COMPOSITION FOR USE IN TREATING DYSTROPHIC EPIDERMOLYSIS BULLOSA
20220088083 · 2022-03-24
Assignee
Inventors
- Katsuto TAMAI (Suita-shi, Osaka, JP)
- Yasushi KIKUCHI (Suita-shi, Osaka, JP)
- Tomoki TAMAKOSHI (Suita-shi, Osaka, JP)
Cpc classification
C12N2310/20
CHEMISTRY; METALLURGY
A61K9/0019
HUMAN NECESSITIES
A61K38/39
HUMAN NECESSITIES
A61K48/00
HUMAN NECESSITIES
A61K35/28
HUMAN NECESSITIES
C12N15/113
CHEMISTRY; METALLURGY
International classification
A61K35/28
HUMAN NECESSITIES
A61K38/39
HUMAN NECESSITIES
A61K9/00
HUMAN NECESSITIES
Abstract
The present disclosure relates to a composition for use in the treatment of dystrophic epidermolysis bullosa, comprising a cell obtained from a patient with dystrophic epidermolysis bullosa, wherein the cell is a mesenchymal stem cell and genetically modified to produce type VII collagen. The present disclosure also relates to a composition for use in the treatment of dystrophic epidermolysis bullosa, comprising a cell that produces type VII collagen, wherein the composition is to be administered into a blister.
Claims
1-16. (canceled)
17. A method of treating dystrophic epidermolysis bullosa, comprising the steps of: (a) obtaining mesenchymal stem cells from a patient with dystrophic epidermolysis bullosa; (b) genetically modifying the cells to produce type VII collagen; and (c) administering the cells of (b) to the patient.
18. The method of claim 17, wherein genetically modifying the cells of (b) includes delivering a COL7A1 gene to the cells.
19. The method of claim 18, wherein the COL7A1 gene comprises a nucleic acid sequence having 90% or more sequence identity with the nucleic acid sequence of SEQ ID NO: 1, or a nucleic acid sequence that encodes an amino acid sequence having 90% or more sequence identity with the amino acid sequence of SEQ ID NO: 2.
20. The method of claim 17, wherein the mesenchymal stem cells are bone marrow-derived mesenchymal stem cells.
21. The method of claim 17, wherein administering the cells to the patient comprises administering a population of cells to the patient, wherein the mesenchymal stem cells are the most abundant cells in the population.
22. The method of claim 17, wherein the cells are administered to the patient by intrablister injection.
23. The method of claim 22, wherein the intrablister injection is an injection of the cells into a space formed between the basal membrane and the dermis of the patient's skin, at a place where the basal membrane is detached from the dermis.
24. A method of treating dystrophic epidermolysis bullosa, comprising: administering a therapeutically-effective amount of cells which produce type VII collagen to a patient in need thereof, the administering being intrablister administration.
25. The method of claim 24, wherein the cells have been genetically modified to produce type VII collagen.
26. The method of claim 25, wherein the cells have been genetically modified by delivering a COL7A1 gene to the cells.
27. The method of claim 26, wherein the COL7A1 gene comprises a nucleic acid sequence having 90% or more sequence identity with the nucleic acid sequence of SEQ ID NO: 1, or a nucleic acid sequence that encodes an amino acid sequence having 90% or more sequence identity with the amino acid sequence of SEQ ID NO: 2.
28. The method of claim 24, wherein the cells have been obtained from the patient with dystrophic epidermolysis bullosa.
29. The method of claim 24, wherein the cells have been obtained from bone marrow.
30. The method of claim 24, wherein the cells are mesenchymal stem cells.
31. The method of claim 30, wherein the mesenchymal stem cells are bone marrow-derived mesenchymal stem cells.
32. The method of claim 30, wherein administering the cells to the patient comprises administering a population of cells to the patient, wherein the mesenchymal stem cells are the most abundant cells in the population.
33. The method of claim 24, wherein the intrablister administration is injection of the cells into a space formed between the basal membrane and the dermis of the patient's skin, at a place where the basal membrane is detached from the dermis.
34. A gRNA comprising a sequence selected from the group consisting of SEQ ID NOs: 3 to 5, or a sequence complementary thereto.
35. A method of preparing cells for administration to a patient in need of treatment of dystrophic epidermolysis bullosa, comprising: genetically modifying mesenchymal stem cells to produce type VII collagen, the cells having been obtained from the patient in need of treatment of dystrophic epidermolysis bullosa, wherein the genetically modified cells are capable of being administered to the patient.
36. A method of treating dystrophic epidermolysis bullosa, comprising: administering a therapeutically-effective amount of cells which produce type VII collagen to a patient in need thereof, the cells being mesenchymal stem cells having been previously obtained from the patient and genetically modified to produce type VII collagen.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
DESCRIPTION OF EMBODIMENTS
[0021] Unless otherwise specified, the terms used in the present disclosure have meanings generally understood by those skilled in the art in the fields such as organic chemistry, medical science, pharmaceutical science, molecular biology, and microbiology. Definitions of some terms used in the present disclosure are provided below, and these definitions supersede the general understandings in the present disclosure.
[0022] Dystrophic epidermolysis bullosa is a hereditary disease caused by a mutation in the COL7A1 gene, which encodes type VII collagen, and is known to be characterized in that no type VII collagen is produced or type VII collagen with reduced function due to the mutation is produced. The type VII collagen forms fibers called anchoring fibrils in the dermis and connects the basement membrane and the dermis. The type VII collagen contains a first non-collagen region, a collagen region, and a second non-collagen region from the N-terminus, and forms a triple chain at the collagen region, which is characterized by a repeating sequence of glycine-X-Y. Two molecules bind to each other at the C-terminus and the N-terminus binds to the basement membrane. Examples of mutations include a mutation in which glycine in the collagen region is replaced by a different amino acid, a stop codon mutation that stops protein translation, and a splice site mutation. The mutation may be in one of the alleles or in both. Dystrophic epidermolysis bullosa includes dominant dystrophic epidermolysis bullosa and recessive dystrophic epidermolysis bullosa, and the recessive dystrophic epidermolysis bullosa include severe generalized recessive dystrophic epidermolysis bullosa and other generalized types with relatively mild symptoms. The dystrophic epidermolysis bullosa herein may be any type of dystrophic epidermolysis bullosa, and the causal mutation in the COL7A1 gene may be any mutation.
[0023] In the present disclosure, a cell that produces type VII collagen is used. As used herein, the term “cell that produces type VII collagen” means a cell that produces a functional type VII collagen (ie, a type VII collagen capable of forming anchoring fibrils). The cell that produces type VII collagen may be a cell that naturally produces type VII collagen or a cell that has been genetically modified to produce type VII collagen.
[0024] In the present disclosure, genetic modification of a cell means both modification of a gene in the genome of the cell and modification of the cell to express a gene from a nucleic acid construct outside the genome (such as a vector). That is, the expression “genetically modifying a cell to produce type VII collagen” includes modifying a cell to express type VII collagen from a COL7A1 gene in the genome, and modifying a cell to express type VII collagen from a COL7A1 gene in a nucleic acid construct outside the genome. Also, “a cell genetically modified to produce type VII collagen” includes a cell that expresses type VII collagen from a COL7A1 gene in the genome and a cell that expresses type VII collagen from a COL7A1 gene in a nucleic acid construct outside the genome.
[0025] Genetic modification of a cell can be carried out by introducing a COL7A1 gene or by correcting a mutation in the COL7A1 gene in the genome. The introduction of a COL7A1 gene can be carried out either by introducing a COL7A1 gene into the genome of the cell or by placing a nucleic acid construct comprising a COL7A1 gene in the cell so that the COL7A1 gene is expressed from the nucleic acid construct outside the genome. When a COL7A1 gene is introduced into the genome of a cell, the COL7A1 gene may be introduced at a specific site or may be introduced at random. In an embodiment, the COL7A1 gene is introduced into the COL7A1 locus of the genome, or a safe harbor such as the AAVS1 region.
[0026] The cell may be a cell obtained from a patient with dystrophic epidermolysis bullosa to which the cell is to be administered (ie, an autologous cell), or a cell obtained from a subject other than the patient (ie, an allogeneic cell). Subjects other than the patient include healthy individuals, especially HLA-matched healthy individuals, or the patient's mother. In an embodiment, the cell is a cell obtained from a patient with dystrophic epidermolysis bullosa. The cell obtained from a patient with dystrophic epidermolysis bullosa includes a cell that does not produce type VII collagen and a cell that produces type VII collagen with reduced function due to a mutation, and the “cell obtained from a patient with dystrophic epidermolysis bullosa” as used herein may be any of them.
[0027] The cell may be any cell as long as it produces type VII collagen in the vicinity of the epidermal basement membrane when administered to a patient. The cell can be a cell derived from skin, bone marrow, or blood (eg, peripheral blood). In an embodiment, the cell is a keratinocyte, skin fibroblast, or mesenchymal stem cell. In a different embodiment, the cell is an iPS cell induced from a cell obtained from a patient or a subject other than the patient or a cell induced from such an iPS cell. Thus, the cell may be a cell obtained from a patient or a subject other than the patient, or may be a cell induced from the obtained cell. When the cell is a genetically modified cell and also it is a cell induced from a cell obtained from a patient or a subject other than the patient, the genetic modification may have been carried out before or after the induction.
[0028] In the present disclosure, the term “cell” is used in the sense of including a cell after proliferation as needed. Proliferation of a cell can be carried out by culturing the cell. For example, “a cell obtained from a patient or a subject other than the patient” includes a cell collected from a patient or a subject other than the patient and then proliferated, and “a genetically modified cell” includes a cell that is proliferated from a cell obtained by genetic modification. When genetic modification is carried out, a cell may be prolifelated until the amount required for the genetic modification is obtained. Also, after genetic modification, the cell may be prolifelated until the amount required for treatment is obtained.
[0029] Keratinocytes and skin fibroblasts may be obtained by any method known in the art. For example, the epidermis and the dermis are separated by enzymatic treatment and/or mechanical treatment of the skin biopsy tissue, and each of the epidermis and the dermis thus separated is further subjected to enzymatic treatment. Keratinocytes can be obtained from the epidermis sample and skin fibroblasts can be obtained from the dermis sample.
[0030] In an embodiment, the cell is a mesenchymal stem cell. When administered to a patient, mesenchymal stem cells are considered to reside in a patient tissue longer than keratinocytes and skin fibroblasts. Also, while inflammatory reactions are expected when a genetically modified cell produces a protein that has not been produced in the patient so far, mesenchymal stem cells have an anti-inflammatory effect and thus would more advantageous than keratinocytes and skin fibroblasts.
[0031] A mesenchymal stem cell (also referred to herein as MSC) has adhesiveness to a solid phase (eg, a plastic culture vessel), and has both the self-renewal ability and the differentiation ability into mesenchymal tissues (such as bone, cartilage, fat, and muscle). In an embodiment, the mesenchymal stem cell is a cell capable of differentiating into at least one of an osteoblast, chondrocyte and adipocyte. In an embodiment, the mesenchymal stem cell is a cell capable of differentiating into an osteoblast, chondrocyte and adipocyte. When a cell population has the above-mentioned abilities, it is understood to include a mesenchymal stem cell. Mesenchymal stem cells can be obtained from bone marrow or other tissues (for example, blood, such as umbilical cord blood and peripheral blood, as well as skin, fat, and dental pulp). In an embodiment, the mesenchymal stem cell is a bone marrow-derived mesenchymal stem cell (also referred to herein as BM-MSC). The bone marrow-derived mesenchymal stem cell can be obtained from any site such as femur, vertebra, sternum, ilium, and tibia.
[0032] Mesenchymal stem cells may be obtained by any method known in the art. For example, methods based on adhesiveness, cell surface markers, and density difference can be mentioned. For example, cells obtained from bone marrow or other tissues containing mesenchymal stem cells are seeded on a plastic or glass culture vessel, and cells that adhere to the culture vessel and proliferate are collected. Alternatively, mesenchymal stem cells can also be obtained by cell sorting (such as FACS, MACS) using an antibody against a surface marker of mesenchymal stem cells. The surface marker of human mesenchymal stem cells may be one or more of the followings: PDGFRα positive, PDGFRβ positive, Lin negative, CD45 negative, CD44 positive, CD90 positive, CD29 positive, Flk-1 negative, CD105 positive, CD73 positive, CD90 positive, CD71 positive, Stro-1 positive, CD106 positive, CD166 positive, CD31 negative, CD271 positive, and CD11b negative.
[0033] iPS cells may be produced by any method known in the art. For example, iPS cells can be produced by introducing three types of transcription factors, OCT4, SOX2, and NANOG into somatic cells such as fibroblasts obtained from a patient or a subject other than the patient (Budniatzky and Gepstein, Stem Cells Transl Med. 3(4):448-57, 2014; Barrett et al, Stem Cells Trans Med 3: 1-6 sctm.2014-0121, 2014; Focosi et al., Blood Cancer Journal 4: e211, 2014).
[0034] As used herein, the term “cell” can mean a single cell or multiple cells, depending on the context. Further, the cell may be a cell population composed of one type of cell or a cell population including a plurality of types of cells.
[0035] As used herein, the term “COL7A1 gene” means a nucleic acid sequence encoding type VII collagen, and is used to include cDNA as well as a sequence containing one or more introns (for example, a genomic sequence or a minigene). The representative nucleic acid sequence of the human COL7A1 gene (cDNA) is shown in SEQ ID NO: 1, and the representative amino acid sequence of human type VII collagen is shown in SEQ ID NO: 2. The cDNA sequence of the COL7A1 gene is disclosed in GenBank: NM_000094.3, and the genome sequence is disclosed in GenBank: AC121252.4. The sequence of a COL7A1 gene is not limited to any specific sequence as long as it encodes a functional type VII collagen (ie, a type VII collagen capable of forming anchoring fibrils).
TABLE-US-00001 cDNA sequence of human COL7A1 gene (8835 bp) (SEQ ID NO: 1) ATGACGCTGCGGCTTCTGGTGGCCGCGCTCTGCGCCGGGATCCTGGCAG AGGCGCCCCGAGTGCGAGCCCAGCACAGGGAGAGAGTGACCTGCACGCG CCTTTACGCCGCTGACATTGTGTTCTTACTGGATGGCTCCTCATCCATT GGCCGCAGCAATTTCCGCGAGGTCCGCAGCTTTCTCGAAGGGCTGGTGC TGCCTTTCTCTGGAGCAGCCAGTGCACAGGGTGTGCGCTTTGCCACAGT GCAGTACAGCGATGATCCACGGACAGAGTTCGGCCTGGATGCACTTGGC TCTGGGGGTGATGTGATCCGCGCCATCCGTGAGCTTAGCTACAAGGGGG GCAACACTCGCACAGGGGCTGCAATTCTCCATGTGGCTGACCATGTCTT CCTGCCCCAGCTGGCCCGACCTGGTGTCCCCAAGGTCTGCATCCTGATC ACAGACGGGAAGTCCCAGGACCTGGTGGACACAGCTGCCCAAAGGCTGA AGGGGCAGGGGGTCAAGCTATTTGCTGTGGGGATCAAGAATGCTGACCC TGAGGAGCTGAAGCGAGTTGCCTCACAGCCCACCAGTGACTTCTTCTTC TTCGTCAATGACTTCAGCATCTTGAGGACACTACTGCCCCTCGTTTCCC GGAGAGTGTGCACGACTGCTGGTGGCGTGCCTGTGACCCGACCTCCGGA TGACTCGACCTCTGCTCCACGAGACCTGGTGCTGTCTGAGCCAAGCAGC CAATCCTTGAGAGTACAGTGGACAGCGGCCAGTGGCCCTGTGACTGGCT ACAAGGTCCAGTACACTCCTCTGACGGGGCTGGGACAGCCACTGCCGAG TGAGCGGCAGGAGGTGAACGTCCCAGCTGGTGAGACCAGTGTGCGGCTG CGGGGTCTCCGGCCACTGACCGAGTACCAAGTGACTGTGATTGCCCTCT ACGCCAACAGCATCGGGGAGGCTGTGAGCGGGACAGCTCGGACCACTGC CCTAGAAGGGCCGGAACTGACCATCCAGAATACCACAGCCCACAGCCTC CTGGTGGCCTGGCGGAGTGTGCCAGGTGCCACTGGCTACCGTGTGACAT GGCGGGTCCTCAGTGGTGGGCCCACACAGCAGCAGGAGCTGGGCCCTGG GCAGGGTTCAGTGTTGCTGCGTGACTTGGAGCCTGGCACGGACTATGAG GTGACCGTGAGCACCCTATTTGGCCGCAGTGTGGGGCCCGCCACTTCCC TGATGGCTCGCACTGACGCTTCTGTTGAGCAGACCCTGCGCCCGGTCAT CCTGGGCCCCACATCCATCCTOCTTTCCTGGAACTTGGTGCCTGAGGCC CGTGGCTACCGGTTGGAATGGCGGCGTGAGACTGGCTTGGAGCCACCGC AGAAGGTGGTACTGCCCTCTGATGTGACCCGCTACCAGTTGGATGGGCT GCAGCCGGGCACTGAGTACCGCCTCACACTCTACACTCTGCTGGAGGGC CACGAGGTGGCCACCCCTGCAACCGTGGTTCCCACTGGACCAGAGCTGC CTGTGAGCCCTGTAACAGACCTGCAAGCCACCGAGCTGCCCGGGCAGCG GGTGCGAGTGTCCTGGAGCCCAGTCCCTGGTGCCACCCAGTACCGCATC ATTGTGCGCAGCACCCAGGGGGTTGAGCGGACCCTGGTGCTTCCTGGGA GTCAGACAGCATTCGACTTGGATGACGTTCAGGCTGGGCTTAGCTACAC TGTGCGGGTGTCTGCTCGAGTGGGTCCCCGTGAGGGCAGTGCCAGTGTC CTCACTGTCCGCCGGGAGCCGGAAACTCCACTTGCTGTTCCAGGGCTGC GGGTTGTGGTGTCAGATGCAACGCGAGTGAGGGTGGCCTGGGGACCCGT CCCTGGAGCCAGTGGATTTCGGATTAGCTGGAGCACAGGCAGTGGTCCG GAGTCCAGCCAGACACTGCCCCCAGACTCTACTGCCACAGACATCACAG GGCTGCAGCCTGGAACCACCTACCAGGTGGCTGTGTCGGTACTGCGAGG CAGAGAGGAGGGCCCTGCTGCAGTCATCGTGGCTCGAACGGACCCACTG GGCCCAGTGAGGACGGTCCATGTGACTCAGGCCAGCAGCTCATCTGTCA CCATTACCTGGACCAGGGTTCCTGGCGCCACAGGATACAGGGTTTCCTG GCACTCAGCCCACGGCCCAGAGAAATCCCAGTTGGTTTCTGGGGAGGCC ACGGTGGCTGAGCTGGATGGACTGGAGCCAGATACTGAGTATACGGTGC ATGTGAGGGCCCATGTGGCTGGCGTGGATGGGCCCCCTGCCTCTGTGGT TGTGAGGACTGCCCCTGAGCCTGTGGGTCGTGTGTCGAGGCTGCAGATC CTCAATGCTTCCAGCGACGTTCTACGGATCACCTGGGTAGGGGTCACTG GAGCCACAGCTTACAGACTGGCCTGGGGCCGGAGTGAAGGCGGCCCCAT GAGGCACCAGATACTCCCAGGAAACACAGACTCTGCAGAGATCCGGGGT CTCGAAGGTGGAGTCAGCTACTCAGTGCGAGTGACTGCACTTGTCGGGG ACCGCGAGGGCACACCTGTCTCCATTGTTGTCACTACGCCGCCTGAGGC TCCGCCAGCCCTGGGGACGCTTCACGTGGTGCAGCGCGGGGAGCACTCG CTGAGGCTGCGCTGGGAGCCGGTGCCCAGAGCGCAGGGCTTCCTTCTGC ACTGGCAACCTGAGGGTGGCCAGGAACAGTCCCGGGTCCTGGGGCCCGA GCTCAGCAGCTATCACCTGGACGGGCTGGAGCCAGCGACACAGTACCGC GTGAGGCTGAGTGTCCTAGGGCCAGCTGGAGAAGGGCCCTCTGCAGAGG TGACTGCGCGCACTGAGTCACCTCGTGTTCCAAGCATTGAACTACGTGT GGTGGACACCTCGATCGACTCGGTGACTTTGGCCTGGACTCCAGTGTCC AGGGCATCCAGCTACATCCTATCCTGGCGGCCACTCAGAGGCCCTGGCC AGGAAGTGCCTGGGTCCCCGCAGACACTTCCAGGGATCTCAAGCTCCCA GCGGGTGACAGGGCTAGAGCCTGGCGTCTCTTACATCTTCTCCCTGACG CCTGTCCTGGATGGTGTGCGGGGTCCTGAGGCATCTGTCACACAGACGC CAGTGTGCCCCCGTGGCCTGGCGGATGTGGTGTTCCTACCACATGCCAC TCAAGACAATGCTCACCGTGCGGAGGCTACGAGGAGGGTCCTGGAGCGT CTGGTGTTGGCACTTGGGCCTCTTGGGCCACAGGCAGTTCAGGTTGGCC TGCTGTGTTACAGTCATCGGCCCTCCCCACTGTTCCCACTGAATGGCTC CCATGACCTTGGCATTATCTTGCAAAGGATCCGTGACATGCCCTACATG GACCCAAGTGGGAACAACCTGGGCACAGCCGTGGTCACAGCTCACAGAT ACATGTTGGCACCAGATGCTCCTGGGCGCCGCCAGCACGTACCAGGGGT GATGGTTCTGCTAGTGGATGAACCCTTGAGAGGTGACATATTCAGCCCC ATCCGTGAGGCCCAGGCTTCTGGGCTTAATGTGGTGATGTTGGGAATGG CTGGAGCGGACCCAGAGCAGCTGCGTCGCTTGGCGCCGGGTATGGACTC TGTCCAGACCTTCTTCGCCGTGGATGATGGGCCAAGCCTGGACCAGGCA GTCAGTGGTCTGGCCACAGCCCTGTGTCAGGCATCCTTCACTACTCAGC CCCGGCCAGAGCCCTGCCCAGTGTATTGTCCAAAGGGCCAGAAGGGGGA ACCTGGAGAGATGGGCCTGAGAGGACAAGTTGGGCCTCCTGGCGACCCT GGCCTCCCGGGCAGGACCGGTGCTCCCGGCCCCCAGGGGCCCCCTGGAA GTGCCACTGCCAAGGGCGAGAGGGGCTTCCCTGGAGCAGATGGGCGTCC AGGCAGCCCTGGCCGCGCCGGGAATCCTGGGACCCCTGGAGCCCCTGGC CTAAAGGGCTCTCCAGGGTTGCCTGGCCCTCGTGGGGACCCGGGAGAGC GAGGACCTCGAGGCCCAAAGGGGGAGCCGGGGGCTCCCGGACAAGTCAT CGGAGGTGAAGGACCTGGGCTTCCTGGGCGGAAAGGGGACCCTGGACCA TCGGGCCCCCCTGGACCTCGTGGACCACTGGGGGACCCAGGACCCCGTG GCCCCCCAGGGCTTCCTGGAACAGCCATGAAGGGTGACAAAGGCGATCG TGGGGAGCGGGGTCCCCCTGGACCAGGTGAAGGTGGCATTGCTCCTGGG GAGCCTGGGCTGCCGGGTCTTCCCGGAAGCCCTGGACCCCAAGGCCCCG TTGGCCCCCCTGGAAAGAAAGGAGAAAAAGGTGACTCTGAGGATGGAGC TCCAGGCCTCCCAGGACAACCTGGGTCTCCGGGTGAGCAGGGCCCACGG GGACCTCCTGGAGCTATTGGCCCCAAAGGTGACCGGGGCTTTCCAGGGC CCCTGGGTGAGGCTGGAGAGAAGGGCGAACGTGGACCCCCAGGCCCAGC GGGATCCCGGGGGCTGCCAGGGGTTGCTGGACGTCCTGGAGCCAAGGGT CCTGAAGGGCCACCAGGACCCACTGGCCGCCAAGGAGAGAAGGGGGAGC CTGGTCGCCCTGGGGACCCTGCAGTGGTGGGACCTGCTGTTGCTGGACC CAAAGGAGAAAAGGGAGATGTGGGGCCCGCTGGGCCCAGAGGAGCTACC GGAGTCCAAGGGGAACGGGGCCCACCCGGCTTGGTTCTTCCTGGAGACC CTGGCCCCAAGGGAGACCCTGGAGACCGGGGTCCCATTGGCCTTACTGG CAGAGCAGGACCCCCAGGTGACTCAGGGCCTCCTGGAGAGAAGGGAGAC CCTGGGCGGCCTGGCCCCCCAGGACCTGTTGGCCCCCGAGGACGAGATG GTGAAGTTGGAGAGAAAGGTGACGAGGGTCCTCCGGGTGACCCGGGTTT GCCTGGAAAAGCAGGCGAGCGTGGCCTTCGGGGGGCACCTGGAGTTCGG GGGCCTGTGGGTGAAAAGGGAGACCAGGGAGATCCTGGAGAGGATGGAC GAAATGGCAGCCCTGGATCATCTGGACCCAAGGGTGACCGTGGGGAGCC GGGTCCCCCAGGACCCCCGGGACGGCTGGTAGACACAGGACCTGGAGCC AGAGAGAAGGGAGAGCCTGGGGACCGCGGACAAGAGGGTCCTCGAGGGC CCAAGGGTGATCCTGGCCTCCCTGGAGCCCCTGGGGAAAGGGGCATTGA AGGGTTTCGGGGACCCCCAGGCCCACAGGGGGACCCAGGTGTCCGAGGC CCAGCAGGAGAAAAGGGTGACCGGGGTCCCCCTGGGCTGGATGGCCGGA GCGGACTGGATGGGAAACCAGGAGCCGCTGGGCCCTCTGGGCCGAATGG TGCTGCAGGCAAAGCTGGGGACCCAGGGAGAGACGGGCTTCCAGGCCTC CGTGGAGAACAGGGCCTCCCTGGCCCCTCTGGTCCCCCTGGATTACCGG GAAAGCCAGGCGAGGATGGCAAACCTGGCCTGAATGGAAAAAACGGAGA ACCTGGGGACCCTGGAGAAGACGGGAGGAAGGGAGAGAAAGGAGATTCA GGCGCCTCTGGGAGAGAAGGTCGTGATGGCCCCAAGGGTGAGCGTGGAG CTCCTGGTATCCTTGGACCCCAGGGGCCTCCAGGCCTCCCAGGGCCAGT GGGCCCTCCTGGCCAGGGTTTTCCTGGTGTCCCAGGAGGCACGGGCCCC AAGGGTGACCGTGGGGAGACTGGATCCAAAGGGGAGCAGGGCCTCCCTG GAGAGCGTGGCCTGCGAGGAGAGCCTGGAAGTGTGCCGAATGTGGATCG GTTGCTGGAAACTGCTGGCATCAAGGCATCTGCCCTGCGGGAGATCGTG GAGACCTGGGATGAGAGCTCTGGTAGCTTCCTGCCTGTGCCCGAACGGC GTCGAGGCCCCAAGGGGGACTCAGGCGAACAGGGCCCCCCAGGCAAGGA GGGCCCCATCGGCTTTCCTGGAGAACGCGGGCTGAAGGGCGACCGTGGA GACCCTGGCCCTCAGGGGCCACCTGGTCTGGCCCTTGGGGAGAGGGGCC CCCCCGGGCCTTCCGGCCTTGCCGGGGAGCCTGGAAAGCCTGGTATTCC CGGGCTCCCAGGCAGGGCTGGGGGTGTGGGAGAGGCAGGAAGGCCAGGA GAGAGGGGAGAACGGGGAGAGAAAGGAGAACGTGGAGAACAGGGCAGAG ATGGCCCTCCTGGACTCCCTGGAACCCCTGGGCCCCCCGGACCCCCTGG CCCCAAGGTGTCTGTGGATGAGCCAGGTCCTGGACTCTCTGGAGAACAG GGACCCCCTGGACTCAAGGGTGCTAAGGGGGAGCCGGGCAGCAATGGTG ACCAAGGTCCCAAAGGAGACAGGGGTGTGCCAGGCATCAAAGGAGACCG GGGAGAGCCTGGACCGAGGGGTCAGGACGGCAACCCGGGTCTACCAGGA GAGCGTGGTATGGCTGGGCCTGAAGGGAAGCCGGGTCTGCAGGGTCCAA GAGGCCCCCCTGGCCCAGTGGGTGGTCATGGAGACCCTGGACCACCTGG TGCCCCGGGTCTTGCTGGCCCTGCAGGACCCCAAGGACCTTCTGGCCTG AAGGGGGAGCCTGGAGAGACAGGACCTCCAGGACGGGGCCTGACTGGAC CTACTGGAGCTGTGGGACTTCCTGGACCCCCCGGCCCTTCAGGCCTTGT GGGTCCACAGGGGTCTCCAGGTTTGCCTGGACAAGTGGGGGAGACAGGG AAGCCGGGAGCCCCAGGTCGAGATGGTGCCAGTGGAAAAGATGGAGACA GAGGGAGCCCTGGTGTGCCAGGGTCACCAGGTCTGCCTGGCCCTGTCGG ACCTAAAGGAGAACCTGGCCCCACGGGGGCCCCTGGACAGGCTGTGGTC GGGCTCCCTGGAGCAAAGGGAGAGAAGGGAGCCCCTGGAGGCCTTGCTG GAGACCTGGTGGGTGAGCCGGGAGCCAAAGGTGACCGAGGACTGCCAGG GCCGCGAGGCGAGAAGGGTGAAGCTGGCCGTGCAGGGGAGCCCGGAGAC CCTGGGGAAGATGGTCAGAAAGGGGCTCCAGGACCCAAAGGTTTCAAGG GTGACCCAGGAGTCGGGGTCCCGGGCTCCCCTGGGCCTCCTGGCCCTCC AGGTGTGAAGGGAGATCTGGGCCTCCCTGGCCTGCCCGGTGCTCCTGGT GTTGTTGGGTTCCCGGGTCAGACAGGCCCTCGAGGAGAGATGGGTCAGC CAGGCCCTAGTGGAGAGCGGGGTCTGGCAGGCCCCCCAGGGAGAGAAGG AATCCCAGGACCCCTGGGGCCACCTGGACCACCGGGGTCAGTGGGACCA CCTGGGGCCTCTGGACTCAAAGGAGACAAGGGAGACCCTGGAGTAGGGC TGCCTGGGCCCCGAGGCGAGCGTGGGGAGCCAGGCATCCGGGGTGAAGA TGGCCGCCCCGGCCAGGAGGGACCCCGAGGACTCACGGGGCCCCCTGGC AGCAGGGGAGAGCGTGGGGAGAAGGGTGATGTTGGGAGTGCAGGACTAA AGGGTGACAAGGGAGACTCAGCTGTGATCCTGGGGCCTCCAGGCCCACG GGGTGCCAAGGGGGACATGGGTGAACGAGGGCCTCGGGGCTTGGATGGT GACAAAGGACCTCGGGGAGACAATGGGGACCCTGGTGACAAGGGCAGCA AGGGAGAGCCTGGTGACAAGGGCTCAGCCGGGTTGCCAGGACTGCGTGG ACTCCTGGGACCCCAGGGTCAACCTGGTGCAGCAGGGATCCCTGGTGAC CCGGGATCCCCAGGAAAGGATGGAGTGCCTGGTATCCGAGGAGAAAAAG GAGATGTTGGCTTCATGGGTCCCCGGGGCCTCAAGGGTGAACGGGGAGT GAAGGGAGCCTGTGGCCTTGATGGAGAGAAGGGAGACAAGGGAGAAGCT GGTCCCCCAGGCCGCCCCGGGCTGGCAGGACACAAAGGAGAGATGGGGG AGCCTGGTGTGCCGGGCCAGTCGGGGGCCCCTGGCAAGGAGGGCCTGAT CGGTCCCAAGGGTGACCGAGGCTTTGACGGGCAGCCAGGCCCCAAGGGT GACCAGGGCGAGAAAGGGGAGCGGGGAACCCCAGGAATTGGGGGCTTCC CAGGCCCCAGTGGAAATGATGGCTCTGCTGGTCCCCCAGGGCCACCTGG CAGTGTTGGTCCCAGAGGCCCCGAAGGACTTCAGGGCCAGAAGGGTGAG CGAGGTCCCCCCGGAGAGAGAGTGGTGGGGGCTCCTGGGGTCCCTGGAG CTCCTGGCGAGAGAGGGGAGCAGGGGCGGCCAGGGCCTGCCGGTCCTCG AGGCGAGAAGGGAGAAGCTGCACTGACGGAGGATGACATCCGGGGCTTT GTGCGCCAAGAGATGAGTCAGCACTGTGCCTGCCAGGGCCAGTTCATCG CATCTGGATCACGACCCCTCCCTAGTTATGCTGCAGACACTGCCGGCTC CCAGCTCCATGCTGTGCCTGTGCTCCGCGTCTCTCATGCAGAGGAGGAA GAGCGGGTACCCCCTGAGGATGATGAGTACTCTGAATACTCCGAGTATT CTGTGGAGGAGTACCAGGACCCTGAAGCTCCTTGGGATAGTGATGACCC CTGTTCCCTGCCACTGGATGAGGGCTCCTGCACTGCCTACACCCTGCGC TGGTACCATCGGGCTGTGACAGGCAGCACAGAGGCCTGTCACCCTTTTG TCTATGGTGGCTGTGGAGGGAATGCCAACCGTTTTGGGACCCGTGAGGC CTGCGAGCGCCGCTGCCCACCCCGGGTGGTCCAGAGCCAGGGGACAGGT ACTGCCCAGGACTGA Amino acid sequence of human type VII collagen (2944 AA) (SEQ ID NO: 2) MTLRLLVAALCAGILAEAPRVRAQHRERVTCTRLYAADIVFLLDGSSSI GRSNFREVRSFLEGLVLPFSGAASAQGVRFATVQYSDDPRTEFGLDALG SGGDVIRAIRELSYKGGNTRTGAAILHVADHVFLPQLARPGVPKVCILI TDGKSQDLVDTAAQRLKGQGVKLFAVGIKNADPEELKRVASQPTSDFFF FVNDFSILRTLLPLVSRRVCTTAGGVPVTRPPDDSTSAPRDLVLSEPSS QSLRVQWTAASGPVTGYKVQYTPLTGLGQPLPSERQEVNVPAGETSVRL RGLRPLTEYQVTVIALYANSIGEAVSGTARTTALEGPELTIQNTTAHSL LVAWRSVPGATGYRVTWRVLSGGPTQQQELGPGQGSVLLRDLEPGTDYE VTVSTLFGRSVGPATSLMARTDASVEQTLRPVILGPTSILLSWNLVPEA RGYRLEWRRETGLEPPQKVVLPSDVTRYQLDGLQPGTEYRLTLYTLLEG HEVATPATVVPTGPELPVSPVTDLQATELPGQRVRVSWSPVPGATQYRI IVRSTQGVERTLVLPGSQTAFDLDDVQAGLSYTVRVSARVGPREGSASV LTVRREPETPLAVPGLRVVVSDATRVRVAWGPVPGASGFRISWSTGSGP ESSQTLPPDSTATDITGLQPGTTYQVAVSVLRGREEGPAAVIVARTDPL GPVRTVHVTQASSSSVTITWTRVPGATGYRVSWHSAHGPEKSQLVSGEA TVAELDGLEPDTEYTVHVRAHVAGVDGPPASVVVRTAPEPVGRVSRLQI LNASSDVLRITWVGVTGATAYRLAWGRSEGGPMRHQILPGNTDSAEIRG LEGGVSYSVRVTALVGDREGTPVSIVVTTPPEAPPALGTLHVVQRGEHS LRLRWEPVPRAQGFLLHWQPEGGQEQSRVLGPELSSYHLDGLEPATQYR VRLSVLGPAGEGPSAEVTARTESPRVPSIELRVVDTSIDSVTLAWTPVS RASSYILSWRPLRGPGQEVPGSPQTLPGISSSQRVTGLEPGVSYIFSLT PVLDGVRGPEASVTQTPVCPRGLADVVFLPHATQDNAHRAEATRRVLER LVLALGPLGPQAVQVGLLSYSHRPSPLFPLNGSHDLGIILQRIRDMPYM DPSGNNLGTAVVTAHRYMLAPDAPGRRQHVPGVMVLLVDEPLRGDIFSP IREAQASGLNVVMLGMAGADPEQLRRLAPGMDSVQTFFAVDDGPSLDQA VSGLATALCQASFTTQPRPEPCPVYCPKGQKGEPGEMGLRGQVGPPGDP GLPGRTGAPGPQGPPGSATAKGERGFPGADGRPGSPGRAGNPGTPGAPG LKGSPGLPGPRGDPGERGPRGPKGEPGAPGQVIGGEGPGLPGRKGDPGP SGPPGPRGPLGDPGPRGPPGLPGTAMKGDKGDRGERGPPGPGEGGIAPG EPGLPGLPGSPGPQGPVGPPGKKGEKGDSEDGAPGLPGQPGSPGEQGPR GPPGAIGPKGDRGFPGPLGEAGEKGERGPPGPAGSRGLPGVAGRPGAKG PEGPPGPTGRQGEKGEPGRPGDPAVVGPAVAGPKGEKGDVGPAGPRGAT GVQGERGPPGLVLPGDPGPKGDPGDRGPIGLTGRAGPPGDSGPPGEKGD PGRPGPPGPVGPRGRDGEVGEKGDEGPPGDPGLPGKAGERGLRGAPGVR GPVGEKGDQGDPGEDGRNGSPGSSGPKGDRGEPGPPGPPGRLVDTGPGA REKGEPGDRGQEGPRGPKGDPGLPGAPGERGIEGFRGPPGPQGDPGVRG PAGEKGDRGPPGLDGRSGLDGKPGAAGPSGPNGAAGKAGDPGRDGLPGL RGEQGLPGPSGPPGLPGKPGEDGKPGLNGKNGEPGDPGEDGRKGEKGDS GASGREGRDGPKGERGAPGILGPQGPPGLPGPVGPPGQGFPGVPGGTGP KGDRGETGSKGEQGLPGERGLRGEPGSVPNVDRLLETAGIKASALREIV ETWDESSGSFLPVPERRRGPKGDSGEQGPPGKEGPIGFPGERGLKGDRG DPGPQGPPGLALGERGPPGPSGLAGEPGKPGIPGLPGRAGGVGEAGRPG ERGERGEKGERGEQGRDGPPGLPGTPGPPGPPGPKVSVDEPGPGLSGEQ GPPGLKGAKGEPGSNGDQGPKGDRGVPGIKGDRGEPGPRGQDGNPGLPG ERGMAGPEGKPGLQGPRGPPGPVGGHGDPGPPGAPGLAGPAGPQGPSGL KGEPGETGPPGRGLTGPTGAVGLPGPPGPSGLVGPQGSPGLPGQVGETG KPGAPGRDGASGKDGDRGSPGVPGSPGLPGPVGPKGEPGPTGAPGQAVV GLPGAKGEKGAPGGLAGDLVGEPGAKGDRGLPGPRGEKGEAGRAGEPGD PGEDGQKGAPGPKGFKGDPGVGVPGSPGPPGPPGVKGDLGLPGLPGAPG VVGFPGQTGPRGEMGQPGPSGERGLAGPPGREGIPGPLGPPGPPGSVGP PGASGLKGDKGDPGVGLPGPRGERGEPGIRGEDGRPGQEGPRGLTGPPG SRGERGEKGDVGSAGLKGDKGDSAVILGPPGPRGAKGDMGERGPRGLDG DKGPRGDNGDPGDKGSKGEPGDKGSAGLPGLRGLLGPQGQPGAAGIPGD PGSPGKDGVPGIRGEKGDVGFMGPRGLKGERGVKGACGLDGEKGDKGEA GPPGRPGLAGHKGEMGEPGVPGQSGAPGKEGLIGPKGDRGFDGQPGPKG DQGEKGERGTPGIGGFPGPSGNDGSAGPPGPPGSVGPRGPEGLQGQKGE RGPPGERVVGAPGVPGAPGERGEQGRPGPAGPRGEKGEAALTEDDIRGF VRQEMSQHCACQGQFIASGSRPLPSYAADTAGSQLHAVPVLRVSHAEEE ERVPPEDDEYSEYSEYSVEEYQDPEAPWDSDDPCSLPLDEGSCTAYTLR WYHRAVTGSTEACHPFVYGGCGGNANRFGTREACERRCPPRVVQSQGTG TAQD*
[0036] In an embodiment, the COL7A1 gene comprises or consists of a nucleic acid sequence having 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% or more sequence identity with the nucleic acid sequence of SEQ ID NO: 1. In a different embodiment, the COL7A1 gene comprises or consists of a nucleic acid sequence wherein 0 to 30, 0 to 20, 0 to 10, 0 to 5, 0 to 3, 0 to 2 or 0 to 1 base(s) is deleted, substituted, or added with respect to the nucleic acid sequence of SEQ ID NO: 1. In a further embodiment, the COL7A1 gene comprises or consists of the nucleic acid sequence of SEQ ID NO: 1.
[0037] In an embodiment, the type VII collagen comprises or consists of an amino acid sequence having 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% or more sequence identity with the amino acid sequence of SEQ ID NO: 2. In a different embodiment, the type VII collagen comprises or consists of an amino acid sequence wherein 0 to 30, 0 to 20, 0 to 10, 0 to 5, 0 to 3, 0 to 2 or 0 to 1 amino acid residue(s) is deleted, substituted, or added with respect to the amino acid sequence of SEQ ID NO: 2. In a further embodiment, the type VII collagen comprises or consists of the amino acid sequence of SEQ ID NO: 2.
[0038] In an embodiment, the COL7A1 gene comprises or consists of a nucleic acid sequence that encodes an amino acid sequence having 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% or more sequence identity with the amino acid sequence of SEQ ID NO: 2. In a different embodiment, the COL7A1 gene comprises or consists of a nucleic acid sequence that encodes an amino acid sequence wherein 0 to 30, 0 to 20, 0 to 10, 0 to 5, 0 to 3, 0 to 2 or 0 to 1 amino acid residue(s) is deleted, substituted, or added with respect to the amino acid sequence of SEQ ID NO: 2.
[0039] As used herein, the term “sequence identity” with respect to a nucleic acid sequence or an amino acid sequence means the proportion of bases or amino acid residues that match between two sequences that are optimally aligned (aligned to be maximally matched) over the entire region of the sequence to be compared. The sequence to be compared may have an addition or a deletion (eg, a gap) in the optimal alignment of the two sequences. The sequence identity can be calculated using a program such as FASTA, BLAST, or CLUSTAL W provided in a public database (for example, DDBJ (http://www.ddbj.nig.ac.jp)). Alternatively, the sequence identity can be obtained using a commercially available sequence analysis software (for example, Vector NTI® software, GENETYX® ver. 12).
[0040] The cell may be genetically modified by any method. In an embodiment, the cell is genetically modified by genome editing such as the CRISPR system (eg, CRISPR/Cas9, CRISPR/Cpf1), TALEN, or ZFN. In a different embodiment, the cell is genetically modified by a viral vector such as a retroviral vector, lentiviral vector, adenoviral vector, or adeno-associated viral vector. In a further embodiment, the cell is genetically modified by CRISPR/Cas9. In a further embodiment, the cell is genetically modified by a retroviral vector or a lentiviral vector.
[0041] In genome editing, causing cleavage in the genome and introducing a donor vector comprising a sequence of interest into the cell can insert the sequence of interest into the cleavage site of the genome. The sequence to be inserted into the genome can be a COL7A1 gene or a sequence to be replaced with a portion containing a mutation in the COL7A1 gene (for example, a partial sequence of a COL7A1 gene). In addition to the sequence of interest, the donor vector may comprise a regulatory sequence such as a promoter or enhancer that controls the expression of the sequence of interest, or other elements such as a drug resistance gene for cell selection, and also may comprise, at both ends, sequences homogeneous to both ends of the insertion site of the genome. The donor vector can be introduced into a desired site as a result of non-homologous end binding or homologous recombination. As the donor vector, a plasmid, an adeno-associated viral vector, an integrase-deficient lentiviral vector, or any of other viral vectors can be used.
[0042] In the CRISPR system, an endonuclease such as Cas9 or Cas12 (eg, Cas12a (also called Cpf1), Cas12b, Cas12e) recognizes a specific base sequence, called PAM sequence, and the double strand of the target DNA is cleaved by the action of the endonuclease. When the endonuclease is Cas9, it cleaves about 3-4 bases upstream of the PAM sequence. Examples of endonucleases include Cas9 of S. pyogenes, S. aureus, N. meningitidis, S. thermophilus, or T. denticola, and Cpf1 of L. bacterium ND2006 or Acidaminococcus sp. BV3L6. The PAM sequence varies depending on the endonuclease, and the PAM sequence of Cas9 in S. pyogenes is NGG, for example. A gRNA comprises a sequence of about 20 bases upstream of the PAM sequence (target sequence) or a sequence complementary thereto on the 5′ end side, and plays a role of recruiting an endonuclease to the target sequence. The sequences other than the target sequence (or a sequence complementary thereto) of a gRNA can be appropriately determined by those skilled in the art depending on the endonuclease to be used. A gRNA may comprises a crRNA (CRISPR RNA), which comprises the target sequence or a sequence complementary thereto and is responsible for the sequence specificity of the gRNA, and a tracrRNA (Trans-activating crRNA), which contributes to the formation of a complex with Cas9 by forming a double strand. The crRNA and tracrRNA may exist as separate molecules. When the endonuclease is Cpf1, the crRNA alone functions as a gRNA. In the present specification, a gRNA comprising elements necessary for the function as a gRNA on a single strand may be particularly referred to as a sgRNA. The gRNA sequence can be determined by a tool available for target sequence selection and gRNA design, such as CRISPRdirect (https://crispr.dbcls.jp/).
[0043] A vector comprising a nucleic acid sequence encoding a gRNA and a nucleic acid sequence encoding an endonuclease may be introduced into and expressed in a cell, or a gRNA and an endonuclease protein that have been prepared extracellularly may be introduced into a cell. The endonuclease may include a nuclear localization signal. The nucleic acid sequence encoding a gRNA and the nucleic acid sequence encoding an endonuclease may be present on different vectors. Methods for introducing the vector, gRNA, and endonuclease into a cell include, but are not limited to, lipofection, electroporation, microinjection, calcium phosphate method, and DEAE-dextran method.
[0044] The present disclosure provides a gRNA and a vector comprising a nucleic acid sequence encoding a gRNA that can be used for the introduction of a COL7A1 gene into the genome. In an embodiment, the gRNA comprises any of the sequences of SEQ ID NOs: 3-5 or a sequence complementary thereto.
[0045] In the case of viral vectors, a COL7A1 gene can be introduced into the genome of a cell when a retroviral vector or a lentiviral vector having integrase activity is used. Alternatively, an integrase-deficient retroviral or lentiviral vector may be used. Integrase-deficient vectors lack integrase activity, for example, due to a mutation in the integrase gene. When an integrase-deficient vector, or an adenoviral vector or an adeno-associated viral vector is used, the sequence incorporated into the vector is not usually introduced into the genome of a cell. For example, when a COL7A1 gene is incorporated into an integrase-deficient lentiviral vector or an adenoviral vector, type VII collagen is expressed from the COL7A1 gene of the vector existing in the cell (in the nucleus).
[0046] A viral vector comprises a sequence encoding a COL7A1 gene and may contain a regulatory sequence such as a promoter or enhancer that controls the expression of the COL7A1 gene and other elements such as a drug resistance gene for cell selection. A viral vector may be prepared by any method known in the art. For example, a retroviral or lentiviral vector can be prepared by introducing a viral vector plasmid comprising LTR sequences at both ends (5′ LTR and 3′ LTR), a packaging signal, and a sequence of interest into a packaging cell with one or more plasmid vectors expressing structural proteins of the virus, such as Gag, Pol, and Env, or into a packaging cell that expresses such structural proteins. Examples of packaging cells include, but are not limited to, 293T cells, 293 cells, HeLa cells, COS1 cells, and COS7 cells. The viral vector may be pseudotyped and may express an envelope protein such as the vesicular stomatitis virus G protein (VSV-G). The sequence of interest can be introduced into a target cell by infecting the target cell with a viral vector thus prepared.
[0047] In an embodiment, the viral vector is a lentiviral vector. Examples of lentiviral vectors include, but are not limited to, HIV (human immunodeficiency virus) (for example, HIV-1 and HIV-2), SIV (simian immunodeficiency virus), FIV (feline immunodeficiency virus), MVV (Maedi-Visna virus), EV1 (Maedi-Visna-like virus), EIAV (equine infectious anemia virus), and CAEV (caprine arthritis encephalitis virus). In an embodiment, the lentiviral vector is HIV.
[0048] As an example, a lentiviral vector can be prepared as follows. First, a viral vector plasmid encoding the viral genome, one or more plasmid vectors expressing Gag, Pol, and Rev (and optionally Tat), and one or more plasmid vectors expressing envelope proteins such as VSV-G are introduced into a packaging cell. The viral vector plasmid comprises LTR sequences at both ends (5′ LTR and 3′ LTR), a packaging signal, and a COL7A1 gene and a promoter that controls its expression (eg, CMV promoter, EF1α promoter, or hCEF promoter). The 5′ LTR functions as a promoter that induces transcription of the viral RNA genome, but may be replaced with a different promoter, such as CMV promoter, to enhance the expression of the RNA genome. Within the cell, the viral RNA genome is transcribed from the vector plasmid and packaged to form a viral core. The viral core is transported to the cell membrane of the packaging cell, encapsulated in the cell membrane, and released as a viral particle from the packaging cell. The released virus particle can be recovered from the culture supernatant of the packaging cell. For example, the virus particle can be recovered by any of conventional purification methods such as centrifugation, filter filtration, and column purification. A lentiviral vector can also be prepared by using a kit such as Lentiviral High Titer Packaging Mix, Lenti-X™ Packaging Single Shots (Takara Bio Inc.), and ViraSafe™ Lentivirus Complete Expression System (Cell Biolabs Inc.). An adeno-associated viral vector can be prepared by using a kit such as AAVpro® Helper Free System (Takara Bio Inc.).
[0049] A cell into which a sequence of interest has been introduced can be detected by Southern blotting or PCR. The sequence of interest need only be introduced into at least one of the alleles.
[0050] In an embodiment of the composition of the present disclosure, the mesenchymal stem cell is the most abundant cell in the composition. In a further embodiment, the mesenchymal stem cell accounts for 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% or more of cells comprised in the composition. In a further embodiment, the composition of the present disclosure is substantially free of cells other than the mesenchymal stem cell. The expression “substantially free of cells other than the mesenchymal stem cell” means that the composition only comprises a cell obtained by a method that is usually understood by those skilled in the art to be a method for obtaining a mesenchymal stem cell.
[0051] The number of cells comprised in a composition is an amount required to exert a desired effect (also referred to herein as an effective amount), and it is appropriately determined by those skilled in the art in consideration of factors such as the age, body weight, and medical condition of the patient, the type of cells and method for genetic modification. The number of cells is not limited to, but can be, for example, 1 cell to 1×10.sup.7 cells, 1×10 cells to 1×10.sup.7 cells, 1×10.sup.2 cells to 1×10.sup.7 cells, 1×10.sup.3 cells to 1×10.sup.7 cells, 1×10.sup.4 cells to 1×10.sup.7 cells, 1×10.sup.5 cells to 1×10.sup.7 cells, 1×10.sup.5 cells to 5×10.sup.6 cells, 5×10.sup.5 cells to 1×10.sup.6 cells, or 1×10.sup.5 cells to 1×10.sup.6 cells. The composition may comprise a pharmaceutically acceptable carrier and/or an additive in addition to the cell. Examples of pharmaceutically acceptable carriers include water, medium, saline, infusion containing glucose, D-sorbitol, D-mannitol or others, and phosphate buffered saline (PBS). Examples of additives include solubilizers, stabilizers, and preservatives. The dosage form of the composition is not particularly limited to, but can be a parenteral preparation such as an injection. Examples of injections include solution injections, suspension injections, emulsion injections, and injections to be prepared before use. The composition may be frozen and may contain a cryoprotectant such as DMSO, glycerol, polyvinylpyrrolidone, polyethylene glycol, dextran, or sucrose.
[0052] The composition of the present disclosure can be administered systemically or topically. In an embodiment, the composition is administered to an affected area of a patient with dystrophic epidermolysis bullosa. As used herein, the affected area means a blister or an area in the vicinity of a blister. In a further embodiment, the composition is administered intradermally at the site of a blister or administered into a blister. In a further embodiment, the composition is administered into a blister. In the present specification, administration into a blister means administration to the space under the epidermis of a blister. The intrablister administration can reduce patient distress as compared to intradermal or subcutaneous administration, and type VII collagen can be well expressed near the basement membrane. The number of cells administered per site is an amount required to exert a desired effect (effective amount), and it is appropriately determined by those skilled in the art in consideration of factors such as the age, body weight, and medical condition of the patient, the type of cells, and method for genetic modification. The number of cells is not limited to, but can be for example, 1 cell to 1×10.sup.7 cells, 1×10 cells to 1×10.sup.7 cells, 1×10.sup.2 cells to 1×10.sup.7 cells, 1×10.sup.3 cells to 1×10.sup.7 cells, 1×10.sup.4 cells to 1×10.sup.7 cells, 1×10.sup.5 cells to 1×10.sup.7 cells, 1×10.sup.5 cells to 5×10.sup.6 cells, 5×10.sup.5 cells to 1×10.sup.6 cells, or 1×10.sup.5 cells to 1×10.sup.6 cells. In an embodiment, the number of cells to be administered per blister is 1 cell to 1×10.sup.7 cells, 1×10 cells to 1×10.sup.7 cells, 1×10.sup.2 cells to 1×10.sup.7 cells, 1×10.sup.3 cells to 1×10.sup.7 cells, 1×10.sup.4 cells to 1×10.sup.7 cells, 1×10.sup.5 cells to 1×10.sup.7 cells, 1×10.sup.5 cells to 5×10.sup.6 cells, 5×10.sup.5 cells to 1×10.sup.6 cells, or 1×10.sup.5 cells to 1×10.sup.6 cells. The amount to be administered per blister may be adjusted according to the size of a blister when the above amount is considered for a standard blister having a diameter of 7 to 8 mm when circularly approximated.
[0053] Exemplary embodiments of the present invention are described below.
[1] A composition for use in the treatment of dystrophic epidermolysis bullosa, comprising a cell obtained from a patient with dystrophic epidermolysis bullosa, wherein the cell is a mesenchymal stem cell and genetically modified to produce type VII collagen.
[2] The composition according to item 1, wherein the cell is genetically modified by introducing a COL7A1 gene.
[3] The composition according to item 2, wherein the COL7A1 gene is introduced into the genome of the cell.
[4] The composition according to item 2 or 3, wherein the COL7A1 gene comprises a nucleic acid sequence having 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% or more sequence identity with the nucleic acid sequence of SEQ ID NO: 1, or a nucleic acid sequence that encodes an amino acid sequence having 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% or more sequence identity with the amino acid sequence of SEQ ID NO: 2.
[5] The composition according to any one of items 1 to 4, wherein the mesenchymal stem cell is a bone marrow-derived mesenchymal stem cell.
[6] The composition according to any one of items 1 to 5, wherein the mesenchymal stem cell is the most abundant cell in the composition.
[7] The composition according to any one of items 1 to 6, wherein the mesenchymal stem cell accounts for 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% or more of cells comprised in the composition.
[8] The composition according to any one of items 1 to 7, wherein the composition does not substantially comprise cells other than the mesenchymal stem cell.
[9] The composition according to any one of items 1 to 8, which is to be administered to an affected area.
[10] The composition according to any one of items 1 to 9, which is to be administered into a blister.
[11] The composition according to any one of items 1 to 10, wherein the cell is genetically modified by genome editing.
[12] The composition according to item 11, wherein the genome editing is carried out by CRISPR/Cas9.
[13] The composition according to any one of items 1 to 10, wherein the cell is genetically modified by a viral vector.
[14] The composition according to item 13, wherein the viral vector is a retroviral vector or a lentiviral vector.
[15] The composition according to item 13 or 14, wherein the viral vector is a lentiviral vector.
[16] A composition for use in the treatment of dystrophic epidermolysis bullosa, comprising a cell that produces type VII collagen, wherein the composition is to be administered into a blister.
[17] The composition according to item 16, wherein the cell is a cell genetically modified to produce type VII collagen.
[18] The composition according to item 17, wherein the cell is genetically modified by introducing a COL7A1 gene.
[19] The composition according to item 18, wherein the COL7A1 gene is introduced into the genome of the cell.
[20] The composition according to item 18 or 19, wherein the COL7A1 gene comprises a nucleic acid sequence having 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% or more sequence identity with the nucleic acid sequence of SEQ ID NO: 1, or a nucleic acid sequence that encodes an amino acid sequence having 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% or more sequence identity with the amino acid sequence of SEQ ID NO: 2.
[21] The composition according to any one of items 17 to 20, wherein the cell is a cell obtained from a patient with dystrophic epidermolysis bullosa.
[22] The composition according to any one of items 16 to 21, wherein the cell is a cell obtained from bone marrow.
[23] The composition according to any one of items 16 to 22, wherein the cell is a mesenchymal stem cell.
[24] The composition according to item 23, wherein the mesenchymal stem cell is a bone marrow-derived mesenchymal stem cell.
[25] The composition according to item 23 or 24, wherein the mesenchymal stem cell is the most abundant cell in the composition.
[26] The composition according to any one of items 23 to 25, wherein the mesenchymal stem cell accounts for 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% or more of cells comprised in the composition.
[27] The composition according to any one of items 23 to 26, wherein the composition does not substantially comprise cells other than the mesenchymal stem cell.
[28] The composition according to any one of items 17 to 27, wherein the cell is genetically modified by genome editing.
[29] The composition according to item 28, wherein the genome editing is carried out by CRISPR/Cas9.
[30] The composition according to any one of items 17 to 27, wherein the cell is genetically modified by a viral vector.
[31] The composition according to item 30, wherein the viral vector is a retroviral vector or a lentiviral vector.
[32] The composition according to item 30 or 31, wherein the viral vector is a lentiviral vector.
[33] A method of producing a composition for use in the treatment of dystrophic epidermolysis bullosa, comprising genetically modifying a cell to produce type VII collagen, and,
preparing a composition comprising the genetically modified cell.
[34] A method of treating dystrophic epidermolysis bullosa, comprising administering to a patient of dystrophic epidermolysis bullosa a composition comprising a cell that produces type VII collagen.
[35] The method according to item 34, wherein the cell is genetically modified to produce type VII collagen.
[36] The method according to item 35, wherein the cell is genetically modified by introducing a COL7A1 gene.
[37] The method according to item 36, wherein the COL7A1 gene is introduced into the genome of the cell.
[38] The composition according to item 36 or 37, wherein the COL7A1 gene comprises a nucleic acid sequence having 70%, 80%, 85%, 90%, 96%, 96%, 97%, 98% or 99% or more sequence identity with the nucleic acid sequence of SEQ ID NO: 1, or a nucleic acid sequence that encodes an amino acid sequence having 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% or more sequence identity with the amino acid sequence of SEQ ID NO: 2.
[39] The method according to any one of items 35 to 38, wherein the cell is genetically modified by genome editing.
[40] The method according to item 39, wherein the genome editing is carried out by CRISPR/Cas9.
[41] The method according to any one of items 35 to 38, wherein the cell is genetically modified by a viral vector.
[42] The method according to item 41, wherein the viral vector is a retroviral vector or a lentiviral vector.
[43] The method according to item 41 or 42, wherein the viral vector is a lentiviral vector.
[44] The method according to any one of items 35 to 43, further comprising, prior to the administering to the patient, genetically modifying a cell to produce type VII collagen.
[45] The method according to item 33 or 44, comprising genetically modifying the cell by introducing a COL7A1 gene.
[46] The method according to item 45, comprising introducing the COL7A1 gene into the genome of the cell.
[47] The method according to item 45 or 46, wherein the COL7A1 gene comprises a nucleic acid sequence having 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% or more sequence identity with the nucleic acid sequence of SEQ ID NO: 1, or a nucleic acid sequence that encodes an amino acid sequence having 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% or more sequence identity with the amino acid sequence of SEQ ID NO: 2.
[48] The method according to any one of items 33 and 44 to 47, comprising genetically modifying the cell by genome editing.
[49] The method according to item 48, wherein the genome editing is carried out by CRISPR/Cas9.
[50] The method according to any one of items 33 and 44 to 47, comprising genetically modifying the cell with a viral vector.
[51] The method according to item 50, wherein the viral vector is a retroviral vector or a lentiviral vector.
[52] The method according to item 50 or 51, wherein the viral vector is a lentiviral vector.
[53] The method according to any one of items 33 to 52, wherein the cell is a cell obtained from a patient with dystrophic epidermolysis bullosa.
[54] The method according to any one of items 33 and 44 to 53, further comprising, prior to the genetically modifying, obtaining a cell from a patient with dystrophic epidermolysis bullosa.
[55] The method according to any one of items 33 to 54, wherein the cell is a cell obtained from bone marrow.
[56] The method according to any one of items 33 to 55, wherein the cell is a mesenchymal stem cell.
[57] The method according to item 56, wherein the mesenchymal stem cell is a bone marrow-derived mesenchymal stem cell.
[58] The method according to item 56 or 57, wherein the mesenchymal stem cell is the most abundant cell in the composition.
[59] The method according to any one of items 56 to 58, wherein the mesenchymal stem cell accounts for 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% or more of cells comprised in the composition.
[60] The method according to any one of items 56 to 59, wherein the composition does not substantially comprise cells other than the mesenchymal stem cell.
[61] The method according to any one of items 34 to 60, comprising administering the composition to an affected area.
[62] The method according to any one of items 34 to 61, comprising administering the composition into a blister.
[63] Use of a composition comprising a cell obtained from a patient with dystrophic epidermolysis bullosa for the manufacture of a medicament for treating dystrophic epidermolysis bullosa, wherein the cell comprises a mesenchymal stem cell and the cell is genetically modified to produce type VII collagen.
[64] Use of a composition comprising a cell that produces type VII collagen for the manufacture of a medicament for treating dystrophic epidermolysis bullosa, wherein the composition is to be administered into a blister.
[65] Use of a composition comprising a cell obtained from a patient with dystrophic epidermolysis bullosa for treating dystrophic epidermolysis bullosa, wherein the cell comprises a mesenchymal stem cell and the cell is genetically modified to produce type VII collagen.
[66] Use of a composition comprising a cell that produces type VII collagen for treating dystrophic epidermolysis bullosa, wherein the composition is to be administered into a blister.
[67] A gRNA comprising a sequence of any one of SEQ ID NOs: 3 to 5 or a sequence complementary thereto.
[68] A vector comprising a nucleic acid sequence encoding the gRNA of item 67.
[0054] The present invention is described in more detail with reference to the examples hereinafter, but not limited to the embodiments described below.
Examples
1. Design of Genome Editing
[0055] Three types of sgRNAs were prepared in order to select a site with good cleavage efficiency by the CRISPR-Cas9 system in the AAVS1 (Adeno-associated virus integration site 1) region in the human genome. The AAVS1 region is a safe region that is not easily affected by gene transfer (safe harbor). Since the CRISPR-Cas9 system recognized the base sequence of “NGG” and cleaved 3 bases upstream of the sequence, regions each having “GG” at the end were selected and sgRNAs each containing a sequence of 20 bases upstream of “NGG” were designed (sgAAVS1-#1 to #3) (
TABLE-US-00002 TABLE 1 sgRNA Target sequence SEQ ID NO. sgAAVS1-#1 ACCCCACAGTGGGGCCACTA 3 sgAAVS1-#2 GTCACCAATCCTGTCCCTAG 4 sgAAVS1-#3 GGGGCCACTAGGGACAGGAT 5
[0056] An oligonucleotide consisting of a sequence of any one of SEQ ID NOs: 3 to 5 was annealed with its complementary strand and cloned into the Bbs1 site of eSpCas9 (1.1) (Addgene plasmid #71814). This plasmid (2.5 μg) was introduced into HEK293 cells (human fetal kidney cell line) seeded in 6-well dishes by Lipofectamin 3000 (Thermo Fisher Scientific). Forty-eight hours after transfection, genomic DNA was extracted from the cells and the region containing the target site was amplified by PCR. The PCR amplified fragments were subjected to heat treatment to be a single chain, annealed by slow cooling, and then treated with a mismatch site-specific endonuclease. The resulting product was fractionated by electrophoresis, the degree of insertion or deletion mutation introduced by the genome cleavage was measured from the density of the band, and the genome editing efficiency was calculated by the following formula (In the formula, “a” indicates the concentration of the band that was not digested, and “b” and “c” indicate the concentrations of the cleaved bands.).
Indel (%)=100×√{square root over ((1−fcut))}),f.sub.cut=(b+c)/(a+b+c)
[0057] All sgRNAs of sgAAVS1-#1 to #3 produced a short DNA fragment different from the control, confirming that double-strand break occurred (
2. Introduction of COL7A1 Gene into BM-MSCs
[0058] For the introduction of a COL7A1 gene into the AAVS1 region, a plasmid expressing the COL7A1 gene under the control of the CAG promoter was designed (
[0059] Since the transfer efficiency increased but the cell viability decreased as the amount of plasmid increased with respect to the cells, first, the experimental conditions in which both the cell viability and the transfer efficiency were good were examined. To human bone marrow-derived mesenchymal stem cells (BM-MSCs) [PromoCell (Heidelberg, Germany) or Lonza (Basel, Switzerland)] (1×10.sup.5 cells), pAAVS-P-CAG-00L7A1 (0 μg, 0.25 μg, 0.5 μg or 1.0 μg) and eSpCas9 (1.1) expressing sgAAVS1-#3 (0 μg, 0.25 μg, 0.5 μg, or 1.0 μg) were introduced by electroporation. All cells were collected 24 hours after transfection, and the viability was calculated from the number of trypan blue staining-positive cells (dead cells) with respect to the total number of cells. In addition, 48 hours after transfection, BM-MSCs were cultured in a medium containing 0.5 μg/mL puromycin (Invivogen, San Diego, Calif., USA) for about 2 weeks for selection, and the number of isolated colonies was determined to measure the efficiency of genome editing. Based on the results shown in
[0060] To BM-MSCs (1×10.sup.5 cells), pAAVS-P-CAG-COL7A1 (0.25 μg) and eSpCas9 (1.1) expressing sgAAVS1-#3 (0.5 μg) were introduced by electroporation. Forty-eight hours after transfection, BM-MSCs were cultured in a medium containing 0.5 μg/mL puromycin (Invivogen, San Diego, Calif., USA) for about 2 weeks for selection. Genomic DNA was extracted from the BM-MSCs, and genome editing and introduction of the COL7A1 gene were confirmed by PCR.
[0061] The PCR product was obtained by amplification between F1-R1, confirming that genome editing had occurred (
[0062] Since collagen was a secretory protein and exuded to the outside of cells, expression of type VII collagen in BM-MSCs was observed by immunostaining with an anti-type VII collagen antibody (Sigma Aldrich, St. Louis, Mo., USA) and western blotting of the culture supernatant. As shown in
3. Expression of Type VII Collagen in Epidermolysis Bullosa Model Mice
[0063] Expression of type VII collagen in epidermolysis bullosa model mice that received genetically modified MSCs was examined. The full-thickness skin of a neonatal Col7A1 gene knockout mouse (Col7a1−/−) showing blistering was excised and transplanted to the back of an immunodeficient mouse (NOD-SCID). One week after transplantation, the genetically modified MSCs described in section 2 above were injected subcutaneously or intradermally with 0.1 to 1.0×10.sup.6 cells (
[0064] As shown in
[0065] Further, in the same manner as above, 2.0×10.sup.6 cells of the genetically modified MSCs described in section 2 above was injected into blisters. Four weeks after that, the transplanted skin was excised and observed with an electron microscope. Formation of anchoring fibrils was confirmed (