cancer Chemotherapy Handbook, 4th ed. St. Louis, Mosby-Year Book, 1993). Combination chemotherapy is the administration of more than one agent to treat cancer. One example is the administration of an antibody that binds GPC1 used in combination with a radioactive or chemical compound. In one example, a chemotherapeutic agent is a biologic, such as a therapeutic antibody (e.g., therapeutic monoclonal antibody), such as an anti-GPC1 antibody provided herein, as well as other anti-cancer antibodies, such as anti-PD1 or anti-PDL1 (e.g., pembrolizumab and nivolumab), anti-EGFR (e.g., cetuximab), or anti-VEGF (e.g., bevacizumab).
[0092] Chimeric antigen receptor (CAR): A chimeric molecule that includes an antigen-binding portion (such as a scFv or single-domain antibody) and a signaling domain, such as a signaling domain from a T cell receptor (for example, CD3ζ). Typically, CARs are comprised of an antigen-binding moiety, a transmembrane domain and an endodomain. The endodomain typically includes a signaling chain having an immunoreceptor tyrosine-based activation motif (ITAM), such as CD3ζ or FcεRIγ. In some instances, the endodomain further includes the intracellular portion of at least one additional co-stimulatory domain, such as CD28, 4-1BB (CD137), ICOS, OX40 (CD134), CD27 and/or DAP10. In some examples, the CAR is multispecific (such as bispecific) or bicistronic. A multispecific CAR is a single CAR molecule comprised of at least two antigen-binding domains (such as scFvs and/or single-domain antibodies) that each bind a different antigen or a different epitope on the same antigen (see, for example, US 2018/0230225). For example, a bispecific CAR refers to a single CAR molecule having two antigen-binding domains that each bind a different antigen. A bicistronic CAR refers to two complete CAR molecules, each containing an antigen-binding moiety that binds a different antigen. In some cases, a bicistronic CAR construct expresses two complete CAR molecules that are linked by a cleavage linker. T cells or NK cells expressing a bispecific or bicistronic CAR can bind cells that express both of the antigens to which the binding moieties are directed (see, for example, Qin et al., Blood 130:810, 2017; and WO/2018/213337).
[0093] Colorectal cancer: A type of cancer that develops in the colon or the rectum. The most common type of colorectal cancer is colorectal adenocarcinoma, which accounts for approximately 95% of all colorectal cancers. Adenocarcinomas develop in the cells lining the inside of the colon and/or rectum. Other types of colorectal cancers include gastrointestinal carcinoid tumors, metastatic colorectal cancer, primary colorectal lymphoma (a type of non-Hodgkin's lymphoma), gastrointestinal stromal tumors (classified as a sarcoma and arising from interstitial cells of Cajal), leiomyosarcoma (arising from smooth muscle cells) and colorectal melanoma.
[0094] Complementarity determining region (CDR): A region of hypervariable amino acid sequence that defines the binding affinity and specificity of an antibody. The light and heavy chains of a mammalian immunoglobulin each have three CDRs, designated L-CDR1, L-CDR2, L-CDR3 and H-CDR1, H-CDR2, H-CDR3, respectively. A single-domain antibody contains three CDRs, referred to herein as CDR1, CDR2 and CDR3.
[0095] Conjugate: In the context of the present disclosure, a “conjugate” is an antibody or antibody fragment (such as an antigen-binding fragment) covalently linked to an effector molecule or a second protein (such as a second antibody). The effector molecule can be, for example, a drug, toxin, therapeutic agent, detectable label, protein, nucleic acid, lipid, nanoparticle, photon absorber, carbohydrate or recombinant virus. An antibody conjugate is often referred to as an “immunoconjugate.” When the conjugate comprises an antibody linked to a drug (such as a cytotoxic agent), the conjugate is often referred to as an “antibody-drug conjugate” or “ADC.” Other antibody conjugates include, for example, multi-specific (such as bispecific or trispecific) antibodies and chimeric antigen receptors (CARs).
[0096] Conservative variant: A protein containing conservative amino acid substitutions that do not substantially affect or decrease the affinity of a protein, such as an antibody to GPC1. For example, a monoclonal antibody that specifically binds GPC1 can include at most about 1, at most about 2, at most about 5, and most about 10, or at most about 15 conservative substitutions and specifically bind the GPC1 polypeptide. The term “conservative variant” also includes the use of a substituted amino acid in place of an unsubstituted parent amino acid, provided that antibody specifically binds GPC1. Non-conservative substitutions are those that reduce an activity or binding to GPC1.
[0097] Conservative amino acid substitution tables providing functionally similar amino acids are well known to one of ordinary skill in the art. The following six groups are examples of amino acids that are considered to be conservative substitutions for one another:
[0098] 1) Alanine (A), Serine (S), Threonine (T);
[0099] 2) Aspartic acid (D), Glutamic acid (E);
[0100] 3) Asparagine (N), Glutamine (Q);
[0101] 4) Arginine (R), Lysine (K);
[0102] 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); and
[0103] 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W).
[0104] Contacting: Placement in direct physical association; includes both in solid and liquid form.
[0105] Cytotoxic agent: Any drug or compound that kills cells.
[0106] Cytotoxicity: The toxicity of a molecule, such as an immunotoxin, to the cells intended to be targeted, as opposed to the cells of the rest of an organism. In contrast, the term “toxicity” refers to toxicity of an immunotoxin to cells other than those that are the cells intended to be targeted by the targeting moiety of the immunotoxin, and the term “animal toxicity” refers to toxicity of the immunotoxin to an animal by toxicity of the immunotoxin to cells other than those intended to be targeted by the immunotoxin.
[0107] Diagnostic: Identifying the presence or nature of a pathologic condition, such as a GPC1-positive cancer. Diagnostic methods differ in their sensitivity and specificity. The “sensitivity” of a diagnostic assay is the percentage of diseased individuals who test positive (percent of true positives). The “specificity” of a diagnostic assay is one minus the false positive rate, where the false positive rate is defined as the proportion of those without the disease who test positive. While a particular diagnostic method may not provide a definitive diagnosis of a condition, it suffices if the method provides a positive indication that aids in diagnosis. “Prognostic” is the probability of development (such as severity) of a pathologic condition, such as mesothelioma.
[0108] Diagnostic tumor imaging: Coupling antibodies and their derivatives with positron emitting radionuclides for positron emission tomography (PET) is a process often referred to as immunoPET. While full length antibodies can be used as immunoPET agents, their biological half-life can require waiting several days prior to imaging, resulting in an increase in non-target radiation doses. Smaller, single domain antibodies have biological half-lives amenable to same day imaging.
[0109] Drug: Any compound used to treat, ameliorate or prevent a disease or condition in a subject. In some embodiments herein, the drug is an anti-cancer agent, for example a cytotoxic agent, such as an anti-mitotic or anti-microtubule agent.
[0110] Effector molecule: The portion of a chimeric molecule that is intended to have a desired effect on a cell to which the chimeric molecule is targeted. Effector molecule is also known as an effector moiety (EM), therapeutic agent, diagnostic agent, or similar terms. Therapeutic agents (or drugs) include such compounds as nucleic acids, proteins, peptides, amino acids or derivatives, glycoproteins, radioisotopes, photon absorbers, lipids, carbohydrates, or recombinant viruses. Nucleic acid therapeutic and diagnostic moieties include antisense nucleic acids, derivatized oligonucleotides for covalent cross-linking with single or duplex DNA, and triplex forming oligonucleotides. Alternatively, the molecule linked to a targeting moiety, such as an anti-GPC1 antibody, may be an encapsulation system, such as a liposome or micelle that contains a therapeutic composition such as a drug, a nucleic acid (such as an antisense nucleic acid), or another therapeutic moiety that can be shielded from direct exposure to the circulatory system. Means of preparing liposomes attached to antibodies or other therapeutic agents are known (see, for example, U.S. Pat. No. 4,957,735; and Connor et al., Pharm Ther 28:341-365, 1985). Diagnostic agents or moieties include radioisotopes and other detectable labels. Detectable labels useful for such purposes include radioactive isotopes such as .sup.35S, .sup.11C, .sup.13N, .sup.15O, .sup.18F, .sup.19F, .sup.99mTc, .sup.131I, .sup.3H, .sup.14C, .sup.15N, .sup.90Y, .sup.99Tc, .sup.111In and .sup.125I, fluorophores, chemiluminescent agents, and enzymes.
[0111] Endometrial cancer: A type of cancer that forms in the endometrium, the tissue lining the uterus. Most endometrial cancers are adenocarcinomas, which arise from the epithelial cells of the endometrium.
[0112] Epitope: An antigenic determinant. These are particular chemical groups or peptide sequences on a molecule that are antigenic (that elicit a specific immune response). An antibody specifically binds a particular antigenic epitope on a polypeptide, such as GPC1.
[0113] Framework region: Amino acid sequences interposed between CDRs. Framework regions of an immunoglobulin molecule include variable light and variable heavy framework regions.
[0114] Fusion protein: A protein comprising at least a portion of two different (heterologous) proteins.
[0115] Glioma: A cancer of the brain and spinal cord that begins in glial cells, which are cells that surround and support nerve cells. Gliomas are classified based on the type of glial cells that produce the tumor. Types of gliomas include astrocytoma (including glioblastoma), ependymoma and oligodendroglioma, which originate in astrocytes, ependymal cells and oligodendrocytes, respectively.
[0116] Glypican-1 (GPC1): A member of the six-member glypican family of heparan sulfate proteoglycans (HSPGs) that are attached to the cell surface by a GPI anchor (Filmus et al., Genome Biol 9:224, 2008). Studies have reported that GPC1 is overexpressed in certain types of cancer, such as pancreatic cancer (Kleeff et al., J Clin Invest 102:1662-1673, 1998), for example, pancreatic ductal adenocarcinoma (Frampton et al., Oncotarget 9:19006-19013, 2018; Kayed et al., Int J Oncol 29:1139-1148, 2006), glioma (Su et al., Am J Pathol 168:2014-2026, 2006), breast cancer (Matsuda et al., Cancer Res 61:5562-5569, 2001), ovarian cancer (Davies et al., Clin Cancer Res 10:5178-5186, 2004), and colorectal cancer (Li et al., Oncotarget 8:101189-101202, 2017). GPC1 genomic, mRNA and protein sequences are publically available (see, for example, NCBI Gene ID 2817).
[0117] GPC1-positive cancer: A cancer that expresses or overexpresses GPC1. Examples of GPC1-positive cancers include, but are not limited to, pancreatic cancer, colorectal cancer, liver cancer, glioma, lung cancer, head and neck cancer, thyroid cancer, endometrial cancer, ovarian cancer and breast cancer.
[0118] Head and neck cancer: Cancer that forms in the squamous cells that line the mucosal surfaces inside the head and neck, such as inside the mouth, nose and throat. Head and neck cancer is often referred to as squamous cell carcinoma of the head and neck
[0119] Heterologous: Originating from a separate genetic source or species.
[0120] Immune response: A response of a cell of the immune system, such as a B cell, T cell, or monocyte, to a stimulus. In one embodiment, the response is specific for a particular antigen (an “antigen-specific response”). In one embodiment, an immune response is a T cell response, such as a CD4.sup.+ response or a CD8.sup.+ response. In another embodiment, the response is a B cell response, and results in the production of specific antibodies.
[0121] Immunoconjugate: A covalent linkage of an effector molecule to an antibody or functional fragment thereof. The effector molecule can be, for example, a detectable label, a photon absorber (such as IR700), or a toxin (to form an immunotoxin, such as an immunotoxin comprising Pseudomonas exotoxin or a variant thereof). Specific, non-limiting examples of toxins include, but are not limited to, abrin, ricin, Pseudomonas exotoxin (PE, such as PE35, PE37, PE38, and PE40), diphtheria toxin (DT), botulinum toxin, or modified toxins thereof, or other toxic agents that directly or indirectly inhibit cell growth or kill cells. For example, PE and DT are highly toxic compounds that typically bring about death through liver toxicity. PE and DT, however, can be modified into a form for use as an immunotoxin by removing the native targeting component of the toxin (such as the domain Ia of PE and the B chain of DT) and replacing it with a different targeting moiety, such as an antibody. In one embodiment, an antibody is joined to an effector molecule. In another embodiment, an antibody joined to an effector molecule is further joined to a lipid or other molecule, such as to increase its half-life in the body. The linkage can be either by chemical or recombinant means. In one embodiment, the linkage is chemical, wherein a reaction between the antibody moiety and the effector molecule has produced a covalent bond formed between the two molecules to form one molecule. A peptide linker (short peptide sequence) can optionally be included between the antibody and the effector molecule. Because immunoconjugates were originally prepared from two molecules with separate functionalities, such as an antibody and an effector molecule, they are also sometimes referred to as “chimeric molecules.” The term “chimeric molecule,” as used herein, therefore refers to a targeting moiety, such as a ligand or an antibody, conjugated (coupled) to an effector molecule. The term “conjugated” or “linked” refers to making two polypeptides into one contiguous polypeptide molecule.
[0122] Immunoliposome: A liposome with antibodies or antibody fragments conjugated to its surface Immunoliposomes can carry cytotoxic agents or other drugs to antibody-targeted cells, such as tumor cells.
[0123] Interstrand crosslinking agent: A type of cytotoxic drug capable of binding covalently between two strands of DNA, thereby preventing DNA replication and/or transcription.
[0124] Isolated: An “isolated” biological component, such as a nucleic acid, protein (including antibodies) or organelle, has been substantially separated or purified away from other biological components in the environment (such as a cell) in which the component naturally occurs, for example other chromosomal and extra-chromosomal DNA and RNA, proteins and organelles. Nucleic acids and proteins that have been “isolated” include nucleic acids and proteins purified by standard purification methods. The term also embraces nucleic acids and proteins prepared by recombinant expression in a host cell as well as chemically synthesized nucleic acids and proteins.
[0125] Label: A detectable compound or composition that is conjugated directly or indirectly to another molecule, such as an antibody or a protein, to facilitate detection of that molecule. Specific, non-limiting examples of labels include fluorescent tags, enzymatic linkages, and radioactive isotopes. In one example, a “labeled antibody” refers to incorporation of another molecule in the antibody. For example, the label is a detectable marker, such as the incorporation of a radiolabeled amino acid or attachment to a polypeptide of biotinyl moieties that can be detected by marked avidin (for example, streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or colorimetric methods). Various methods of labeling polypeptides and glycoproteins are known and may be used. Examples of labels for polypeptides include, but are not limited to, the following: radioisotopes or radionucleotides (such as .sup.35S, .sup.11C, .sup.13N, .sup.15O, .sup.18F, .sup.19F, .sup.99mTc, .sup.131I, .sup.3H, .sup.14C, .sup.15N, .sup.90Y, .sup.99Tc, .sup.111In and .sup.125I), fluorescent labels (such as fluorescein isothiocyanate (FITC), rhodamine, lanthanide phosphors), enzymatic labels (such as horseradish peroxidase, beta-galactosidase, luciferase, alkaline phosphatase), chemiluminescent markers, biotinyl groups, predetermined polypeptide epitopes recognized by a secondary reporter (such as a leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags), or magnetic agents, such as gadolinium chelates. In some embodiments, labels are attached by spacer arms of various lengths to reduce potential steric hindrance.
[0126] Linker: In some cases, a linker is a peptide within an antibody binding fragment (such as an Fv fragment) which serves to indirectly bond the variable heavy chain to the variable light chain. “Linker” can also refer to a peptide serving to link a targeting moiety, such as an antibody, to an effector molecule, such as a cytotoxin or a detectable label. The terms “conjugating,” “joining,” “bonding” or “linking” refer to making two polypeptides into one contiguous polypeptide molecule, or to covalently attaching a radionuclide or other molecule to a polypeptide, such as an antibody. The linkage can be either by chemical or recombinant means. “Chemical means” refers to a reaction between the antibody moiety and the effector molecule such that there is a covalent bond formed between the two molecules to form one molecule.
[0127] Liver cancer: Any type of cancer occurring in liver tissue. The most common type of liver cancer is hepatocellular carcinoma (HCC), which develops in hepatocytes. Other types of liver cancer include cholangiocarcinoma, which develops in the bile ducts; liver angiosarcoma, which is a rare form of liver cancer that begins in the blood vessels of the liver; and hepatoblastoma, which is a very rare type of liver cancer found most often in children.
[0128] Lung cancer: Any cancer that forms in the lung. Most cancers that begin in the lung are carcinomas. The two primary types of lung carcinoma are small-cell lung carcinoma (SCLC) and non-small cell lung carcinoma (NSCLC). Subclasses of NSCLC include adenocarcinoma, squamous-cell carcinoma and large-cell carcinoma.
[0129] Operably linked: A first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence. For instance, a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence. Generally, operably linked DNA sequences are contiguous and, where necessary to join two protein-coding regions, in the same reading frame.
[0130] Ovarian cancer: Cancer that forms in tissues of the ovary. Most ovarian cancers are either ovarian epithelial carcinomas (cancer that begins in the cells on the surface of the ovary) or malignant germ cell tumors (cancer that begins in egg cells). Another type of ovarian cancer is stromal cell cancer, which originates in cells that release hormones and connect the different structures of the ovaries.
[0131] Pancreatic cancer: A disease in which malignant cells are found in the tissues of the pancreas. Pancreatic tumors can be either exocrine tumors or neuroendocrine tumors, based on the cell origin of the cancer. The vast majority (˜94%) of pancreatic cancers are exocrine tumors. Exocrine cancers include, for example, adenocarcinoma (the most common type of exocrine tumor), acinar cell carcinoma, intraductal papillary-mucinous neoplasm (IPMN), and mucinous cystadenocarcinoma. In some examples, the pancreatic cancer is pancreatic ductal adenocarcinoma (PDAC). Pancreatic neuroendocrine tumors, also referred to as islet cell tumors, are classified by the type of hormones they produce. Exemplary neuroendocrine tumors include gastrinoma, glucaganoma, insulinoma, somatostatinoma, VIPoma (vasoactive intestinal peptide) and nonfunctional islet cell tumor.
[0132] Pharmaceutically acceptable carriers: The pharmaceutically acceptable carriers of use are conventional. Remington's Pharmaceutical Sciences, by E.W. Martin, Mack Publishing Co., Easton, Pa., 15th Edition, 1975, describes compositions and formulations suitable for pharmaceutical delivery of the antibodies and other compositions disclosed herein. In general, the nature of the carrier will depend on the particular mode of administration being employed. For instance, parenteral formulations usually comprise injectable fluids that include pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle. For solid compositions (such as powder, pill, tablet, or capsule forms), conventional non-toxic solid carriers can include, for example, pharmaceutical grades of mannitol, lactose, starch, or magnesium stearate. In addition to biologically neutral carriers, pharmaceutical compositions to be administered can contain minor amounts of non-toxic auxiliary substances, such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate.
[0133] Photoimmunotherapy: A targeted cancer therapy that utilizes an antigen-specific antibody-photoabsorber conjugate that can be activated by near-infrared light to kill targeted cells. The photon absorber is typically based on phthalocyanine dye, such as a near infrared (NIR) phthalocyanine dye (for example, IRDye® 700DX, also known as IR700). The antibody (for example, a GPC1-specific antibody) binds to the appropriate cell surface antigen (e.g. GPC1) and the photo-activatable dye induces lethal damage to cell membranes after NIR-light exposure. NIR-light exposure (690 nm) induces highly selective, necrotic cancer cell death within minutes without damage to adjoining cells (see, for example, U.S. Application No. 2018/0236076). Thus provided herein are the disclosed antibodies (e.g., HM2 and D4, or fragments thereof) conjugated to IR700.
[0134] Preventing, treating or ameliorating a disease: “Preventing” a disease refers to inhibiting the full development of a disease. “Treating” refers to a therapeutic intervention that ameliorates a sign or symptom of a disease or pathological condition after it has begun to develop, such as a reduction in tumor burden or a decrease in the number of size of metastases. “Ameliorating” refers to the reduction in the number or severity of signs or symptoms of a disease, such as cancer.
[0135] Promoter: An array of nucleic acid control sequences which direct transcription of a nucleic acid, such as one encoding an antibody or antibody fragment provided herein. A promoter includes necessary nucleic acid sequences near the start site of transcription, such as, in the case of a polymerase II type promoter, a TATA element. A promoter also optionally includes distal enhancer or repressor elements which can be located as much as several thousand base pairs from the start site of transcription. Exemplary promoters include constitutive and activatable promoters.
[0136] Purified: The term purified does not require absolute purity; rather, it is intended as a relative term. Thus, for example, a purified peptide preparation is one in which the peptide or protein is more enriched than the peptide or protein is in its natural environment within a cell. In one embodiment, a preparation is purified such that the protein or peptide represents at least 50% of the total peptide or protein content of the preparation. Substantial purification denotes purification from other proteins or cellular components. A substantially purified protein is at least 60%, 70%, 80%, 90%, 95% or 98% pure. Thus, in one specific, non-limiting example, a substantially purified protein, such as an antibody or antibody fragment, is 90% free of other proteins or cellular components.
[0137] Pyrrolobenzodiazepine (PBD): A class of sequence-selective DNA minor-groove binding crosslinking agents originally discovered in Streptomyces species. PDBs are significantly more potent than systemic chemotherapeutic drugs. The mechanism of action of PBDs is associated with their ability to form an adduct in the minor groove of DNA, thereby interfering with DNA processing. In the context of the present disclosure, PBDs include naturally produced and isolated PBDs, chemically synthesized naturally occurring PBDs, and chemically synthesized non-naturally occurring PBDs. PBDs also include monomeric, dimeric and hybrid PBDs (for a review see Gerratana, Med Res Rev 32(2):254-293, 2012).
[0138] Recombinant: A recombinant nucleic acid or protein is one that has a sequence that is not naturally occurring or has a sequence that is made by an artificial combination of two otherwise separated segments of sequence. This artificial combination is often accomplished by chemical synthesis or by the artificial manipulation of isolated segments of nucleic acids, for example, by genetic engineering techniques.
[0139] Sample (or biological sample): A biological specimen containing genomic DNA, RNA (including mRNA), protein, or combinations thereof, obtained from a subject. Examples include, but are not limited to, peripheral blood, tissue, cells, urine, saliva, tissue biopsy, fine needle aspirate, surgical specimen, and autopsy material. In one example, a sample includes a tumor biopsy. In one example, a sample includes a fine needle aspirate.
[0140] Sequence identity: The similarity between amino acid or nucleic acid sequences is expressed in terms of the similarity between the sequences, otherwise referred to as sequence identity. Sequence identity is frequently measured in terms of percentage identity (or similarity or homology); the higher the percentage, the more similar the two sequences are. Homologs or variants of a polypeptide or nucleic acid molecule will possess a relatively high degree of sequence identity when aligned using standard methods.
[0141] Methods of alignment of sequences for comparison are well known in the art. Various programs and alignment algorithms are described in: Smith and Waterman, Adv. Appl. Math. 2:482, 1981; Needleman and Wunsch, J. Mol. Biol. 48:443, 1970; Pearson and Lipman, Proc. Natl. Acad. Sci. U.S.A. 85:2444, 1988; Higgins and Sharp, Gene 73:237, 1988; Higgins and Sharp, CABIOS 5:151, 1989; Corpet et al., Nucleic Acids Research 16:10881, 1988; and Pearson and Lipman, Proc. Natl. Acad. Sci. U.S.A. 85:2444, 1988. Altschul et al., Nature Genet. 6:119, 1994, presents a detailed consideration of sequence alignment methods and homology calculations.
[0142] The NCBI Basic Local Alignment Search Tool (BLAST) (Altschul et al., J. Mol. Biol. 215:403, 1990) is available from several sources, including the National Center for Biotechnology Information (NCBI, Bethesda, Md.) and on the internet, for use in connection with the sequence analysis programs blastp, blastn, blastx, tblastn and tblastx. A description of how to determine sequence identity using this program is available on the NCBI website on the internet.
[0143] Homologs and variants of an antibody that specifically binds a GPC1 polypeptide are typically characterized by possession of at least about 75%, for example at least about 80%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity counted over the full-length alignment with the amino acid sequence of the antibody using the NCBI Blast 2.0, gapped blastp set to default parameters. For comparisons of amino acid sequences of greater than about 30 amino acids, the Blast 2 sequences function is employed using the default BLOSUM62 matrix set to default parameters, (gap existence cost of 11, and a per residue gap cost of 1). When aligning short peptides (fewer than around 30 amino acids), the alignment should be performed using the Blast 2 sequences function, employing the PAM30 matrix set to default parameters (open gap 9, extension gap 1 penalties). Proteins with even greater similarity to the reference sequences will show increasing percentage identities when assessed by this method, such as at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% sequence identity. When less than the entire sequence is being compared for sequence identity, homologs and variants will typically possess at least 80% sequence identity over short windows of 10-20 amino acids, and may possess sequence identities of at least 85% or at least 90% or 95% depending on their similarity to the reference sequence. Methods for determining sequence identity over such short windows are available at the NCBI website on the internet. One of skill in the art will appreciate that these sequence identity ranges are provided for guidance only; it is entirely possible that strongly significant homologs could be obtained that fall outside of the ranges provided.
[0144] Small molecule: A molecule, typically with a molecular weight less than about 1000 Daltons, or in some embodiments, less than about 500 Daltons, wherein the molecule is capable of modulating, to some measurable extent, an activity of a target molecule.
[0145] Subject: Living multi-cellular vertebrate organisms, a category that includes both human and veterinary subjects, including human and non-human mammals.
[0146] Synthetic: Produced by artificial means in a laboratory, for example a synthetic nucleic acid or protein (for example, an antibody) can be chemically synthesized in a laboratory.
[0147] Therapeutically effective amount: A quantity of a specific substance sufficient to achieve a desired effect in a subject being treated. For instance, this can be the amount necessary to inhibit or suppress growth of a tumor. In one embodiment, a therapeutically effective amount is the amount necessary to eliminate, reduce the size, or prevent metastasis of a tumor, such as reduce a tumor size and/or volume by at least 10%, at least 20%, at least 50%, at least 75%, at least 80%, at least 90%, at least 95%, or even 100%, and/or reduce the number and/or size/volume of metastases by at least 10%, at least 20%, at least 50%, at least 75%, at least 80%, at least 90%, at least 95%, or even 100%, for example as compared to a size/volume/number prior to treatment. When administered to a subject, a dosage will generally be used that will achieve target tissue concentrations (for example, in tumors) that has been shown to achieve a desired in vitro effect.
[0148] Thyroid cancer: A type of cancer that forms in the tissues of the thyroid gland. Thyroid cancers are classified according to histopathological characteristic and include papillary thyroid cancer, follicular thyroid cancer, medullary thyroid cancer, poorly differentiated thyroid cancer, anaplastic thyroid cancer, thyroid lymphoma, squamous cell thyroid carcinoma and sarcoma of the thyroid.
[0149] Toxin: A molecule that is cytotoxic for a cell. Toxins include abrin, ricin, Pseudomonas exotoxin (PE), diphtheria toxin (DT), botulinum toxin, saporin, restrictocin or gelonin, or modified toxins thereof. For example, PE and DT are highly toxic compounds that typically bring about death through liver toxicity. PE and DT, however, can be modified into a form for use as an immunotoxin by removing the native targeting component of the toxin (such as domain Ia of PE or the B chain of DT) and replacing it with a different targeting moiety, such as an antibody.
[0150] Vector: A nucleic acid molecule as introduced into a host cell, thereby producing a transformed host cell. A vector may include nucleic acid sequences that permit it to replicate in a host cell, such as an origin of replication. A vector may also include one or more selectable marker genes and other genetic elements known in the art. In some embodiments, the vector is a virus vector, such as a lentivirus vector or an AAV vector.
III. Monoclonal Antibodies Specific for Glypican-1 (GPC1)
[0151] Described herein are two monoclonal antibodies that bind GPC1 with high affinity. One of the monoclonal antibodies is a mouse antibody (HM2), the other is a single-domain (VHH) camel antibody (D4). It is disclosed herein that antibody D4 specifically binds both human and mouse GPC1, and both antibodies bind human GPC1 with high affinity. Chimeric antigen receptor (CAR) T cells comprised of the disclosed antibodies are capable of potently killing GPC1-positive tumor cells in vitro and in vivo. The nucleotide and amino acid sequences of HM2 and D4 are provided below. Tables 1A, 1B and 2 list the amino acid positions of CDR1, CDR2 and CDR3 of each antibody, as determined using either Kabat, IMGT, or Paratome, or a combination of all three. One of skill in the art could readily determine the CDR boundaries using an alternative numbering scheme, such as the Chothia numbering scheme.
TABLE-US-00001 HM2 V.sub.H DNA (SEQ ID NO: 1) GAGGTTCAGCTGCAGCAGTCTGGGGCTGAGCTTGTGAGGCCAGGGGCCTCAGTCAAGT TGTCCTGCACAGCTTCTGGCTTTAACATTAAAGACGACTATATGCACTGGGTGAAGCA GAGGCCTGAACAGGGCCTGGAGTGGATTGGATGGATTGATCCTGAGAATGGTGATACT GAATATGCCTCGAAGTTCCAGGGCAAGGCCACTATAACAGCAGACACATCCTCCAACA CAGCCTACCTGCAGCTCAGCAGCCTGACATCTGAGGACACTGCCGTCTATTACTGTACT CGTAGCTCCGTAGGCTACTGGGGCCAAGGCACCACTCTCACAGTCTCCTCA HM2 V.sub.H Protein (SEQ ID NO: 2) EVQLQQSGAELVRPGASVKLSCTASG WVKQRPEQGLEWIGW
EY ASKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYC
WGQGTTLTVSS (Underline = Kabat CDRs; Bold = IMGT CDRs; Italics = Paratome CDRs) HM2 V.sub.L DNA (SEQ ID NO: 3) GATGTTGTGATGACCCAAACTCCACTCTCCCTGCCTGTCAGTCTTGGAGATCAAGCCTC CATCTCTTGCAGATCTAGTCAGAGCCTTGTACACAGTAATGGAAACACCTATTTACATT GGTACCTGCAGAAGCCAGGCCAGTCTCCAAAGCTCCTGATCTACAAAGTTTCCAACCG ATTTTCTGGGGTCCCAGACAGGTTCAGTGGCAGTGGATCAGGGACTTATTTCACACTCA AGATCAGCAGAGTGGAGGCTGAGGATCTGGGAGTTTATTTCTGCTCTCAAAGAACACA TGTTCCGTACACGTTCGGAGGGGGGACCAAGCTGGAGATAAAA HM2 V.sub.L Protein (SEQ ID NO: 4) DVVMTQTPLSLPVSLGDQASISCRSSQS
LHWYLQKPGQSPKLLIY
NRFSG VPDRFSGSGSGTYFTLKISRVEAEDLGVYFC
TFGGGTKLEIK (Underline = Kabat CDRs; Bold = IMGT CDRs; Italics = Paratome CDRs)
TABLE-US-00002 TABLE 1A Location of CDRs in HM2 VH domain amino acid sequence (SEQ ID NO: 2) Numbering Scheme CDR1 CDR2 CDR3 Kabat 31-35 50-66 99-103 IMGT 26-33 51-58 97-103 Paratome 27-35 47-61 97-103 Combined 26-35 47-66 97-103
TABLE-US-00003 TABLE 1B Location of CDRs in HM2 VL domain amino acid sequence (SEQ ID NO: 4) Numbering Scheme CDR1 CDR2 CDR3 Kabat 24-39 55-61 94-102 IMGT 27-37 55-57 94-101 Paratome 28-39 51-61 94-102 Combined 24-39 51-61 94-102
TABLE-US-00004 D4 DNA (SEQ ID NO: 5) CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTGCAGCCCGGGGGGTCTCTGAGAC TCTCCTGTGTAGCCTCTGGATACAGCTACAGTATTGGTTACATGGCCTGGTTCCGCCAG GCCCCAGGAAAGGAGCGCGCGTGGGTCGCGTCTCGATATACTGGTGACGGTGGCGCA GTCTTTGACGACGCCGTGAAGGGCCGATTCACCACCTCCCAAGAGAGTGCCGGGAACA CGTTCGATTTGCAAATGGACAGCCTGAAACCTGAGGACACTGCCATGTACTATTGCGC AGCGAAAGGGCCCGGTTTCGGGCGGTGGGAGTACTGGGGCCGGGGGACCCAGGTCAC CGTCTCCTCA D4 Protein (SEQ ID NO: 6) QVQLVESGGGLVQPGGSLRLSCVASG WFRQAPGKERAWVA
RFTTSQESAGNTFDLQMDSLKPEDTAMYYC
WGRGTQVTVS S (Underline = Kabat CDRs; Bold = IMGT CDRs; Italics = Paratome CDRs)
TABLE-US-00005 TABLE 2 Location of CDRs in the D4 amino acid sequence (SEQ ID NO: 6) Numbering Scheme CDR1 CDR2 CDR3 Kabat 31-35 50-66 99-109 IMGT 26-33 51-58 97-108 Paratome 27-33 47-61 97-108 Combined 26-35 47-66 97-108
[0152] Provided herein are monoclonal antibodies that bind (for example, specifically bind) GPC1, such as cell-surface or soluble GPC1. In some example, a GPC1 monoclonal antibody has a Kd of 10 nM or less, such as 0.1 nM to 10 nM. In some embodiments, the GPC1 is human GPC1, mouse GPC1, or both human and mouse GPC1. In some embodiments, the monoclonal antibody includes a variable heavy (VH) domain and a variable light (VL) domain. In some examples, the monoclonal antibody includes at least a portion of the amino acid sequence set forth herein as SEQ ID NO: 2 and/or SEQ ID NO: 4, such as one or more (such as all three) CDR sequences from SEQ ID NO: 2 and/or SEQ ID NO: 4, as determined by any numbering scheme, such as IMGT, Kabat, Paratome or Chothia, or any combination thereof. In other embodiments, the monoclonal antibody is a single-domain antibody. In some examples, the monoclonal antibody includes at least a portion of the amino acid sequence set forth herein as SEQ ID NO: 6, such as one or more (such as all three) CDR sequences from SEQ ID NO: 6, as determined by any numbering scheme, such as IMGT, Kabat, Paratome or Chothia, or any combination thereof.
[0153] In some embodiments, the VH domain of the monoclonal antibody comprises the CDR1, CDR2 and CDR3 sequences of SEQ ID NO: 2 and/or the VL domain of the monoclonal antibody comprises the CDR1, CDR2 and CDR3 sequences of SEQ ID NO: 4. In some examples, the CDR sequences are determined using the IMGT, Kabat, Paratome or Chothia numbering scheme, or a combination thereof. In particular examples, the CDR sequences are determined using a combination of Kabat, IMGT and Paratome.
[0154] In some embodiments, the CDR1, CDR2 and CDR3 sequences of the VH domain of the monoclonal antibody comprise residues 31-35, 50-66 and 99-103 of SEQ ID NO: 2; residues 26-33, 51-58 and 97-103 of SEQ ID NO: 2; residues 27-35, 47-61 and 97-103 of SEQ ID NO: 2; or residues 26-35, 47-66 and 97-103 of SEQ ID NO: 2. In some embodiments, CDR1, CDR2 and CDR3 sequences of the VL domain of the monoclonal antibody comprise residues 24-39, 55-61 and 94-102 of SEQ ID NO: 4; residues 27-37, 55-57 and 94-101 of SEQ ID NO: 4; or residues 28-39, 51-61 and 94-102 of SEQ ID NO: 4.
[0155] In some examples, the amino acid sequence of the VH domain of the monoclonal antibody is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 2 and/or the amino acid sequence of the VL domain of the monoclonal antibody is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 4. In specific non-limiting examples, the sequence of the VH domain of the monoclonal antibody comprises or consists of SEQ ID NO: 2, and/or the sequence of the VL domain of the monoclonal antibody comprises or consists of SEQ ID NO: 4.
[0156] In some embodiments, the monoclonal antibody comprises an antigen-binding fragment selected from an Fab fragment, an Fab′ fragment, an F(ab)′.sub.2 fragment, a single chain variable fragment (scFv) and a disulfide stabilized variable fragment (dsFv).
[0157] In some embodiments, the monoclonal antibody is an IgG, such as IgG1.
[0158] In some embodiments, the monoclonal antibody is a mouse antibody. In other embodiments, the monoclonal antibody is a humanized antibody. In yet other embodiments, the monoclonal antibody is a chimeric antibody.
[0159] In some embodiments, the single-domain monoclonal antibody comprises the CDR1, CDR2 and CDR3 sequences of SEQ ID NO: 6. In some examples, the CDR sequences are determined using the IMGT, Kabat, Paratome or Chothia numbering scheme, or a combination thereof. In particular examples, the CDR sequences are determined using a combination of Kabat, IMGT and Paratome.
[0160] In some embodiments, the CDR1, CDR2 and CDR3 sequences of the single-domain monoclonal antibody comprise residues 31-35, 50-66 and 99-109 of SEQ ID NO: 6; residues 26-33, 51-58 and 97-108 of SEQ ID NO: 6; residues 27-33, 47-61 and 97-108 of SEQ ID NO: 6; or residues 26-35, 47-66 and 97-108 of SEQ ID NO: 6. In some examples, the amino acid sequence of the monoclonal antibody is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 6. In specific non-limiting examples, the sequence of the monoclonal antibody comprises of consists of SEQ ID NO: 6.
[0161] In some embodiments, the monoclonal antibody is a camel antibody. In other embodiments, the monoclonal antibody is a humanized antibody. In other embodiments, the monoclonal antibody is a chimeric antibody.
[0162] Also provided herein are chimeric antigen receptors (CARs) that include a monoclonal antibody disclosed herein (for example a single-domain antibody or a scFv). In some embodiments, the CAR further includes a hinge region, a transmembrane domain, a costimulatory signaling moiety, a signaling domain, or any combination thereof. In specific non-limiting examples, the hinge region comprises a CD8α hinge region, the transmembrane domain comprises a CD8α transmembrane domain, the costimulatory signaling moiety comprises a 4-1BB signaling moiety and/or the signaling domain comprises a CD3ζ signaling domain.
[0163] Also provided herein are GPC1-specific monoclonal antibodies modified to enable their use with a universal CAR system. In some embodiments, the GPC1-specific monoclonal antibody is fused to one component of a specific binding pair. In some examples, the monoclonal antibody is fused to a leucine zipper or biotin.
[0164] Further provided are cells expressing a GPC1-specific CAR. In some examples, the cell is a T lymphocyte, such as a CTL. CARs and CAR-expressing T cells are further described in section IV.
[0165] Also provided herein are immunoconjugates that include a monoclonal antibody disclosed herein and an effector molecule. In some instances, the immunoconjugate includes an antibody dimer (such as two D4 VHH). In some embodiments, the effector molecule is a toxin, such as, but not limited to, Pseudomonas exotoxin or a variant thereof, such as PE38 or PE-LR. In some examples, the PE is PE-LR having the amino acid sequence of residues 121-363 of SEQ ID NO: 15. In particular non-limiting embodiments, the amino acid sequence of the immunoconjugate is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19 or SEQ ID NO: 21. In specific examples, the amino acid sequence of the immunotoxin comprises or consists of SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19 or SEQ ID NO: 21. In other embodiments, the effector molecule is a detectable label, such as, but not limited to, a fluorophore, an enzyme or a radioisotope. In other embodiments, the effector molecule is a photon absorber, such as IR700. Immunoconjugates comprising a photon absorber can be used for photoimmunotherapy. Immunoconjugates are further described in section V.
[0166] Further provided herein are antibody-drug conjugates (ADCs) that include a drug conjugated to a monoclonal antibody disclosed herein. In some embodiments, the drug is a small molecule, for example an anti-microtubule agent, an anti-mitotic agent and/or a cytotoxic agent. ADCs are further described in section VI.
[0167] Also provided herein are multi-specific antibodies that include a monoclonal antibody disclosed herein and at least one additional monoclonal antibody or antigen-binding fragment thereof. In some embodiments, the multi-specific antibody is a bispecific antibody. In other embodiments, the multi-specific antibody is a trispecific antibody. In some embodiments, the at least one additional monoclonal antibody or antigen binding fragment thereof specifically binds a component of the T cell receptor or a natural killer (NK) cell activating receptor. Multi-specific antibodies are further described in section VII.
[0168] Further provided herein are antibody-nanoparticle conjugates that include a nanoparticle conjugated to a monoclonal antibody disclosed herein. In some embodiments, the nanoparticle comprises a polymeric nanoparticle, nanosphere, nanocapsule, liposome, dendrimer, polymeric micelle, or niosome. In some embodiments, the nanoparticle includes a cytotoxic agent. Antibody-nanoparticle conjugates are further described in section VIII.
[0169] Also provided herein are fusion proteins that include a monoclonal antibody disclosed herein and a heterologous protein or peptide. In some embodiments, the heterologous protein is an Fc protein. In some examples, the Fc protein is a mouse Fc or a human Fc protein.
[0170] Also provided are nucleic acid molecules encoding a monoclonal antibody disclosed herein. In some embodiments, the nucleic acid molecule is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 1, SEQ ID NO: 3, or SEQ ID NO: 5. In some examples, the nucleic acid molecule comprises of consists of the nucleotide sequence SEQ ID NO: 1, or a degenerate variant thereof; the nucleotide sequence of SEQ ID NO: 3, or a degenerate variant thereof; the nucleotide sequences of SEQ ID NO: 1 and SEQ ID NO: 3, or degenerate variants thereof; or the nucleotide sequence of SEQ ID NO: 5, or a degenerate variant thereof. Further provided are nucleic acid molecules encoding a CAR, immunoconjugate, multi-specific antibody, or fusion protein disclosed herein. In some examples, the immunoconjugate comprises PE-LR, and the nucleic acid sequence encoding LR comprises nucleotides 361-1089 of SEQ ID NO: 14. In particular examples, the nucleic acid molecule encodes an immunotoxin and the nucleic acid sequence of the immunotoxin is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18 or SEQ ID NO: 20. In specific examples, the nucleic acid sequence of the immunotoxin comprises or consists of SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18 or SEQ ID NO: 20, or a degenerate variant thereof. In some embodiments, the nucleic acid molecule is operably linked to a promoter. Vectors that include the nucleic acid molecules are further provided herein.
[0171] Further provided herein is a nucleic acid construct that expresses a CAR and a truncated human EGFR (huEGFRt). In some embodiments, the nucleic acid comprises in the 5′ to 3′ direction: a nucleic acid encoding a first granulocyte-macrophage colony stimulating factor receptor signal sequence (GMCSFRss); a nucleic acid encoding a GPC1-specific monoclonal antibody disclosed herein; a nucleic acid encoding an extracellular hinge region; a nucleic acid encoding a transmembrane domain; a nucleic acid encoding an intracellular co-stimulatory domain; a nucleic acid encoding a intracellular signaling domain; a nucleic acid encoding a self-cleaving 2A peptide; a nucleic acid encoding a second GMCSFRss; and a nucleic acid encoding a truncated human epidermal growth factor receptor (huEGFRt). In some examples, the nucleic acid further includes a human elongation factor 1α (EF1α) promoter sequence 5′ of the nucleic acid encoding the first GMCSFRss. In some examples, the hinge region comprises a CD8α hinge region. In some examples, the transmembrane domain comprises a CD8α transmembrane domain. In some examples, the costimulatory signaling moiety comprises a 4-1BB signaling moiety. In some examples, the signaling domain comprises a CD3ζ signaling domain. In some examples, the amino acid sequence of the GPC1-specific monoclonal antibody comprises SEQ ID NO: 2 and SEQ ID NO: 4. In other examples, the amino acid sequence of the GPC1-specific monoclonal antibody comprises SEQ ID NO: 6. Vectors comprising the nucleic acid constructs are also provided. In some embodiments, the vector is a lentiviral vector.
[0172] Also provided is an isolated cell co-expressing a GPC1-specific CAR disclosed herein and huEGFRt. In some examples, the cell is a cytotoxic T lymphocyte (CTL).
[0173] Compositions that include a pharmaceutically acceptable carrier and a monoclonal antibody, CAR, isolated cell (such as a CAR expressing cell, for example a CAR T cell or a CAR NK cell), immunoconjugate, ADC, multi-specific antibody, antibody-nanoparticle conjugate, or fusion protein disclosed herein are further provided by the present disclosure. Compositions and their use are further described in section IX.
IV. Chimeric Antigen Receptors (CARs)
[0174] The disclosed monoclonal antibodies can also be used to produce CARs (also known as chimeric T cell receptors, artificial T cell receptors or chimeric immunoreceptors) and/or cytotoxic T lymphocytes (CTLs) or natural killer (NK) cells engineered to express CARs. Generally, CARs include a binding moiety, an extracellular hinge and spacer element, a transmembrane region and an endodomain that performs signaling functions (Cartellieri et al., J Biomed Biotechnol 2010:956304, 2010; Dai et al., J Natl Cancer Inst 108(7):djv439, 2016). In many instances, the binding moiety is an antigen binding fragment of a monoclonal antibody, such as a scFv, or a single-domain antibody. The spacer/hinge region typically includes sequences from IgG subclasses, such as IgG1, IgG4, IgD and CD8 domains. The transmembrane domain can be derived from a variety of different T cell proteins, such as CD3ζ, CD4, CD8 or CD28. Several different endodomains have been used to generate CARs. For example, the endodomain can consist of a signaling chain having an ITAM, such as CD3ζ or FcεRIγ. In some instances, the endodomain further includes the intracellular portion of at least one additional co-stimulatory domain, such as CD28, 4-1BB (CD137, TNFRSF9), OX-40 (CD134), ICOS, CD27 and/or DAP10.
[0175] CTLs, NK cells (or other immune cells) expressing CARs can be used to target a specific cell type, such as a GPC1-positive tumor cell. Thus, the monoclonal antibodies disclosed herein can be used to engineer CTLs or NK cells that express a CAR containing the GPC1-specific monoclonal antibody, thereby targeting the engineered CTLs or NK cells to GPC1-expressing tumor cells. Engineered T cells have previously been used for adoptive therapy for some types of cancer (see, for example, Park et al., Mol Ther 15(4):825-833, 2007). The use of T cells expressing CARs is more universal than standard CTL-based immunotherapy because CTLs expressing CARs are HLA unrestricted and can therefore be used for any patient having a tumor that expresses the target antigen.
[0176] Multispecific (such as bispecific) or bicistronic CARs are also contemplated by the present disclosure. In some embodiments, the multispecific or bispecific CAR includes a monoclonal antibody (or antigen-binding fragment thereof) specific for GPC1 (such as HM2 or D4) and a monoclonal antibody specific for a different antigen, such as a T cell antigen. Similarly, a bicistronic CAR includes two CAR molecules expressed from the same construct where one CAR molecule is a GPC1-targeted CAR and the second CAR targets a second antigen. See, for example, Qin et al., Blood 130:810, 2017; and WO/2018/213337.
[0177] Accordingly, provided herein are CARs that include a GPC1-specific antibody, such as a single-domain antibody or a scFv. Also provided are isolated nucleic acid molecules and vectors encoding the CARs (including bispecific and bicistronic CARs), and host cells, such as CTLs or NK cells, expressing the CARs, bispecific CAR or bicistronic CARs. CTLs or NK cells expressing CARs comprised of a GPC1-specific monoclonal antibody can be used for the treatment of cancers that express GPC1. In some embodiments herein, the CAR is a bispecific CAR. In other embodiments herein, the CAR is a bicistronic CAR.
[0178] In some embodiments, the CAR includes a signal peptide sequence, for example, N-terminal to the antigen binding domain. The signal peptide sequence can be any suitable signal peptide sequence, such as a signal sequence from granulocyte-macrophage colony-stimulating factor receptor (GMCSFR), immunoglobulin light chain kappa, or IL-2. While the signal peptide sequence may facilitate expression of the CAR on the surface of the cell, the presence of the signal peptide sequence in an expressed CAR is not necessary in order for the CAR to function. Upon expression of the CAR on the cell surface, the signal peptide sequence may be cleaved off of the CAR. Accordingly, in some embodiments, the CAR lacks a signal peptide sequence.
[0179] In some embodiments, the CARs disclosed herein are expressed from a construct (such as from a lentivirus vector) that also expresses a truncated version of human EGFR (huEGFRt). The CAR and huEGFRt are separated by a self-cleaving peptide sequence (such as T2A) such that upon expression in a transduced cell, the CAR is cleaved from huEGFRt.
[0180] In some embodiments disclosed herein, the CAR constructs encode the following amino acid sequences, in the N-terminal to C-terminal direction:
TABLE-US-00006 GMCSFRss: (SEQ ID NO: 7) MLLLVTSLLLCELPHPAFLLIP NdeI: HM Antigen-binding: a GPC 1-specific antibody (such as HM2 or D4) SpeI: TS CD8α hinge: (SEQ ID NO: 8) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD CD8α TM: (SEQ ID NO: 9) IYIWAPLAGTCGVLLLSLVIT 4-1BB: (SEQ ID NO: 10) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL CD3ζ: (SEQ ID NO: 11) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLY NELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR T2A: (SEQ ID NO: 12) EGRGSLLTCGDVEENPGP GMCSFRss: (SEQ ID NO: 7) MLLLVTSLLLCELPHPAFLLIP huEGFRt: (SEQ ID NO: 13) RKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKT VKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGD VIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPR DCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQC AHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNG PKIPSIATGMVGALLLLLVVALGIGLFM
[0181] The human epidermal growth factor receptor is comprised of four extracellular domains, a transmembrane domain and three intracellular domains. The EGFR domains are found in the following N-terminal to C-terminal order: Domain I-Domain II-Domain III-Domain IV-transmembrane (TM) domain-juxtamembrane domain-tyrosine kinase domain-C-terminal tail. Domain I and Domain III are leucine-rich domains that participate in ligand binding. Domain II and Domain IV are cysteine-rich domains and do not make contact with EGFR ligands. Domain II mediates formation of homo- or hetero-dimers with analogous domains from other EGFR family members, and Domain IV can form disulfide bonds with Domain II. The EGFR TM domain makes a single pass through the cell membrane and may play a role in protein dimerization. The intracellular domain includes the juxtamembrane domain, tyrosine kinase domain and C-terminal tail, which mediate EGFR signal transduction (Wee and Wang, Cancers 9(52), doi:10.3390/cancers9050052; Ferguson, Annu Rev Biophys 37:353-373, 2008; Wang et al., Blood 118(5):1255-1263, 2011).
[0182] A truncated version of human EGFR, referred to herein as “huEGFRt” includes only Domain III, Domain IV and the TM domain. Thus, huEGFRt lacks Domain I, Domain II, and all three intracellular domains. huEGFRt is not capable of binding EGF and lacks signaling activity. However, this molecule retains the capacity to bind particular EGFR-specific monoclonal antibodies, such as FDA-approved cetuximab (PCT Publication No. WO 2011/056894, which is herein incorporated by reference).
[0183] Transduction of T cells (or NK cells) with a construct (such as a lentivirus vector) encoding both huEGFRt and a tumor antigen-specific CAR disclosed herein allows for selection of transduced T cells using labelled EGFR monoclonal antibody cetuximab (ERBITUX™). For example, cetuximab can be labeled with biotin, and transduced T cells can be selected using anti-biotin magnetic beads, which are commercially available (such as from Miltenyi Biotec). Co-expression of huEGFRt also allows for in vivo tracking of adoptively transferred CAR-expressing T cells (or NK cells). Furthermore, binding of cetuximab to T cells expressing huEGFRt induces cytotoxicity of ADCC effector cells, thereby providing a mechanism to eliminate transduced T cells in vivo (Wang et al., Blood 118(5):1255-1263, 2011), such as at the conclusion of therapy.
[0184] Also provided herein are GPC1-specific monoclonal antibodies modified to enable their use with a universal CAR system. Universal CAR systems have been developed in order to increase CAR flexibility and expand their use to additional antigens. Currently, for each patient who receives CAR T cell therapy, autologous T cells must be cultured, expanded, and modified to express an antigen-specific CAR. This process is lengthy and expensive, limiting its use. Universal CARs are based on a system in which the signaling components of the CAR are split from the antigen-binding portion of the molecule, but come together using a “lock-key” system. For example, biotin-binding immune receptor (BBIR) CARs are comprised of an intracellular T cell signaling domain fused to an extracellular domain comprising avidin. Biotinylated antigen-specific (such as GPC1-specific) monoclonal antibodies can then bind the BBIR to direct T cells to tumor antigen-expressing cells. Another example is the split, universal and programmable (SUPRA) CAR system. In the SUPRA system, the CAR includes the intracellular signaling domains fused to an extracellular leucine zipper, which is paired with an antigen-specific monoclonal antibody fused to a cognate leucine zipper. For a review of universal CAR systems, see, for example, Zhao et al., J Hematol Oncol 11(1):132, 2018; and Cho et al., Cell 173:1426-1438, 2018. In some embodiments herein, the GPC1-specific monoclonal antibody is fused to one component of a specific binding pair. In some examples, the monoclonal antibody is fused to a leucine zipper or biotin.
[0185] Another type of universal CAR can be generated using a sortase enzyme. A sortase is a prokaryotic enzyme that modifies surface proteins by recognizing and cleaving a carboxyl-terminal sorting signal. Sortase catalyzes transpeptidation between a sortase recognition motif and a sortase acceptor motif. Thus, antigen-specific CARs can be generated by contacting an antigen-specific antibody fused to a sortase recognition motif with a portion of a CAR molecule that includes the intracellular signaling domain(s), a transmembrane region and an extracellular portion comprising a sortase acceptor motif. In the presence of the sortase enzyme, the two components become covalently attached to form a complete antigen-specific CAR. Accordingly, in some embodiments herein, a GPC1-specific monoclonal antibody is modified to include a sortase recognition motif (see, for example, PCT Publication No. WO 2016/014553).
V. Immunoconjugates
[0186] The disclosed monoclonal antibodies can be conjugated to a therapeutic agent or effector molecule Immunoconjugates include, but are not limited to, molecules in which there is a covalent linkage of a therapeutic agent to an antibody. A therapeutic agent is an agent with a particular biological activity directed against a particular target molecule or a cell bearing a target molecule. One of skill in the art will appreciate that therapeutic agents can include various drugs such as vinblastine, daunomycin and the like, cytotoxins such as native or modified Pseudomonas exotoxin or diphtheria toxin, encapsulating agents (such as liposomes) that contain pharmacological compositions, radioactive agents such as .sup.125I, .sup.32P, .sup.14C, .sup.3H and .sup.35S, photon absorbers such as IR700, and other labels, target moieties and ligands.
[0187] The choice of a particular therapeutic agent depends on the particular target molecule or cell, and the desired biological effect. Thus, for example, the therapeutic agent can be a cytotoxin that is used to bring about the death of a particular target cell (such as a tumor cell). Conversely, where it is desired to invoke a non-lethal biological response (such as for use in detection), the therapeutic agent can be conjugated to a non-lethal pharmacological agent or a liposome containing a non-lethal pharmacological agent.
[0188] With the therapeutic agents and antibodies described herein, one of skill can readily construct a variety of clones containing functionally equivalent nucleic acids, such as nucleic acids which differ in sequence but which encode the same effector moiety or antibody sequence. Thus, the present disclosure provides nucleic acids encoding antibodies and conjugates and fusion proteins thereof.
[0189] Effector molecules can be linked to an antibody of interest using any number of means. Both covalent and noncovalent attachment means may be used. The procedure for attaching an effector molecule to an antibody varies according to the chemical structure of the effector. Polypeptides typically contain a variety of functional groups; such as carboxylic acid (COOH), free amine (—NH.sub.2) or sulfhydryl (—SH) groups, which are available for reaction with a suitable functional group on an antibody to result in the binding of the effector molecule. Alternatively, the antibody is derivatized to expose or attach additional reactive functional groups. The derivatization may involve attachment of any of a number of known linker molecules. The linker can be any molecule used to join the antibody to the effector molecule. The linker is capable of forming covalent bonds to both the antibody and to the effector molecule. Suitable linkers are well-known to those of skill in the art and include, but are not limited to, straight or branched-chain carbon linkers, heterocyclic carbon linkers, or peptide linkers. Where the antibody and the effector molecule are polypeptides, the linkers may be joined to the constituent amino acids through their side groups (such as through a disulfide linkage to cysteine) or to the alpha carbon amino and carboxyl groups of the terminal amino acids.
[0190] In some circumstances, it is desirable to free the effector molecule from the antibody when the immunoconjugate has reached its target site. Therefore, in these circumstances, immunoconjugates will comprise linkages that are cleavable in the vicinity of the target site. Cleavage of the linker to release the effector molecule from the antibody may be prompted by enzymatic activity or conditions to which the immunoconjugate is subjected either inside the target cell or in the vicinity of the target site.
[0191] In view of the large number of methods that have been reported for attaching a variety of radiodiagnostic compounds, radiotherapeutic compounds, labels (such as enzymes or fluorescent molecules), drugs, toxins, and other agents to antibodies one skilled in the art will be able to determine a suitable method for attaching a given agent to an antibody or other polypeptide.
[0192] The antibodies disclosed herein can be derivatized or linked to another molecule (such as another peptide or protein). In general, the antibodies or portion thereof is derivatized such that the binding to the target antigen is not affected adversely by the derivatization or labeling. For example, the antibody can be functionally linked (by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as another antibody (for example, a bispecific antibody or a diabody), a detection agent, a photon absorber, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
[0193] One type of derivatized antibody is produced by cross-linking two or more antibodies (of the same type or of different types, such as to create bispecific antibodies). Suitable crosslinkers include those that are heterobifunctional, having two distinctly reactive groups separated by an appropriate spacer (such as m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional (such as disuccinimidyl suberate). Such linkers are commercially available.
[0194] The antibody can be conjugated with a detectable marker; for example, a detectable marker capable of detection by ELISA, spectrophotometry, flow cytometry, microscopy or diagnostic imaging techniques (such as computed tomography (CT), computed axial tomography (CAT) scans, magnetic resonance imaging (MRI), nuclear magnetic resonance imaging NMRI), magnetic resonance tomography (MTR), ultrasound, fiberoptic examination, and laparoscopic examination). Specific, non-limiting examples of detectable markers include fluorophores, chemiluminescent agents, enzymatic linkages, radioactive isotopes and heavy metals or compounds (for example super paramagnetic iron oxide nanocrystals for detection by MRI). For example, useful detectable markers include fluorescent compounds, including fluorescein, fluorescein isothiocyanate, rhodamine, 5-dimethylamine-1-napthalenesulfonyl chloride, phycoerythrin, lanthanide phosphors and the like. Bioluminescent markers are also of use, such as luciferase, green fluorescent protein (GFP) and yellow fluorescent protein (YFP). An antibody or antigen binding fragment can also be conjugated with enzymes that are useful for detection, such as horseradish peroxidase, β-galactosidase, luciferase, alkaline phosphatase, glucose oxidase and the like. When an antibody or antigen binding fragment is conjugated with a detectable enzyme, it can be detected by adding additional reagents that the enzyme uses to produce a reaction product that can be discerned. For example, when the agent horseradish peroxidase is present the addition of hydrogen peroxide and diaminobenzidine leads to a colored reaction product, which is visually detectable. An antibody or antigen binding fragment may also be conjugated with biotin, and detected through indirect measurement of avidin or streptavidin binding. It should be noted that the avidin itself can be conjugated with an enzyme or a fluorescent label.
[0195] An antibody may be labeled with a magnetic agent, such as gadolinium. Antibodies can also be labeled with lanthanides (such as europium and dysprosium), and manganese. Paramagnetic particles such as superparamagnetic iron oxide are also of use as labels. An antibody may also be labeled with a predetermined polypeptide epitopes recognized by a secondary reporter (such as leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags). In some embodiments, labels are attached by spacer arms of various lengths to reduce potential steric hindrance.
[0196] An antibody can also be labeled with a radiolabeled amino acid. The radiolabel may be used for both diagnostic and therapeutic purposes. For instance, the radiolabel may be used to detect expression of a target antigen by x-ray, emission spectra, or other diagnostic techniques. Examples of labels for polypeptides include, but are not limited to, the following radioisotopes or radionucleotides: .sup.3H, .sup.14C, .sup.15N, .sup.35S, .sup.90Y, .sup.99Tc, .sup.111In, .sup.125I, .sup.131I.
[0197] An antibody disclosed herein can also be conjugated to a photon absorber. In some embodiments, the photon absorber is a phthalocyanine dye, such as, but not limited to, IRDye® 700DX (also known as “IR700”). Antibody-photoabsorber conjugates can be used for photoimmunotherapy.
[0198] An antibody can also be derivatized with a chemical group such as polyethylene glycol (PEG), a methyl or ethyl group, or a carbohydrate group. These groups may be useful to improve the biological characteristics of the antibody, such as to increase serum half-life or to increase tissue binding.
[0199] Toxins can be employed with the monoclonal antibodies described herein to produce immunotoxins. Exemplary toxins include ricin, abrin, diphtheria toxin and subunits thereof, as well as botulinum toxins A through F. These toxins are readily available from commercial sources (for example, Sigma Chemical Company, St. Louis, Mo.). Contemplated toxins also include variants of the toxins described herein (see, for example, see, U.S. Pat. Nos. 5,079,163 and 4,689,401). In one embodiment, the toxin is Pseudomonas exotoxin (PE) (U.S. Pat. No. 5,602,095). As used herein “Pseudomonas exotoxin” refers to a full-length native (naturally occurring) PE or a PE that has been modified. Such modifications can include, but are not limited to, elimination of domain Ia, various amino acid deletions in domains Ib, II and III, single amino acid substitutions and the addition of one or more sequences at the carboxyl terminus (for example, see Siegall et al., J. Biol. Chem. 264:14256-14261, 1989).
[0200] PE employed with the monoclonal antibodies described herein can include the native sequence, cytotoxic fragments of the native sequence, and conservatively modified variants of native PE and its cytotoxic fragments. Cytotoxic fragments of PE include those which are cytotoxic with or without subsequent proteolytic or other processing in the target cell. Cytotoxic fragments of PE include PE40, PE38, and PE35. For additional description of PE and variants thereof, see for example, U.S. Pat. Nos. 4,892,827; 5,512,658; 5,602,095; 5,608,039; 5,821,238; and 5,854,044; U.S. Patent Application Publication No. 2015/0099707; PCT Publication Nos. WO 99/51643 and WO 2014/052064; Pai et al., Proc. Natl. Acad. Sci. USA 88:3358-3362, 1991; Kondo et al., J. Biol. Chem. 263:9470-9475, 1988; Pastan et al., Biochim. Biophys. Acta 1333:C1-C6, 1997.
[0201] Also contemplated herein are protease-resistant PE variants and PE variants with reduced immunogenicity, such as, but not limited to PE-LR, PE-6X, PE-8X, PE-LR/6X and PE-LR/8X (see, for example, Weldon et al., Blood 113(16):3792-3800, 2009; Onda et al., Proc Natl Acad Sci USA 105(32):11311-11316, 2008; and PCT Publication Nos. WO 2007/016150, WO 2009/032954 and WO 2011/032022, which are herein incorporated by reference).
[0202] In some examples, the PE is a variant that is resistant to lysosomal degradation, such as PE-LR (Weldon et al., Blood 113(16):3792-3800, 2009; PCT Publication No. WO 2009/032954). In other examples, the PE is a variant designated PE-LR/6X (PCT Publication No. WO 2011/032022). In other examples, the PE variant is PE with reducing immunogenicity. In yet other examples, the PE is a variant designated PE-LR/8M (PCT Publication No. WO 2011/032022).
[0203] Modification of PE may occur in any previously described variant, including cytotoxic fragments of PE (for example, PE38, PE-LR and PE-LR/8M). Modified PEs may include any substitution(s), such as for one or more amino acid residues within one or more T-cell epitopes and/or B cell epitopes of PE, or deletion of one or more T-cell and/or B-cell epitopes (see, for example, U.S. Patent Application Publication No. 2015/0099707).
[0204] Contemplated forms of PE also include deimmunized forms of PE, for example versions with domain II deleted (for example, PE24). Deimmunized forms of PE are described in, for example, PCT Publication Nos. WO 2005/052006, WO 2007/016150, WO 2007/014743, WO 2007/031741, WO 2009/32954, WO 2011/32022, WO 2012/154530, and WO 2012/170617.
[0205] In some embodiments herein, the immunoconjugate comprises the D4 of HM2 antibody and PE-LR. In some examples, a dimer of D4 is present in the immunoconjugate. In particular non-limiting embodiments, the amino acid sequence of the immunoconjugate is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19 or SEQ ID NO: 21. In specific examples, the amino acid sequence of the immunotoxin comprises or consists of SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19 or SEQ ID NO: 21.
[0206] The antibodies described herein can also be used to target any number of different diagnostic or therapeutic compounds to cells expressing the tumor antigen on their surface. Thus, an antibody of the present disclosure can be attached directly or via a linker to a drug that is to be delivered directly to cells expressing cell-surface antigen. This can be done for therapeutic, diagnostic or research purposes. Therapeutic agents include such compounds as nucleic acids, proteins, peptides, amino acids or derivatives, glycoproteins, radioisotopes, photon absorbers, lipids, carbohydrates, or recombinant viruses. Nucleic acid therapeutic and diagnostic moieties include antisense nucleic acids, derivatized oligonucleotides for covalent cross-linking with single or duplex DNA, and triplex forming oligonucleotides.
[0207] Alternatively, the molecule linked to an antibody can be an encapsulation system, such as a nanoparticle, liposome or micelle that contains a therapeutic composition such as a drug, a nucleic acid (for example, an antisense nucleic acid), or another therapeutic moiety that is preferably shielded from direct exposure to the circulatory system. Means of preparing liposomes attached to antibodies are well known to those of skill in the art (see, for example, U.S. Pat. No. 4,957,735; Connor et al., Pharm. Ther. 28:341-365, 1985).
[0208] Antibodies described herein can also be covalently or non-covalently linked to a detectable label. Detectable labels suitable for such use include any composition detectable by spectroscopic, photochemical, biochemical, immunochemical, electrical, optical or chemical means. Useful labels include magnetic beads, fluorescent dyes (for example, fluorescein isothiocyanate, Texas red, rhodamine, green fluorescent protein, and the like), radiolabels (for example, .sup.3H, .sup.125I, .sup.35S, .sup.14C, or .sup.32P), enzymes (such as horseradish peroxidase, alkaline phosphatase and others commonly used in an ELISA), and colorimetric labels such as colloidal gold or colored glass or plastic (such as polystyrene, polypropylene, latex, and the like) beads.
[0209] Means of detecting such labels are well known to those of skill in the art. Thus, for example, radiolabels may be detected using photographic film or scintillation counters, fluorescent markers may be detected using a photodetector to detect emitted illumination. Enzymatic labels are typically detected by providing the enzyme with a substrate and detecting the reaction product produced by the action of the enzyme on the substrate, and colorimetric labels are detected by simply visualizing the colored label.
VI. Antibody-Drug Conjugates (ADCs)
[0210] ADCs are compounds comprised of a tumor antigen-specific antibody (such as a single-domain antibody or antigen-binding fragment of an immunoglobulin) and a drug, typically a cytotoxic agent, such as an anti-microtubule agent or cross-linking agent. Because ADCs are capable of specifically targeting cancer cells, the drug can be much more potent than agents used for standard chemotherapy. The most common cytotoxic drugs currently used with ADCs have an IC.sub.50 that is 100- to 1000-fold more potent than conventional chemotherapeutic agents. Common cytotoxic drugs include anti-microtubule agents, such as maytansinoids and auristatins (such as auristatin E and auristatin F). Other cytotoxins for use with ADCs include pyrrolobenzodiazepines (PDBs), which covalently bind the minor groove of DNA to form interstrand crosslinks. In many instances, ADCs comprise a 1:2 to 1:4 ratio of antibody to drug (Bander, Clinical Advances in Hematology & Oncology 10(8; suppl 10):3-7, 2012).
[0211] The antibody and drug can be linked by a cleavable or non-cleavable linker. However, in some instances, it is desirable to have a linker that is stable in the circulation to prevent systemic release of the cytotoxic drug that could result in significant off-target toxicity. Non-cleavable linkers prevent release of the cytotoxic agent before the ADC is internalized by the target cell. Once in the lysosome, digestion of the antibody by lysosomal proteases results in the release of the cytotoxic agent (Bander, Clinical Advances in Hematology & Oncology 10(8; suppl 10):3-7, 2012).
[0212] One method for site-specific and stable conjugation of a drug to a monoclonal antibody is via glycan engineering. Monoclonal antibodies have one conserved N-linked oligosaccharide chain at the Asn297 residue in the CH2 domain of each heavy chain (Qasba et al., Biotechnol Prog 24:520-526, 2008). Using a mutant β1,4-galactosyltransferase enzyme (Y289L-Gal-T1; U.S. Patent Application Publication Nos. 2007/0258986 and 2006/0084162, herein incorporated by reference), 2-keto-galactose is transferred to free GlcNAc residues on the antibody heavy chain to provide a chemical handle for conjugation.
[0213] The oligosaccharide chain attached to monoclonal antibodies can be classified into three groups based on the terminal galactose residues—fully galactosylated (two galactose residues; IgG-G2), one galactose residue (IgG-G1) or completely degalactosylated (IgG-G0). Treatment of a monoclonal antibody with β1,4-galactosidase converts the antibody to the IgG-G0 glycoform. The mutant β1,4-galactosyltransferase enzyme is capable of transferring 2-keto-galactose or 2-azido-galactose from their respective UDP derivatives to the GlcNAc residues on the IgG-G1 and IgG-G0 glycoforms. The chemical handle on the transferred sugar enables conjugation of a variety of molecules to the monoclonal antibody via the glycan residues (Qasba et al., Biotechnol Prog 24:520-526, 2008).
[0214] Provided herein are ADCs that include a drug (such as a cytotoxic agent) conjugated to a monoclonal antibody that binds (such as specifically binds) GPC1. In some embodiments, the drug is a small molecule. In some examples, the drug is a cross-linking agent, an anti-microtubule agent and/or anti-mitotic agent, or any cytotoxic agent suitable for mediating killing of tumor cells. Exemplary cytotoxic agents include, but are not limited to, a PDB, an auristatin, a maytansinoid, dolastatin, calicheamicin, nemorubicin and its derivatives, PNU-159682, anthracycline, vinca alkaloid, taxane, trichothecene, CC1065, camptothecin, elinafide, a combretastain, a dolastatin, a duocarmycin, an enediyne, a geldanamycin, an indolino-benzodiazepine dimer, a puromycin, a tubulysin, a hemiasterlin, a spliceostatin, or a pladienolide, as well as stereoisomers, isosteres, analogs, and derivatives thereof that have cytotoxic activity.
[0215] In some embodiments, the ADC comprises a pyrrolobenzodiazepine (PBD). The natural product anthramycin (a PBD) was first reported in 1965 (Leimgruber et al., J Am Chem Soc, 87:5793-5795, 1965; Leimgruber et al., J Am Chem Soc, 87:5791-5793, 1965). Since then, a number of PBDs, both naturally-occurring and synthetic analogues, have been reported (Gerratana, Med Res Rev 32(2):254-293, 2012; and U.S. Pat. Nos. 6,884,799; 7,049,311; 7,067,511; 7,265,105; 7,511,032; 7,528,126; and 7,557,099). As one example, PDB dimers recognize and bind to specific DNA sequences, and have been shown to be useful as cytotoxic agents. PBD dimers have been conjugated to antibodies and the resulting ADC shown to have anti-cancer properties (see, for example, US 2010/0203007). Exemplary linkage sites on the PBD dimer include the five-membered pyrrolo ring, the tether between the PBD units, and the N10-C11 imine group (see WO 2009/016516; US 2009/304710; US 2010/047257; US 2009/036431; US 2011/0256157; and WO 2011/130598).
[0216] In some embodiments, the ADC comprises an antibody conjugated to one or more maytansinoid molecules. Maytansinoids are derivatives of maytansine, and are mitotic inhibitors which act by inhibiting tubulin polymerization. Maytansine was first isolated from the east African shrub Maytenus serrata (U.S. Pat. No. 3,896,111). Subsequently, it was discovered that certain microbes also produce maytansinoids, such as maytansinol and C-3 maytansinol esters (U.S. Pat. No. 4,151,042). Synthetic maytansinoids are disclosed, for example, in U.S. Pat. Nos. 4,137,230; 4,248,870; 4,256,746; 4,260,608; 4,265,814; 4,294,757; 4,307,016; 4,308,268; 4,308,269; 4,309,428; 4,313,946; 4,315,929; 4,317,821; 4,322,348; 4,331,598; 4,361,650; 4,364,866; 4,424,219; 4,450,254; 4,362,663; and 4,371,533.
[0217] In some embodiments, the ADC includes an antibody conjugated to a dolastatin or auristatin, or an analog or derivative thereof (see U.S. Pat. Nos. 5,635,483; 5,780,588; 5,767,237; and 6,124,431). Auristatins are derivatives of the marine mollusk compound dolastatin-10. Dolastatins and auristatins have been shown to interfere with microtubule dynamics, GTP hydrolysis, and nuclear and cellular division (Woyke et al., Antimicrob Agents and Chemother 45(12):3580-3584, 2001) and have anticancer (U.S. Pat. No. 5,663,149) and antifungal activity (Pettit et al., Antimicrob Agents Chemother 42:2961-2965, 1998). Exemplary dolastatins and auristatins include, but are not limited to, dolastatin 10, auristatin E, auristatin F, auristatin EB (AEB), auristatin EFP (AEFP), MMAD (Monomethyl Auristatin D or monomethyl dolastatin 10), MMAF (Monomethyl Auristatin F or N-methylvaline-valine-dolaisoleuine-dolaproine-phenylalanine), MMAE (Monomethyl Auristatin E or N-methylvaline-valine-dolaisoleuine-dolaproine-norephedrine), 5-benzoylvaleric acid-AE ester (AEVB), and other auristatins (see, for example, U.S. Publication No. 2013/0129753).
[0218] In some embodiments, the ADC comprises an antibody conjugated to one or more calicheamicin molecules. The calicheamicin family of antibiotics, and analogues thereof, are capable of producing double-stranded DNA breaks at sub-picomolar concentrations (Hinman et al., Cancer Res 53:3336-3342, 1993; Lode et al., Cancer Res 58:2925-2928, 1998). Exemplary methods for preparing ADCs with a calicheamicin drug moiety are described in U.S. Pat. Nos. 5,712,374; 5,714,586; 5,739,116; and 5,767,285.
[0219] In some embodiments, the ADC comprises an anthracycline. Anthracyclines are antibiotic compounds that exhibit cytotoxic activity. It is believed that anthracyclines can operate to kill cells by a number of different mechanisms, including intercalation of the drug molecules into the DNA of the cell thereby inhibiting DNA-dependent nucleic acid synthesis; inducing production of free radicals which then react with cellular macromolecules to cause damage to the cells; and/or interactions of the drug molecules with the cell membrane. Non-limiting exemplary anthracyclines include doxorubicin, epirubicin, idarubicin, daunomycin, daunorubicin, doxorubicin, epirubicin, nemorubicin, valrubicin and mitoxantrone, and derivatives thereof. For example, PNU-159682 is a potent metabolite (or derivative) of nemorubicin (Quintieri et al., Clin Cancer Res 11(4):1608-1617, 2005). Nemorubicin is a semisynthetic analog of doxorubicin with a 2-methoxymorpholino group on the glycoside amino of doxorubicin (Grandi et al., Cancer Treat Rev 17:133, 1990; Ripamonti et al., Br J Cancer 65:703-707, 1992).
[0220] In some embodiments, the ADC can further include a linker. In some examples, the linker is a bifunctional or multifunctional moiety that can be used to link one or more drug moieties to an antibody to form an ADC. In some embodiments, ADCs are prepared using a linker having reactive functionalities for covalently attaching to the drug and to the antibody. For example, a cysteine thiol of an antibody can form a bond with a reactive functional group of a linker or a drug-linker intermediate to make an ADC.
[0221] In some examples, a linker has a functionality that is capable of reacting with a free cysteine present on an antibody to form a covalent bond. Exemplary linkers with such reactive functionalities include maleimide, haloacetamides, α-haloacetyl, activated esters such as succinimide esters, 4-nitrophenyl esters, pentafluorophenyl esters, tetrafluorophenyl esters, anhydrides, acid chlorides, sulfonyl chlorides, isocyanates, and isothiocyanates.
[0222] In some examples, a linker has a functionality that is capable of reacting with an electrophilic group present on an antibody. Examples of such electrophilic groups include, but are not limited to, aldehyde and ketone carbonyl groups. In some cases, a heteroatom of the reactive functionality of the linker can react with an electrophilic group on an antibody and form a covalent bond to an antibody unit. Non-limiting examples include hydrazide, oxime, amino, hydrazine, thiosemicarbazone, hydrazine carboxylate and arylhydrazide.
[0223] In some examples, the linker is a cleavable linker, which facilitates release of the drug. Examples of cleavable linkers include acid-labile linkers (for example, comprising hydrazone), protease-sensitive linkers (for example, peptidase-sensitive), photolabile linkers, and disulfide-containing linkers (Chari et al., Cancer Res 52:127-131, 1992; U.S. Pat. No. 5,208,020).
[0224] The ADCs disclosed herein can be used for the treatment of a GPC1-positive cancer alone or in combination with another therapeutic agent and/or in combination with any standard therapy for the treatment of cancer (such as surgical resection of the tumor, chemotherapy or radiation therapy).
VII. Multi-Specific Antibodies
[0225] Multi-specific antibodies are recombinant proteins comprised of two or more monoclonal antibodies (such as single-domain antibodies) or antigen-binding fragments of two or more different monoclonal antibodies. For example, bispecific antibodies are comprised of antigen-binding fragments of two different monoclonal antibodies. Thus, bispecific antibodies bind two different antigens and trispecific antibodies bind three different antigens. Multi-specific antibodies can be used for cancer immunotherapy by simultaneously targeting, for example, both CTLs (such as a CTL receptor component such as CD3) or effector natural killer (NK) cells, and at least one tumor antigen. The GPC1-specific monoclonal antibodies disclosed herein can be used to generate multi-specific (such as bispecific or trispecific) antibodies that target both GPC1 and CTLs, or target both GPC1 and NK cells, thereby providing a means to treat GPC1-expressing cancers. In one example, the GPC1-specific monoclonal antibodies disclosed herein are used to generate multi-specific (such as bispecific or trispecific) antibodies that target both GPC1 and PD1, PDL1, EGFR, or VEGF, thereby providing a means to treat GPC1-expressing cancers.
[0226] Bi-specific T-cell engagers (BiTEs) are a type of bispecific monoclonal antibody that are fusions of a first monoclonal antibody (such as a scFv or a single-domain antibody) that targets a tumor antigen (such as GPC1) and a second antibody that binds T cells, such as CD3 on T cells. In some embodiments herein, one of the binding moieties of the BiTE is specific for GPC1.
[0227] Bi-specific killer cell engagers (BiKEs) are a type of bispecific monoclonal antibody that are fusions of a first monoclonal antibody (such as a scFv or single-domain antibody) that targets a tumor antigen (such as GPC1) and a second scFv that binds a NK cell activating receptor, such as CD16.
[0228] Provided herein are multi-specific, such as trispecific or bispecific, monoclonal antibodies comprising a GPC1-specific monoclonal antibody. In some embodiments, the multi-specific monoclonal antibody further comprises a monoclonal antibody that specifically binds a component of the T cell receptor, such as CD3. In other embodiments, the multi-specific monoclonal antibody further comprises a monoclonal antibody that specifically binds a NK cell activating receptor, such as CD16, Ly49, or CD94. Also provided are isolated nucleic acid molecules and vectors encoding the multi-specific antibodies, and host cells comprising the nucleic acid molecules or vectors. Multi-specific antibodies comprising a GPC1-specific antibody can be used for the treatment of cancers that express GPC1. Thus, provided herein are methods of treating a subject with cancer by selecting a subject with a cancer that expresses GPC1, and administering to the subject a therapeutically effective amount of the GPC1-targeting multi-specific antibody.
VIII. Antibody-Nanoparticle Conjugates
[0229] The monoclonal antibodies disclosed herein can be conjugated to a variety of different types of nanoparticles to deliver cytotoxic agents or other anti-cancer agents directly to tumor cells via binding of the antibody to GPC1 expressed on the surface of tumor cells. The use of nanoparticles reduces off-target side effects and can also improve drug bioavailability and reduce the dose of a drug required to achieve a therapeutic effect. Nanoparticle formulations can be tailored to suit the drug that is to be carried or encapsulated within the nanoparticle. For example, hydrophobic molecules can be incorporated inside the core of a nanoparticle, while hydrophilic drugs can be carried within an aqueous core protected by a polymeric or lipid shell. Examples of nanoparticles include, but at not limited to, nanospheres, nanocapsules, liposomes, dendrimers, polymeric micelles, niosomes, and polymeric nanoparticles (Fay and Scott, Immunotherapy 3(3):381-394, 2011).
[0230] Liposomes are currently one of the most common types of nanoparticles used for drug delivery. An antibody conjugated to a liposome is often referred to as an “immunoliposome.” The liposomal component of an immunoliposome is typically a lipid vesicle of one or more concentric phospholipid bilayers. In some cases, the phospholipids are composed of a hydrophilic head group and two hydrophobic chains to enable encapsulation of both hydrophobic and hydrophilic drugs. Conventional liposomes are rapidly removed from the circulation via macrophages of the reticuloendothelial system (RES). To generate long-circulating liposomes, the composition, size and charge of the liposome can be modulated. The surface of the liposome may also be modified, such as with a glycolipid or sialic acid. For example, the inclusion of polyethylene glycol (PEG) significantly increases circulation half-life. Liposomes for use as drug delivery agents, including for preparation of immunoliposomes, have been described in the art (see, for example, Paszko and Senge, Curr Med Chem 19(31)5239-5277, 2012; Immordino et al., Int J Nanomedicine 1(3):297-315, 2006; U.S. Patent Application Publication Nos. 2011/0268655; 2010/00329981).
[0231] Niosomes are non-ionic surfactant-based vesicles having a structure similar to liposomes. The membranes of niosomes are composed only of nonionic surfactants, such as polyglyceryl-alkyl ethers or N-palmitoylglucosamine Niosomes range from small, unilamellar to large, multilamellar particles. These nanoparticles are monodisperse, water-soluble, chemically stable, have low toxicity, are biodegradable and non-immunogenic, and increase bioavailability of encapsulated drugs.
[0232] Dendrimers include a range of branched polymer complexes. These nanoparticles are water-soluble, biocompatible and are sufficiently non-immunogenic for human use. Generally, dendrimers consist of an initiator core, surrounded by a layer of a selected polymer that is grafted to the core, forming a branched macromolecular complex. Dendrimers are typically produced using polymers such as poly(amidoamine) or poly(L-lysine). Dendrimers have been used for a variety of therapeutic and diagnostic applications, including for the delivery of DNA, RNA, bioimaging contrast agents and chemotherapeutic agents.
[0233] Polymeric micelles are composed of aggregates of amphiphilic co-polymers (consisting of both hydrophilic and hydrophobic monomer units) assembled into hydrophobic cores, surrounded by a corona of hydrophilic polymeric chains exposed to the aqueous environment. In many cases, the polymers used to prepare polymeric micelles are heterobifunctional copolymers composed of a hydrophilic block of PEG, poly(vinyl pyrrolidone) and hydrophobic poly(L-lactide) or poly(L-lysine) that forms the particle core. Polymeric micelles can be used to carry drugs that have poor solubility. These nanoparticles have been used to encapsulate a number of anti-cancer drugs, including doxorubicin and camptothecin. Cationic micelles have also been developed to carry DNA or RNA molecules.
[0234] Polymeric nanoparticles include both nanospheres and nanocapsules. Nanospheres consist of a solid matrix of polymer, while nanocapsules contain an aqueous core. The formulation selected typically depends on the solubility of the therapeutic agent to be carried/encapsulated; poorly water-soluble drugs are more readily encapsulated within a nanospheres, while water-soluble and labile drugs, such as DNA and proteins, are more readily encapsulated within nanocapsules. The polymers used to produce these nanoparticles include, for example, poly(acrylamide), poly(ester), poly(alkylcyanoacrylates), poly(lactic acid) (PLA), poly(glycolic acids) (PGA), and poly(D,L-lactic-co-glycolic acid) (PLGA).
[0235] Antibodies (or fragments thereof) can be conjugated to a suitable nanoparticle according to standard methods known in the art. For example, conjugation can be either covalent or non-covalent. In some embodiments in which the nanoparticle is a liposome, the antibody is attached to a sterically stabilized, long circulation liposome via a PEG chain. Coupling of antibodies or antibody fragments to a liposome can also involve thioester bonds, for example by reaction of thiols and maleimide groups. Cross-linking agents can be used to create sulfhydryl groups for attachment of antibodies to nanoparticles (Paszko and Senge, Curr Med Chem 19(31)5239-5277, 2012).
IX. Compositions and Methods of Use
[0236] Compositions are provided that include one or more of the disclosed monoclonal antibodies that bind (for example specifically bind) GPC1 in a carrier. Compositions comprising ADCs, CARs (and CTLs comprising CARs), multi-specific (such as bispecific or trispecific) antibodies, antibody-nanoparticle conjugates, immunoliposomes and immunoconjugates are also provided. The compositions can be prepared in unit dosage forms for administration to a subject. The amount and timing of administration are at the discretion of the treating clinician to achieve the desired outcome. The antibody, ADC, CAR, CTL, multi-specific antibody, antibody-nanoparticle conjugate, immunoliposome or immunoconjugate can be formulated for systemic or local (such as intra-tumor) administration. In one example, the antibody is formulated for parenteral administration, such as intravenous administration.
[0237] The compositions for administration can include a solution of the antibody, ADC, CAR, CTL, multi-specific (such as bispecific or trispecific) antibody, antibody-nanoparticle conjugate, immunoliposome or immunoconjugate in a pharmaceutically acceptable carrier, such as an aqueous carrier. A variety of aqueous carriers can be used, for example, buffered saline and the like. These solutions are sterile and generally free of undesirable matter. These compositions may be sterilized by conventional, well known sterilization techniques. The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, toxicity adjusting agents and the like, for example, sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate and the like. The concentration of antibody in these formulations can vary widely, and will be selected primarily based on fluid volumes, viscosities, body weight and the like in accordance with the particular mode of administration selected and the subject's needs.
[0238] A typical pharmaceutical composition for intravenous administration includes about 0.1 to 10 mg of antibody (or ADC, CAR, multi-specific antibody, antibody-nanoparticle conjugate, or immunoconjugate) per subject per day. Dosages from 0.1 up to about 100 mg per subject per day may be used, particularly if the agent is administered to a secluded site and not into the circulatory or lymph system, such as into a body cavity or into a lumen of an organ. Actual methods for preparing administrable compositions will be known or apparent to those skilled in the art and are described in more detail in such publications as Remington's Pharmaceutical Science, 19th ed., Mack Publishing Company, Easton, Pa. (1995).
[0239] The monoclonal antibodies disclosed herein can also be administered by other routes, including via inhalation, oral, topical or intraocular. In some examples, the monoclonal antibody (or conjugate thereof) is administered via fine-needle.
[0240] Antibodies (or other therapeutic molecules) may be provided in lyophilized form and rehydrated with sterile water before administration, although they are also provided in sterile solutions of known concentration. The antibody solution is then added to an infusion bag containing 0.9% sodium chloride, USP, and in some cases administered at a dosage of from 0.5 to 15 mg/kg of body weight, such as 1 to 10 mg/kg or 1 to 5 mg/kg. Considerable experience is available in the art in the administration of antibody drugs, which have been marketed in the U.S. since the approval of RITUXAN™ in 1997. Antibodies, ADCs, CARs, multi-specific (such as bispecific or trispecific) antibodies, antibody-nanoparticle conjugates, immunoliposomes or immunoconjugates can be administered by slow infusion, rather than in an intravenous push or bolus. In one example, a higher loading dose is administered, with subsequent, maintenance doses being administered at a lower level. For example, an initial loading dose of 3 to 5 mg/kg may be infused over a period of some 90 minutes, followed by weekly maintenance doses for 4-8 weeks of 1 to 2 mg/kg infused over a 30-minute period if the previous dose was well tolerated.
[0241] Controlled release parenteral formulations can be made as implants, oily injections, or as particulate systems. For a broad overview of protein delivery systems see, Banga, A. J., Therapeutic Peptides and Proteins: Formulation, Processing, and Delivery Systems, Technomic Publishing Company, Inc., Lancaster, Pa., (1995). Particulate systems include, for example, microspheres, microparticles, microcapsules, nanocapsules, nanospheres, and nanoparticles. Microcapsules contain the therapeutic protein, such as a cytotoxin or a drug, as a central core. In microspheres the therapeutic is dispersed throughout the particle. Particles, microspheres, and microcapsules smaller than about 1 μm are generally referred to as nanoparticles, nanospheres, and nanocapsules, respectively. Capillaries have a diameter of approximately 5 μm so that only nanoparticles are administered intravenously. Microparticles are typically around 100 μm in diameter and are administered subcutaneously or intramuscularly. See, for example, Kreuter, J., Colloidal Drug Delivery Systems, J. Kreuter, ed., Marcel Dekker, Inc., New York, N.Y., pp. 219-342 (1994); and Tice & Tabibi, Treatise on Controlled Drug Delivery, A. Kydonieus, ed., Marcel Dekker, Inc. New York, N.Y., pp. 315-339, (1992).
[0242] Polymers can be used for ion-controlled release of the antibody-based compositions disclosed herein. Various degradable and nondegradable polymeric matrices for use in controlled drug delivery are known in the art (Langer, Accounts Chem. Res. 26:537-542, 1993). For example, the block copolymer, polaxamer 407, exists as a viscous yet mobile liquid at low temperatures but forms a semisolid gel at body temperature. It has been shown to be an effective vehicle for formulation and sustained delivery of recombinant interleukin-2 and urease (Johnston et al., Pharm. Res. 9:425-434, 1992; and Pec et al., J. Parent. Sci. Tech. 44(2):58-65, 1990). Alternatively, hydroxyapatite has been used as a microcarrier for controlled release of proteins (Ijntema et al., Int. J. Pharm. 112:215-224, 1994). In yet another aspect, liposomes are used for controlled release as well as drug targeting of the lipid-capsulated drug (Betageri et al., Liposome Drug Delivery Systems, Technomic Publishing Co., Inc., Lancaster, Pa. (1993)). Numerous additional systems for controlled delivery of therapeutic proteins are known (see U.S. Pat. Nos. 5,055,303; 5,188,837; 4,235,871; 4,501,728; 4,837,028; 4,957,735; 5,019,369; 5,055,303; 5,514,670; 5,413,797; 5,268,164; 5,004,697; 4,902,505; 5,506,206; 5,271,961; 5,254,342 and 5,534,496).
[0243] A. Therapeutic Methods
[0244] The antibodies, compositions, CARs (and CTLs expressing CARs), ADCs, multi-specific (such as bispecific or trispecific) antibodies, antibody-nanoparticle conjugates, immunoliposomes and immunoconjugates disclosed herein can be administered to slow or inhibit the growth of tumor cells or inhibit the metastasis of tumor cells, such as GPC1-positive cancers. In these applications, a therapeutically effective amount of a composition is administered to a subject in an amount sufficient to inhibit growth, replication or metastasis of cancer cells, or to inhibit a sign or a symptom of the cancer. Suitable subjects may include those diagnosed with a cancer that expresses GPC1, such as, but not limited to pancreatic cancer, colorectal cancer, liver cancer, glioma, lung cancer, head and neck cancer, thyroid cancer, endometrial cancer, breast cancer or ovarian cancer. In some examples, the method reduces the volume of a tumor (such as a metastasis) by at least 10%, at least 20%, at least 50%, at least 75%, at least 80%, at least 90%, at least 95%, or even 100%, for example as compared to a volume prior to treatment. In some examples, the method reduces the number of tumor cells of a tumor by at least 10%, at least 20%, at least 50%, at least 75%, at least 80%, at least 90%, at least 95%, or even 100%, for example as compared to the number prior to treatment, In some examples, the method reduces the size of a tumor (such as a metastasis) by at least 10%, at least 20%, at least 50%, at least 75%, at least 80%, at least 90%, at least 95%, or even 100%, for example as compared to a size prior to treatment, In some examples, the method reduces the number of metastases at least 10%, at least 20%, at least 50%, at least 75%, at least 80%, at least 90%, at least 95%, or even 100%, for example as compared to a number prior to treatment. In some examples, the method increases the prognosis of a subject, such as increases the lifespan of the subject by at least 4 months, at least 6 months, at least 8 months, at least 9 months, at least 12 months, at least 24 months, at least 36 months, or at least 60 months, for example as compared to a number prior to treatment, In some examples, combinations of these effects are achieved.
[0245] Provided herein is a method of treating a GPC1-positive cancer in a subject by administering to the subject a therapeutically effective amount of a GPC1-specific antibody, immunoconjugate, CAR (or CTLs expressing a CAR), ADC, multi-specific (such as bispecific or trispecific) antibody, antibody-nanoparticle conjugate, immunoliposome or composition disclosed herein. Also provided herein is a method of inhibiting tumor growth or metastasis of a GPC1-positive cancer in a subject by administering to the subject a therapeutically effective amount of a GPC1-specific antibody, immunoconjugate, CAR (such as a CTL expressing a CAR), ADC, multi-specific (such as bispecific or trispecific) antibody, antibody-nanoparticle conjugate, immunoliposome or composition disclosed herein. In some embodiments, the GPC1-positive cancer is a pancreatic cancer, colorectal cancer, liver cancer, glioma, lung cancer, head and neck cancer, thyroid cancer, endometrial cancer, breast cancer or ovarian cancer.
[0246] A therapeutically effective amount of a GPC1-specific monoclonal antibody, ADC, CAR (for example a CTL expressing a CAR), multi-specific (such as bispecific or trispecific) antibody, immunoconjugate, immunoliposome or composition disclosed herein will depend upon the severity of the disease, the type of disease, and the general state of the patient's health. A therapeutically effective amount of the antibody-based composition is that which provides either subjective relief of a symptom(s) or an objectively identifiable improvement as noted by the clinician or other qualified observer.
[0247] Administration of the GPC1-specific antibodies, ADCs, CARs, immunoconjugates, multi-specific antibodies, antibody-nanoparticle conjugates, immunoliposomes and compositions disclosed herein can also be accompanied by administration of other anti-cancer agents or therapeutic treatments (such as surgical resection of a tumor). Any suitable anti-cancer agent can be administered in combination with the antibodies, compositions and immunoconjugates disclosed herein. Exemplary anti-cancer agents include, but are not limited to, chemotherapeutic agents, such as, for example, mitotic inhibitors, alkylating agents, anti-metabolites, intercalating antibiotics, growth factor inhibitors, cell cycle inhibitors, enzymes, topoisomerase inhibitors, anti-survival agents, biological response modifiers, anti-hormones (e.g. anti-androgens) and anti-angiogenesis agents. Other anti-cancer treatments include radiation therapy and other antibodies that specifically target cancer cells (such as anti-PD1, anti-PDL1, anti-VEGF, and anti-EGFR antibodies).
[0248] Non-limiting examples of alkylating agents include nitrogen mustards (such as mechlorethamine, cyclophosphamide, melphalan, uracil mustard or chlorambucil), alkyl sulfonates (such as busulfan), nitrosoureas (such as carmustine, lomustine, semustine, streptozocin, or dacarbazine).
[0249] Non-limiting examples of antimetabolites include folic acid analogs (such as methotrexate), pyrimidine analogs (such as 5-FU or cytarabine), and purine analogs, such as mercaptopurine or thioguanine.
[0250] Non-limiting examples of natural products include vinca alkaloids (such as vinblastine, vincristine, or vindesine), epipodophyllotoxins (such as etoposide or teniposide), antibiotics (such as dactinomycin, daunorubicin, doxorubicin, bleomycin, plicamycin, or mitomycin C), and enzymes (such as L-asparaginase).
[0251] Non-limiting examples of miscellaneous agents include platinum coordination complexes (such as cis-diamine-dichloroplatinum II also known as cisplatin), substituted ureas (such as hydroxyurea), methyl hydrazine derivatives (such as procarbazine), and adrenocrotical suppressants (such as mitotane and aminoglutethimide).
[0252] Non-limiting examples of hormones and antagonists include adrenocorticosteroids (such as prednisone), progestins (such as hydroxyprogesterone caproate, medroxyprogesterone acetate, and magestrol acetate), estrogens (such as diethylstilbestrol and ethinyl estradiol), antiestrogens (such as tamoxifen), and androgens (such as testerone proprionate and fluoxymesterone). Examples of the most commonly used chemotherapy drugs include Adriamycin, Alkeran, Ara-C, BiCNU, Busulfan, CCNU, Carboplatinum, Cisplatinum, Cytoxan, Daunorubicin, DTIC, 5-FU, Fludarabine, Hydrea, Idarubicin, Ifosfamide, Methotrexate, Mithramycin, Mitomycin, Mitoxantrone, Nitrogen Mustard, Taxol (or other taxanes, such as docetaxel), Velban, Vincristine, VP-16, while some more newer drugs include Gemcitabine (Gemzar), Herceptin, Irinotecan (Camptosar, CPT-11), Leustatin, Navelbine, Rituxan STI-571, Taxotere, Topotecan (Hycamtin), Xeloda (Capecitabine), Zevelin and calcitriol.
[0253] Non-limiting examples of immunomodulators that can be used include AS-101 (Wyeth-Ayerst Labs.), bropirimine (Upjohn), gamma interferon (Genentech), GM-CSF (granulocyte macrophage colony stimulating factor; Genetics Institute), IL-2 (Cetus or Hoffman-LaRoche), human immune globulin (Cutter Biological), IMREG (from Imreg of New Orleans, La.), SK&F 106528, and TNF (tumor necrosis factor; Genentech).
[0254] Another common treatment for some types of cancer is surgical treatment, for example surgical resection of the cancer or a portion of it. Another example of a treatment is radiotherapy, for example administration of radioactive material or energy (such as external beam therapy) to the tumor site to help eradicate the tumor or shrink it prior to surgical resection.
[0255] B. Methods for Diagnosis and Detection
[0256] Methods are provided herein for detecting GPC1 protein in vitro or in vivo. For example, the disclosed monoclonal antibodies can be used for in vivo tumor imaging. To use the disclosed antibodies as diagnostic reagents in vivo, the antibodies are labelled with a detectable moiety, such as a radioisotope, fluorescent label or positron emitting radionuclides. As one example, the monoclonal antibodies disclosed herein can be conjugated to a positron emitting radionuclide for use in positron emission tomography (PET); this diagnostic process is often referred to as immunoPET. While full length antibodies can make good immunoPET agents, their biological half-life can require waiting several days prior to imaging, which increases associated non-target radiation doses. Smaller, single domain antibodies/nanobodies have biological half-lives amenable to same day imaging.
[0257] In other instances, GPC1 expression is detected in a biological sample. The sample can be any sample, including, but not limited to, tissue from biopsies, autopsies and pathology specimens. Biological samples also include sections of tissues, for example, frozen sections taken for histological purposes. Biological samples further include body fluids, such as blood, serum, plasma, sputum, spinal fluid or urine. In some examples, the sample is a serum sample containing exosomes. A biological sample is typically obtained from a mammal, such as a human or non-human primate.
[0258] Exosomes are lipid bilayer-enclosed extracellular vesicles containing proteins and nucleic acids that are secreted by all cells and circulate in the blood. It has been demonstrated that patients with pancreatic cancer have GPC1-positive, cancer-derived exosomes circulating in their blood (Melo et al., Nature 523(7559):177-182, 2015). Thus, detection of GPC1-positive exosomes in serum can be used as a means to diagnose a subject as having a GPC1-positive cancer, such as pancreatic cancer. Accordingly, provided herein is a method of diagnosing a subject as having a GPC1-positive cancer (such as pancreatic cancer) by contacting a serum sample from the subject with a GPC1-specific monoclonal antibody disclosed herein; and detecting binding of the antibody to exosomes in the sample. In some examples, exosomes are isolated from the serum sample prior to being contacted with the GPC1-specific antibody. Detection of GPC1-expressing exosomes can be performed using any appropriate assay, such as by flow cytometry using a GPC1-specific antibody disclosed herein.
[0259] Provided herein is a method of determining if a subject has a GPC1-positive cancer by contacting a sample from the subject with a GPC1-specific monoclonal antibody disclosed herein; and detecting binding of the antibody to the sample. An increase in binding of the antibody to the sample as compared to binding of the antibody to a control sample identifies the subject as having a GPC1-positive cancer.
[0260] In another embodiment, provided is a method of confirming a diagnosis of a GPC1-positive cancer in a subject by contacting a sample from a subject diagnosed with a GPC1-positive cancer with a GPC1-specific monoclonal antibody disclosed herein; and detecting binding of the antibody to the sample. An increase in binding of the antibody to the sample as compared to binding of the antibody to a control sample confirms the diagnosis of a GPC1-positive cancer in the subject.
[0261] In some examples of the disclosed methods, the monoclonal antibody is directly labeled.
[0262] In other examples, the methods further include contacting a second antibody (a detection antibody) that specifically binds the monoclonal antibody with the sample; and detecting the binding of the second antibody. An increase in binding of the second antibody to the sample as compared to binding of the second antibody to a control sample detects a GPC1-positive cancer in the subject or confirms the diagnosis of a GPC1-positive cancer in the subject.
[0263] In some cases, the cancer is pancreatic cancer, colorectal cancer, liver cancer, glioma, lung cancer, head and neck cancer, thyroid cancer, endometrial cancer, breast cancer or ovarian cancer.
[0264] In some examples, the control sample is a sample from a subject without cancer. In particular examples, the sample is a blood or tissue sample.
[0265] In some embodiments of the methods of diagnosis and detection, the antibody that binds (for example specifically binds) GPC1 is directly labeled with a detectable label. In another embodiment, the antibody that binds (for example, specifically binds) GPC1 (the first antibody) is unlabeled and a second antibody or other molecule that can bind the antibody that specifically binds GPC1 is labeled. As is well known to one of skill in the art, a second antibody is chosen that is able to specifically bind the specific species and class of the first antibody. For example, if the first antibody is a human IgG, then the secondary antibody may be an anti-human-IgG. Other molecules that can bind to antibodies include, without limitation, Protein A and Protein G, both of which are available commercially.
[0266] Suitable labels for the antibody or secondary antibody include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, magnetic agents and radioactive materials. Non-limiting examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase. Non-limiting examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin. Non-limiting examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin. A non-limiting exemplary luminescent material is luminol; a non-limiting exemplary a magnetic agent is gadolinium, and non-limiting exemplary radioactive labels include .sup.125I, .sup.131I, .sup.35S or .sup.3H.
[0267] In an alternative embodiment, GPC1 can be assayed in a biological sample by a competition immunoassay utilizing GPC1 protein standards labeled with a detectable substance and an unlabeled antibody that specifically binds GPC1. In this assay, the biological sample, the labeled GPC1 protein standards and the antibody that specifically bind GPC1 are combined and the amount of labeled GPC1 protein standard bound to the unlabeled antibody is determined. The amount of GPC1 in the biological sample is inversely proportional to the amount of labeled GPC1 protein standard bound to the antibody that specifically binds GPC1.
[0268] The immunoassays and methods disclosed herein can be used for a number of purposes. In one embodiment, the antibody that specifically binds may be used to detect the production of GPC1 in cells in cell culture. In another embodiment, the antibody can be used to detect the amount of GPC1 in a biological sample, such as a tissue sample, or a blood or serum sample. In some examples, the GPC1 is cell-surface GPC1. In other examples, the GPC1 protein is soluble (for example, in a cell culture supernatant or in a body fluid sample, such as a blood or serum sample).
[0269] In one embodiment, a kit is provided for detecting GPC1 in a biological sample, such as a blood sample or tissue sample. For example, to confirm a cancer diagnosis in a subject, a biopsy can be performed to obtain a tissue sample for histological examination. Kits for detecting GPC1 will typically comprise a monoclonal antibody that specifically binds GPC1, such as any of the monoclonal antibodies disclosed herein, and can further include a labeled secondary antibody that can specifically bind to the anti-GPC1 antibody. In a specific embodiment, the anti-GPC1 antibody in the kit itself is labeled (for example, with a fluorescent, radioactive, or an enzymatic label).
[0270] In one embodiment, a kit includes instructional materials disclosing means of use of an antibody that binds GPC1. The instructional materials may be written, in an electronic form (such as a computer diskette or compact disk) or may be visual (such as video files). The kits may also include additional components to facilitate the particular application for which the kit is designed. Thus, for example, the kit may additionally contain means of detecting a label (such as enzyme substrates for enzymatic labels, filter sets to detect fluorescent labels, appropriate secondary labels such as a secondary antibody, or the like). The kits may additionally include buffers and other reagents routinely used for the practice of a particular method.
[0271] In one embodiment, the diagnostic kit comprises an immunoassay. Although the details of the immunoassays may vary with the particular format employed, the method of detecting GPC1 in a biological sample generally includes the steps of contacting the biological sample with an antibody which specifically reacts, under immunologically reactive conditions, to GPC1. The antibody is allowed to specifically bind under immunologically reactive conditions to form an immune complex, and the presence of the immune complex (bound antibody) is detected directly or indirectly.
[0272] The antibodies disclosed herein can also be utilized in immunoassays, such as, but not limited to radioimmunoassays (RIAs), ELISA, or immunohistochemical assays. The antibodies can also be used for fluorescence activated cell sorting (FACS). FACS employs a plurality of color channels, low angle and obtuse light-scattering detection channels, and impedance channels, among other more sophisticated levels of detection, to separate or sort cells (see U.S. Pat. No. 5,061,620). Any of the monoclonal antibodies that bind GPC1, as disclosed herein, can be used in these assays. Thus, the antibodies can be used in a conventional immunoassay, including, without limitation, an ELISA, an RIA, FACS, tissue immunohistochemistry, Western blot or immunoprecipitation.
[0273] The following examples are provided to illustrate certain particular features and/or embodiments. These examples should not be construed to limit the disclosure to the particular features or embodiments described.
EXAMPLES
Example 1: Isolation and Characterization of GPC1-Specific Monoclonal Antibodies
[0274] This example describes two GPC1-specific monoclonal antibodies that were isolated from a phage display library and mouse hybridomas. Mouse monoclonal antibody HM2 (SEQ ID NO: 2 and SEQ ID NO: 4) binds the C-lobe of GPC1 close to the cell surface, and the camel single-domain antibody D4 (SEQ ID NO: 6) recognizes a conformational epitope in the protein core of GPC1.
[0275] Antibody D4 was isolated from a camel single-domain (VHH) phage library after three rounds of panning (
[0276] Antibody HM2 was isolated from the mice immunized with a recombinant GPC1 fragment and screened on GPC1-positive cells following a previously described protocol (Phung et al., mAbs 4(5):592-599, 2012). An ELISA demonstrated that HM2 specifically binds human GPC1, but not human GPC2, GPC3, GPCS or GPC6 (
[0277] Using antibody HM2 (1 μg/ml), expression of GPC1 in human pancreatic tumors was evaluated by immunohistochemistry. As shown in
[0278] HM2 and D4 were used to generate GPC1-targeted CAR T cells. Lentiviral constructs expressing a CAR comprising HM2 scFv or VHH antibody D4 along with truncated human EGFR (huEGFRt) were produced (
[0279] Cytolytic activity of HM2 and D4 CAR T cells was tested in vitro. Luciferase expressing 2B9 (GPC1-positive), H8 (GPC1-positive), T3M4 (GPC1-positive) and A431 (GPC1-negative) cells were co-cultured with mock, HM2 or D4 CAR-transduced T cells at E:T ratios ranging from 1.1:1 to 30:1 for 20 hours. Specific lysis was measured using a luminescent-based cytolytic assay. As shown in
[0280] Additional studies were conducted to evaluate cytokine production induced by GPC1-targeted CART cells. GPC1-positive (H8 and 2B9) and GPC1-negative (A431) tumor cells were co-cultured with GPC1-targeted HM2 or D4 CAR T cells for 20 hours at an E:T ratio of 10. The culture supernatants were harvested to measure IL-2 (
[0281] GPC1-targeted CAR T cells based on antibody HM2 or D4 were evaluated in a peritoneal dissemination xenograft mouse model of pancreatic cancer. 2B9 tumor-bearing NSG mice were treated with peritoneal injection of either mock T cells or CAR T cells at day 11 after tumor cell inoculation (
Example 2: Immunotoxins Based on the D4 and HM2 Antibodies
[0282] This example describes the generation and testing of immunotoxins comprised of the D4 or HM2 antibody and a truncated form of Pseudomonas exotoxin A that lacks domain II (referred to herein as “LR”).
Immunotoxin Sequences
[0283] Four different immunotoxins were generated: D4-LR, HM2-LR, D4-AAA-D4-LR and D4-GGS-D4-LR. The latter two immunotoxins include dimers of D4 separated by a three-amino acid linker (AAA or GGS). The nucleotide and amino acid sequences of the four immunotoxins are provided below. The LR coding sequence (for the nucleotide sequences) and the LR portion of the amino acid sequences are underlined.
TABLE-US-00007 D4-LR nucleotide sequence (SEQ ID NO: 14) ATGCAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTGCAGCCCGGGGGGTCTCTGA GACTCTCCTGTGTAGCCTCTGGATACAGCTACAGTATTGGTTACATGGCCTGGTTCCGC CAGGCCCCAGGAAAGGAGCGCGCGTGGGTCGCGTCTCGATATACTGGTGACGGTGGC GCAGTCTTTGACGACGCCGTGAAGGGCCGATTCACCACCTCCCAAGAGAGTGCCGGGA ACACGTTCGATTTGCAAATGGACAGCCTGAAACCTGAGGACACTGCCATGTACTATTG CGCAGCGAAAGGGCCCGGTTTCGGGCGGTGGGAGTACTGGGGCCGGGGGACCCAGGT CACCGTCTCCTCAAAGCTTAAAGCAAGCGGCGGTCGCCATCGCCAGCCGCGCGGCTGG GAACAGCTGGGCGGTGGCGGTGGCAGCCCCACCGGTGCCGAGTTCCTGGGCGACGGT GGCGATGTGTCCTTTAGCACCCGTGGTACCCAGAACTGGACGGTAGAGCGCCTGCTGC AGGCACATCGTCAGCTGGAAGAGCGTGGCTATGTATTCGTTGGCTACCACGGCACTTT TCTGGAAGCAGCTCAGTCCATCGTGTTTGGTGGTGTCCGTGCCCGTTCTCAAGACCTGG ATGCGATTTGGCGTGGTTTCTACATTGCAGGCGATCCAGCGCTGGCATACGGTTATGCG CAGGACCAGGAACCGGATGCTCGTGGTCGCATTCGTAATGGTGCGCTGCTGCGCGTAT ATGTGCCGCGTTCCAGCCTGCCGGGCTTCTACCGCACTAGCCTGACCCTGGCCGCGCCG GAGGCGGCGGGTGAAGTGGAACGTCTGATTGGTCATCCTCTGCCTCTGCGCCTGGATG CCATCACCGGCCCAGAGGAGGAGGGCGGTCGTCTGGAAACCATTCTGGGCTGGCCGCT GGCTGAACGTACGGTCGTTATTCCGAGCGCGATTCCTACCGATCCTCGTAACGTTGGCG GCGATCTGGACCCATCTTCTATTCCAGATAAGGAGCAGGCAATCTCCGCGCTGCCGGA TTATGCAAGCCAACCGGGTAAACCACCTCGTGAAGATCTGAAATAA D4-LR amino acid sequence (SEQ ID NO: 15) MQVQLVESGGGLVQPGGSLRLSCVASGYSYSIGYMAWFRQAPGKERAWVASRYTGDGG AVFDDAVKGRFTTSQESAGNTFDLQMDSLKPEDTAMYYCAAKGPGFGRWEYWGRGTQV TVSSKLKASGGRHRQPRGWEQLGGGGGSPTGAEFLGDGGDVSFSTRGTQNWTVERLLQA HRQLEERGYVFVGYHGTFLEAAQSIVFGGVRARSQDLDAIWRGFYIAGDPALAYGYAQD QEPDARGRIRNGALLRVYVPRSSLPGFYRTSLTLAAPEAAGEVERLIGHPLPLRLDAITGPE EEGGRLETILGWPLAERTVVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDYASQPGKPPR EDLK HM2-LR nucleotide sequence (SEQ ID NO: 16) ATGGAGGTTCAGCTGCAGCAGTCTGGGGCTGAGCTTGTGAGGCCAGGGGCCTCAGTCA AGTTGTCCTGCACAGCTTCTGGCTTTAACATTAAAGACGACTATATGCACTGGGTGAA GCAGAGGCCTGAACAGGGCCTGGAGTGGATTGGATGGATTGATCCTGAGAATGGTGAT ACTGAATATGCCTCGAAGTTCCAGGGCAAGGCCACTATAACAGCAGACACATCCTCCA ACACAGCCTACCTGCAGCTCAGCAGCCTGACATCTGAGGACACTGCCGTCTATTACTG TACTCGTAGCTCCGTAGGCTACTGGGGCCAAGGCACCACTCTCACAGTCTCCTCAGGC GGAGGCGGATCAGGTGGTGGCGGATCTGGAGGTGGCGGAAGCGATGTTGTGATGACC CAAACTCCACTCTCCCTGCCTGTCAGTCTTGGAGATCAAGCCTCCATCTCTTGCAGATC TAGTCAGAGCCTTGTACACAGTAATGGAAACACCTATTTACATTGGTACCTGCAGAAG CCAGGCCAGTCTCCAAAGCTCCTGATCTACAAAGTTTCCAACCGATTTTCTGGGGTCCC AGACAGGTTCAGTGGCAGTGGATCAGGGACTTATTTCACACTCAAGATCAGCAGAGTG GAGGCTGAGGATCTGGGAGTTTATTTCTGCTCTCAAAGAACACATGTTCCGTACACGTT CGGAGGGGGGACCAAGCTGGAGATAAAAAAGCTTAAAGCAAGCGGCGGTCGCCATCG CCAGCCGCGCGGCTGGGAACAGCTGGGCGGTGGCGGTGGCAGCCCCACCGGTGCCGA GTTCCTGGGCGACGGTGGCGATGTGTCCTTTAGCACCCGTGGTACCCAGAACTGGACG GTAGAGCGCCTGCTGCAGGCACATCGTCAGCTGGAAGAGCGTGGCTATGTATTCGTTG GCTACCACGGCACTTTTCTGGAAGCAGCTCAGTCCATCGTGTTTGGTGGTGTCCGTGCC CGTTCTCAAGACCTGGATGCGATTTGGCGTGGTTTCTACATTGCAGGCGATCCAGCGCT GGCATACGGTTATGCGCAGGACCAGGAACCGGATGCTCGTGGTCGCATTCGTAATGGT GCGCTGCTGCGCGTATATGTGCCGCGTTCCAGCCTGCCGGGCTTCTACCGCACTAGCCT GACCCTGGCCGCGCCGGAGGCGGCGGGTGAAGTGGAACGTCTGATTGGTCATCCTCTG CCTCTGCGCCTGGATGCCATCACCGGCCCAGAGGAGGAGGGCGGTCGTCTGGAAACCA TTCTGGGCTGGCCGCTGGCTGAACGTACGGTCGTTATTCCGAGCGCGATTCCTACCGAT CCTCGTAACGTTGGCGGCGATCTGGACCCATCTTCTATTCCAGATAAGGAGCAGGCAA TCTCCGCGCTGCCGGATTATGCAAGCCAACCGGGTAAACCACCTCGTGAAGATCTGAA ATAA HM2-LR amino acid sequence (SEQ ID NO: 17) MEVQLQQSGAELVRPGASVKLSCTASGFNIKDDYMHWVKQRPEQGLEWIGWIDPENGDT EYASKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCTRSSVGYWGQGTTLTVSSGGGGS GGGGSGGGGSDVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPK LLIYKVSNRFSGVPDRFSGSGSGTYFTLKISRVEAEDLGVYFCSQRTHVPYTFGGGTKLEIK KLKASGGRHROPRGWEOLGGGGGSPTGAEFLGDGGDVSFSTRGTONWTVERLWAHROL EERGYVFVGYHGTFLEAAQSIVFGGVRARSQDLDAIWRGFYIAGDPALAYGYAQDQEPDA RGRIRNGALLRVYVPRSSLPGFYRTSLTLAAPEAAGEVERLIGHPLPLRLDAITGPEEEGGR LETILGWPLAERTVVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDYASQPGKPPREDLK D4-AAA-D4-LR nucleotide sequence (SEQ ID NO: 18) ATGCAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTGCAGCCCGGGGGGTCTCTGA GACTCTCCTGTGTAGCCTCTGGATACAGCTACAGTATTGGTTACATGGCCTGGTTCCGC CAGGCCCCAGGAAAGGAGCGCGCGTGGGTCGCGTCTCGATATACTGGTGACGGTGGC GCAGTCTTTGACGACGCCGTGAAGGGCCGATTCACCACCTCCCAAGAGAGTGCCGGGA ACACGTTCGATTTGCAAATGGACAGCCTGAAACCTGAGGACACTGCCATGTACTATTG CGCAGCGAAAGGGCCCGGTTTCGGGCGGTGGGAGTACTGGGGCCGGGGGACCCAGGT CACCGTCTCCTCAGCGGCGGCGCAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTG CAGCCCGGGGGGTCTCTGAGACTCTCCTGTGTAGCCTCTGGATACAGCTACAGTATTG GTTACATGGCCTGGTTCCGCCAGGCCCCAGGAAAGGAGCGCGCGTGGGTCGCGTCTCG ATATACTGGTGACGGTGGCGCAGTCTTTGACGACGCCGTGAAGGGCCGATTCACCACC TCCCAAGAGAGTGCCGGGAACACGTTCGATTTGCAAATGGACAGCCTGAAACCTGAGG ACACTGCCATGTACTATTGCGCAGCGAAAGGGCCCGGTTTCGGGCGGTGGGAGTACTG GGGCCGGGGGACCCAGGTCACCGTCTCCTCAAAGCTTAAAGCAAGCGGCGGTCGCCAT CGCCAGCCGCGCGGCTGGGAACAGCTGGGCGGTGGCGGTGGCAGCCCCACCGGTGCC GAGTTCCTGGGCGACGGTGGCGATGTGTCCTTTAGCACCCGTGGTACCCAGAACTGGA CGGTAGAGCGCCTGCTGCAGGCACATCGTCAGCTGGAAGAGCGTGGCTATGTATTCGT TGGCTACCACGGCACTTTTCTGGAAGCAGCTCAGTCCATCGTGTTTGGTGGTGTCCGTG CCCGTTCTCAAGACCTGGATGCGATTTGGCGTGGTTTCTACATTGCAGGCGATCCAGCG CTGGCATACGGTTATGCGCAGGACCAGGAACCGGATGCTCGTGGTCGCATTCGTAATG GTGCGCTGCTGCGCGTATATGTGCCGCGTTCCAGCCTGCCGGGCTTCTACCGCACTAGC CTGACCCTGGCCGCGCCGGAGGCGGCGGGTGAAGTGGAACGTCTGATTGGTCATCCTC TGCCTCTGCGCCTGGATGCCATCACCGGCCCAGAGGAGGAGGGCGGTCGTCTGGAAAC CATTCTGGGCTGGCCGCTGGCTGAACGTACGGTCGTTATTCCGAGCGCGATTCCTACCG ATCCTCGTAACGTTGGCGGCGATCTGGACCCATCTTCTATTCCAGATAAGGAGCAGGC AATCTCCGCGCTGCCGGATTATGCAAGCCAACCGGGTAAACCACCTCGTGAAGATCTG AAATAA D4-AAA-D4-LR amino acid sequence (SEQ ID NO: 19) MQVQLVESGGGLVQPGGSLRLSCVASGYSYSIGYMAWFRQAPGKERAWVASRYTGDGG AVFDDAVKGRFTTSQESAGNTFDLQMDSLKPEDTAMYYCAAKGPGFGRWEYWGRGTQV TVSSAAAQVQLVESGGGLVQPGGSLRLSCVASGYSYSIGYMAWFRQAPGKERAWVASRY TGDGGAVI-DDAVKGRFTTSQESAGNTFDLQMDSLKPEDTAMYYCAAKGPGFGRWEYWG RGTQVTVSSKLKASGGRHRQPRGWEQLGGGGGSPTGAEFLGDGGDVSFSTRGTQNWTVE RLLQAHRQLEERGYVFVGYHGTFLEAAQSIVFGGVRARSQDLDAIWRGFYIAGDPALAYG YAQDQEPDARGRIRNGALLRVYVPRSSLPGFYRTSLTLAAPEAAGEVERLIGHPLPLRLDAI TGPEEEGGRLETILGWPLAERTVVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDYASQPG KPPREDLK D4-GGS-D4-LR nucleotide sequence (SEQ ID NO: 20) ATGCAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTGCAGCCCGGGGGGTCTCTGA GACTCTCCTGTGTAGCCTCTGGATACAGCTACAGTATTGGTTACATGGCCTGGTTCCGC CAGGCCCCAGGAAAGGAGCGCGCGTGGGTCGCGTCTCGATATACTGGTGACGGTGGC GCAGTCTTTGACGACGCCGTGAAGGGCCGATTCACCACCTCCCAAGAGAGTGCCGGGA ACACGTTCGATTTGCAAATGGACAGCCTGAAACCTGAGGACACTGCCATGTACTATTG CGCAGCGAAAGGGCCCGGTTTCGGGCGGTGGGAGTACTGGGGCCGGGGGACCCAGGT CACCGTCTCCTCAGGCGGCAGCCAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTG CAGCCCGGGGGGTCTCTGAGACTCTCCTGTGTAGCCTCTGGATACAGCTACAGTATTG GTTACATGGCCTGGTTCCGCCAGGCCCCAGGAAAGGAGCGCGCGTGGGTCGCGTCTCG ATATACTGGTGACGGTGGCGCAGTCTTTGACGACGCCGTGAAGGGCCGATTCACCACC TCCCAAGAGAGTGCCGGGAACACGTTCGATTTGCAAATGGACAGCCTGAAACCTGAGG ACACTGCCATGTACTATTGCGCAGCGAAAGGGCCCGGTTTCGGGCGGTGGGAGTACTG GGGCCGGGGGACCCAGGTCACCGTCTCCTCAAAGCTTAAAGCAAGCGGCGGTCGCCAT CGCCAGCCGCGCGGCTGGGAACAGCTGGGCGGTGGCGGTGGCAGCCCCACCGGTGCC GAGTTCCTGGGCGACGGTGGCGATGTGTCCTTTAGCACCCGTGGTACCCAGAACTGGA CGGTAGAGCGCCTGCTGCAGGCACATCGTCAGCTGGAAGAGCGTGGCTATGTATTCGT TGGCTACCACGGCACTTTTCTGGAAGCAGCTCAGTCCATCGTGTTTGGTGGTGTCCGTG CCCGTTCTCAAGACCTGGATGCGATTTGGCGTGGTTTCTACATTGCAGGCGATCCAGCG CTGGCATACGGTTATGCGCAGGACCAGGAACCGGATGCTCGTGGTCGCATTCGTAATG GTGCGCTGCTGCGCGTATATGTGCCGCGTTCCAGCCTGCCGGGCTTCTACCGCACTAGC CTGACCCTGGCCGCGCCGGAGGCGGCGGGTGAAGTGGAACGTCTGATTGGTCATCCTC TGCCTCTGCGCCTGGATGCCATCACCGGCCCAGAGGAGGAGGGCGGTCGTCTGGAAAC CATTCTGGGCTGGCCGCTGGCTGAACGTACGGTCGTTATTCCGAGCGCGATTCCTACCG ATCCTCGTAACGTTGGCGGCGATCTGGACCCATCTTCTATTCCAGATAAGGAGCAGGC AATCTCCGCGCTGCCGGATTATGCAAGCCAACCGGGTAAACCACCTCGTGAAGATCTG AAATAA D4-GGS-D4-LR amino acid sequence (SEQ ID NO: 21) MQVQLVESGGGLVQPGGSLRLSCVASGYSYSIGYMAWFRQAPGKERAWVASRYTGDGG AVFDDAVKGRFTTSQESAGNTFDLQMDSLKPEDTAMYYCAAKGPGFGRWEYWGRGTQV TVSSGGSQVQLVESGGGLVQPGGSLRLSCVASGYSYSIGYMAWFRQAPGKERAWVASRY TGDGGAVFDDAVKGRFTTSQESAGNTFDLQMDSLKPEDTAMYYCAAKGPGFGRWEYWG RGTQVTVSSKLKASGGRHRQPRGWEQLGGGGGSPTGAEFLGDGGDVSFSTRGTQNWTVE RLLQAHRQLEERGYVFVGYHGTFLEAAQSIVFGGVRARSQDLDAIWRGFYIAGDPALAYG YAQDQEPDARGRIRNGALLRVYVPRSSLPGFYRTSLTLAAPEAAGEVERLIGHPLPLRLDAI TGPEEEGGRLETILGWPLAERTVVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDYASQPG KPPREDLK
Generation and Testing of GPC1-Targeted Immunotoxins
[0284] The HM2-LR immunotoxin is comprised of the HM2 VH domain linked to the HM2 VL domain via a (G.sub.4S).sub.3 linker, and a truncated Pseudomonas exotoxin A (LR) conjugated to the VL domain. The D4-LR immunotoxin is comprised of the D4 VHH single-domain antibody conjugated to LR. Schematics of the two immunotoxins are shown in
[0285] Affinity of HM2-LR and D4-LR for GPC1 was tested using Octet analysis (
[0286] The immunotoxins were also tested for their ability to kill GPC1-positive cancer cells in vitro. Cytotoxicity assays were performed on GPC1-positive cell lines H8, 2B9 and T3M4, and GPC1-negative cell line A431 using WST-8 reagent after three days incubation. The D4-LR and HM2-LR immunotoxins efficiently killed GPC1 overexpressing H8 and 2B9 cell lines with IC50 values ranging from 14 to 31 ng/ml (
[0287] To enhance killing capacity of the D4 immunotoxin, two bivalent D4 immunotoxins (D4-AAA-D4-LR and D4-GGS-D4-LR) were generated and tested. A schematic of the two D4-D4-LR immunotixins is shown in
[0288] Binding affinity of the D4-D4-LR immunotoxins for GPC1 was evaluated using three different assays: Octet (
[0289] Cytotoxicity assays were performed to determine the ability of the D4-D4-LR immunotoxins to kill GPC1-expressing tumor cells. Assays were performed on GPC1-positive (H8, 2B9 and T3M4) and negative (A431) cell lines. Bivalent D4 immunotoxins showed similar efficacy on GPC1-overexpressing cell lines H8 (
[0290] The effect of the D4-LR, D4-AAA-D4-LR and HM2-LR immunotoxins on tumor growth was tested in a mouse H8/A431 subcutaneous xenograft model. Five-week old female athymic nude mice were injected with 5×10.sup.6 cells in the right dorsal flank. Mice were treated a total of nine times with D4-LR (5 mg/kg), D4-AAA-D4-LR (3 mg/kg) or HM2-LR (5 mg/kg) by tail vein injection on days 5, 7, 9, 11, 13, 15, 17, 19 and 21 post-inoculation. Each experimental group contained five mice. Tumor volume for each mouse and for the average of each experimental group are shown in
[0291] In view of the many possible embodiments to which the principles of the disclosure may be applied, it should be recognized that the illustrated embodiments are only examples and should not be taken as limiting the scope of the disclosure. Rather, the scope of the disclosure is defined by the following claims.