Antigen Delivery Vectors and Constructs

20220073446 · 2022-03-10

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates to fluorocarbon vectors for the delivery of antigens to immunoresponsive target cells. It further relates to fluorocarbon vector-antigen constructs and the use of such vectors associated with antigens as vaccines and immunotherapeutics in animals.

Claims

1-32. (canceled)

33. A method of inducing a cell-mediated response in a subject against an intracellular pathogen, the method comprising administering a multi-component pharmaceutical composition configured for intracellular delivery of T cell epitopes to the subject in need thereof, wherein the pharmaceutical composition comprises: two to about 20 different types of fluorocarbon peptide constructs, wherein each different type of fluorocarbon peptide construct comprises: a fluorocarbon chain from 3 to 30 carbon atoms, wherein one or more fluorine moieties is optionally substituted with chlorine, bromine or iodine or a methyl group; and, a peptide comprising one or more CD8.sup.+ T cell epitopes including at least two MHC class I or II epitopes, the peptide being coupled to the fluorocarbon vector via either an N-terminus or C-terminus of the peptide and the fluorocarbon vector; wherein the fluorocarbon peptide constructs are comprised within micelles, each different type of fluorocarbon peptide construct comprises a different peptide sequence, and the fluorocarbon chain enhances CD8.sup.+ T cell response against the peptide; and, one or more pharmaceutical acceptable carriers, excipients, diluents or adjuvants.

34. The method of claim 33 wherein the fluorocarbon peptide construct is according to structure ##STR00004## where Sp is an optional chemical spacer moiety and R is the peptide.

35. The method of claim 33 wherein the fluorocarbon peptide construct is according to structure ##STR00005## where Sp is an optional chemical spacer moiety and R is the peptide.

36. The method of claim 33 wherein the fluorocarbon peptide construct is according to structure ##STR00006## where Sp is an optional chemical spacer moiety and R is the peptide.

37. The method of claim 33 wherein the peptide comprises one or more immunogenic epitopes from a viral protein.

38. The method of claim 33 wherein the peptide comprises one or more immunogenic epitopes from an influenza or hepatitis B virus protein.

39. The method of claim 33 wherein the peptide comprises between 7 to 70 amino acids.

40. The method of claim 33 wherein the peptide comprises two or more overlapping T cell epitopes.

41. The method of claim 33 wherein the peptide comprises multiple overlapping viral T cell epitopes and/or fusion peptides.

42. The method of claim 33, wherein the fluorocarbon peptide construct is according to structure C.sub.mF.sub.n-—C.sub.yH.sub.x-Sp)-R, where m=3 to 30, n<=2m+1, y=0 to 15, x<=2y, (m+y)=3-30 and Sp is an optional chemical spacer moiety and R is the peptide.

43. The method of claim 33, wherein the subject in need thereof is a human subject.

44. The method of claim 33, wherein the administration comprising multiple doses each administered between 2 to 12 weeks apart.

45. The method of claim 33, further comprising a boost step wherein the pharmaceutical composition is administered in a repeat dose 3 months to 5 years apart.

46. A method of inducing a cell-mediated response in a subject against an intracellular pathogen, the method comprising administering a combination of different types of fluorocarbon peptide constructs configured for intracellular delivery of T cell epitopes to the subject in need thereof, wherein the each different type of fluorocarbon peptide construct comprises: a fluorocarbon chain from 3 to 20 carbon atoms, wherein one or more fluorine moieties is optionally substituted with chlorine, bromine or iodine or a methyl group, and an in vivo immunogenic peptide of between 7 to 70 amino acids in length, comprising one or more CD8.sup.+ T cell epitopes, at least two MHC class I or MHC class II epitopes, and being covalently linked via either an N-terminus or C-terminus terminal lysine to the fluorocarbon chain, wherein each different type of fluorocarbon peptide construct comprises a different in vivo immunogenic peptide sequence and the fluorocarbon chain enhances CD8.sup.+ T cell response against the peptide; and, wherein the combination of different types of the fluorocarbon constructs is lyophilized and re-constituted in a liquid form before the administration to the subject in need thereof.

47. The method of claim 46, wherein the peptide is between 15 to 35 amino acids in length.

48. The method of claim 46, wherein the fluorocarbon peptide construct is according to structure C.sub.mF.sub.n-—C.sub.yH.sub.x-Sp-R, where m=3 to 30, n<=2m+1, y=0 to 15, x<=2y, (m+y)=3-30 and Sp is an optional chemical spacer moiety and R is the peptide.

49. The method of claim 46, wherein the fluorocarbon peptide construct is according to structure ##STR00007## where Sp is an optional chemical spacer moiety and R is the peptide.

50. The method of claim 46, wherein the peptide comprises one or more epitopes from an influenza or hepatitis B virus protein.

51. The method of claim 46, wherein the subject in need thereof is a human subject.

52. The method of claim 46, wherein the administration comprising multiple doses each administered between 2 to 12 weeks apart and/or the method further comprising a boost step wherein the pharmaceutical composition is administered in a repeat dose 3 months to 5 years apart.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0042] The examples refer to the figures in which:

[0043] FIG. 1: shows HPLC chromatograms of various peptides and constructs at T=0;

[0044] FIG. 2: shows HPLC chromatograms of various peptides and constructs stored at 40° C. for 27 days;

[0045] FIG. 3: shows critical micelle concentration evaluation for two peptides, FAVS-3-ENV and FAVS-1-ENV;

[0046] FIG. 4: shows particle size analysis by quasi light scattering spectrometry after 20 hours standing for various peptide constructs;

[0047] FIG. 5: shows cellular immune response assessed by ex vivo IFN-gamma ELISPOT assay in mice after single immunisation (A,B), first boost (C,D) and second boost (E,F);

[0048] FIG. 6 shows nature of T lymphocytes primed in vivo by various fluorocarbon-peptide constructs;

[0049] FIG. 7: shows cellular immune response assessed by ex vivo IFN-g ELISPOT assay in mice after three immunisations with FAVS-1-ENV alone or in combination with murabutide;

[0050] FIG. 8: cytokine measurement after three injections with FAVS-1-ENV alone or in combination with murabutide; and

[0051] FIG. 9: shows cellular immune response assessed by ex vivo IFN-g ELISPOT assay in mice after two intranasal administrations with FAVS-1-ENV alone or in combination with murabutide.

DETAILED DESCRIPTION

Example 1

[0052] Synthesis of Fluorocarbon-Vectored Peptides

[0053] The following fluorocarbon-vector peptides were synthesised:

TABLE-US-00001 FAVS-1-ENV: NNTRKRIRIQRGPGRAFVTIGK- C.sub.8F.sub.17(CH.sub.2).sub.2CO-K-NH.sub.2 FAVS-2-ENV: NNTRKRIRIQRGPGRAFVTIGK- C.sub.8F.sub.17(CH.sub.2).sub.6CO-K-NH.sub.2 FAVS-3-ENV: IRIQRGPGRAFVTIGKK-CO(CH.sub.2).sub.2- (PEG).sub.4-C.sub.8F.sub.17(CH.sub.2).sub.6CO-K-NH.sub.2

[0054] Where the standard amino acid one letter code is utilised and PEG is CH.sub.2—CH.sub.2—O. NNTRKRIRIQRGPGRAFVTIGK is the ENV(301-322) peptide of the Human Immunodeficiency Virus.

[0055] Peptide synthesis was carried out on an ABI 430 or ABI 433 automatic peptide synthesizer, on Rink amide resin (0.38 mmol/g loading) using Nsc (2-(4-nitrophenylsulfonyl)ethoxycarbonyl), or Fmoc ((9-fluorenylmethylcarbonyl) amino acids. Coupling was promoted with HOCt (6-Chloro-1-oxybenzotriazole) and DIC (1,3-diisopropylcarbodiimide), and Fmoc/Nsc deprotection was carried out using 20% piperidine in DMF (Dimethylformamide). Uncoupled N-termini were capped with acetic anhydride as part of each cycle. Cleavage of the peptide from resin and concomitant side-chain deprotection was achieved using TFA, water and TIS (Diisopropylsilane) (95:3:2), with crude isolation of product by precipitation into cold diethyl ether. Purification was performed by preparative HPLC using Jupiter C5 or Luna C18 (2) columns (250×22 mm) and peptide mass was verified by mass spectrometry.

[0056] Peptide purity was verified prior to conducting the experiments by HPLC (HP 1050) using a column from Supelco (C5, 250×4.6 mm, 300 A, 5 μm) under gradient elution. Solvent A (90% Water, 10% Acetonitrile, 0.1% TFA), Solvent B (10% Water, 90% Acetonitrile, 0.1% TFA). A gradient 0 to 100% of B in 30 minutes was used and column temperature was 40° C. The wavelength of the UV detector was set up at 215 nm. Purity of the fluorocarbon-vector peptides in each case was greater than 90%.

[0057] The chemical stability of hermetically sealed samples containing lyophilised vector-peptides was assessed at 4° C., 20° C. and 40° C. together with the unvectored peptide as a comparator (NNTRKRIRIQRGPGRAFVTIGK-NH.sub.2). The stability over the time was monitored by HPLC using the conditions described above. The data is shown in FIGS. 1 and 2.

[0058] For each peptide conjugate, no sign of degradation was observed after 27 days at 40° C. incubation, with a single peak eluting at the same retention time as found at T=0.

Example 2

[0059] Physicochemical Analysis of Fluorocarbon-Vectored Peptides

[0060] (i) Solubility

[0061] The solubility of the fluorocarbon-vector peptides in aqueous solution at concentrations useful for a pharmaceutical formulation was confirmed. Solutions of peptides were prepared at 20° C. by dissolving the lyophilised peptide powder with PBS (0.01M, pH 7.2) across a range of concentrations. Preparations were then vortexed for one minute. An aliquot was collected and the remainder of the solution was centrifuged for 10 minutes at 12,000 rpm. To a 96-well flat bottom plate containing 25 μl aliquots of serial dilutions of each peptide was added 200 μl of the BCA working reagent (Pierce, UK) containing the solution A (bicichoninic acid, sodium carbonate, sodium tartrate in a sodium hydroxyde 0.1M solution, 50 vol,) and B (4% cupric sulphate solution, 1 vol.). After incubating for 45 minutes at 37° C. and cooling for 10 minutes, the absorbance was measured at 570 nm. The plates were analysed by a Wallac Victor multilabel counter (Perkin Elmer). For each peptide a calibration curve was plotted and used to determine the peptide concentration in the soluble fraction, expressed in nmol/ml. Data are presented Table 1. All the peptides were found to be fully soluble at the concentration of antigen used for murine immunisation studies.

TABLE-US-00002 TABLE 1 Summary of the solubility assay performed by the protein assay method Peptide Solubility Free peptide >3300 nmol/ml FAVS-1-ENV >4000 nmol/ml FAVS-2-ENV  >500 nmol/ml FAVS-3-ENV >3000 nmol/ml

[0062] (ii) Critical Micelle Concentration [CMC]

[0063] The Critical Micelle Concentration of the fluorocarbon-vectored peptides in physiological phosphate buffered saline was determined by dye bonding with 8-anilino-1-naphthalene-sulphonic acid (ANS). Starting from 300 μg peptide/ml solutions, serial two-fold dilutions of the peptide and peptide-vector solutions in PBS (0.01M, pH 7.2) were prepared at 20° C., from which 200 μl were added to the wells of a microplate. 40 μl of freshly dissolved ANS in PBS was then added to each well. After two minutes the plate was excited at 355 nm and scanned at 460 nm on a Victor microplate fluorimeter. The ratio (Intensity of fluorescence of the sample/Intensity of fluorescence of the blank) was plotted on a linear scale versus the concentration on a logarithmic scale. Data are presented FIG. 3.

[0064] (iii) Particle Size Analysis

[0065] analysis was performed on a Malvern 4700C Quasi Light Scattering spectrometer (Malvern Ltd, UK) equipped with an Argon laser (Uniphase Corp., San Jose, Calif.) tuned at 488 nm. Samples were maintained at a temperature of 25° C. The laser has variable detector geometry for angular dependence measurement. Measurements were performed at angles of 90° and 60°. Solutions were prepared by dissolving the peptide in filtered 0.01M phosphate buffered saline to a concentration of 500 nmol/ml and vortexing for 1 minute. Solutions were then dispensed into cuvettes (working volume of 1 ml). Measurements were taken after 15 minutes at an angle of 90° (FIG. 4). The Kcount value output is proportional to the number of particles detected; in all cases the Kcount was >10 in order to ensure that reliable size distribution measurements were obtained.

TABLE-US-00003 TABLE 2 Particle size of micellar solution in PBS. Standing Time size (nm) Average ITS reference (h) Kcount Population1 Population2 size (nm) Polydispersity FAVS-1-ENV 0.25 177 28 — 28.3 0.151 20 230 32 — 32.7 0.180 FAVS-2-ENV 0.25 190 15 120 28.5 0.450 20 245 20 300 68.4 0.539 FAVS-3-ENV 0.25 201 70 400 209 0.659 20 225 105 800 207 0.647

Example 3

[0066] (i) Immunogenicity of Fluorocarbon-Vectored Peptides

[0067] Specific-pathogen-free mice (6-8 week female Balb/c) were purchased from Harlan (UK). Peptides ENV, FAVS-1-ENV, FAVS-2-ENV or FAVS-3-ENV were dissolved in PBS (0.01M, pH 7.2). Each dose was normalised to 50 nmol peptide per ml based on the net peptide content obtained from amino-acid analysis. Mice (3 per group) were immunized subcutaneously under the skin of the interscapular area with 50 nmol peptide in a volume of 100 μl PBS, pH 7.2. Three doses were administered at ten day intervals. A mouse group receiving a priming dose of free peptide admixed with Complete Freund's adjuvant (50 nmol peptide in PBS emulsified in an equal volume of adjuvant) and booster doses of Incomplete Freund's adjuvant served as a positive control. Ten days after the final immunisation mice were sacrificed and spleens removed to assess the cellular immune response to the peptide. To determine the progress of the immune response development, groups of mice receiving a single and two doses of peptide were also set up.

[0068] The in vivo cellular response primed by the vectored peptides was monitored by IFN-gamma ELISPOT on fresh spleen cells in order to enumerate the ex-vivo frequency of peptide-specific IFN-gamma producing cells and more specifically peptide-specific CD8+T lymphocytes primed following immunisation. Spleen cells were restimulated in vitro with the ENV(301-322) NNTRKRIRIQRGPGRAFVTIGK peptide containing a well-known T-helper epitope and ENV(311-320) RGPGRAFVTI a shorter peptide corresponding to the CD8 epitope (MHC class I H-2Dd-restricted known as P18-I10) in order to cover both components of the cellular immune response (T Helper and CD8 T cell activity).

[0069] The spleens from each group of mice were pooled and spleen cells isolated. Cells were washed three times in RPMI-1640 before counting. Murine IFN-g Elispot assays were performed using Diaclone Kit (Diaclone, France) according to the manufacturer's instructions with the following modifications. Duplicate culture of spleen cells at cell density of 5×10.sup.5/well were distributed in anti-IFN-gamma antibody coated PVDF bottomed-wells (96-well Multiscreen™-IP microplate—Millipore) with the appropriate concentration of peptide (10, 1, 0 mg/ml of T helper ENV(301-322) or P18-I10 CTL epitope) in culture medium (RPMI-1640), 5 μM β-mercaptoethanol, 5 mM glutamine supplemented with 10% Foetal Calf Serum during 18 hours at 37° C. under 5% CO.sub.2 atmosphere. The spots were counted using a Carl Zeiss Vision ELIspot reader unit. The results correspond to mean values obtained with each conditions after background subtraction. Results are expressed as spot forming units (SFC) per million input spleen cells (FIG. 5).

[0070] (ii) Nature of T Lymphocytes Primed In Vivo by the Fluorocarbon-Peptides (CD4 and CD8 T Cell Separation)

[0071] Spleen Cells from immunized mice were distributed in 48-well microplates at cell density of 2.5×10.sup.6/well with 1 μg/ml of T helper ENV(301-322) or P18-I10 CTL peptides. At day 3, 5 ng/ml of recombinant murine IL-2 was added to each well. At day 7, pre-stimulated spleen cells were harvested, washed three times in RPMI 1640, counted and separated by magnetic cell sorting using magnetic beads conjugated with monoclonal rat anti-mouse CD8a and CD4 antibodies (MACS, Microbeads Miltenyi Biotec, UK) according to manufacturer's instructions. CD4 and CD8+ T cells were distributed at cell density of 2.5×10.sup.5/well in duplicate in antibody coated PVDF bottomed-wells (96-well Multiscreen™-IP microplate, Millipore) with 1 mg/ml of peptide in culture medium (RPMI-1640, 5 μM β-mercaptoethanol, Glutamine, non-essential amino-acids, sodium pyruvate supplemented with 10% Foetal Calf Serum for 12 hours at 37° C. under 5% CO.sub.2 atmosphere. The spots were counted using a Carl Zeiss Vision ELIspot reader unit. The results correspond to mean values obtained with each conditions after background subtraction (<10 spots). Results are expressed as spot forming units (SFC) per million input spleen cells.

[0072] According to the ex vivo IFN-γ ELISPOT assays, the FAVS-peptide constructs were able to prime a strong cellular immune response against both the long (ENV301-322) and the short ENV peptides (P18-I10 CTL epitope) after a single in vivo exposure to the antigen (FIGS. 5 A and B). FIG. 6 demonstrates that both CD4+ and CD8+ENV-specific T cells were efficiently primed in vivo.

[0073] The intensity of the response after priming with the FAVS-peptides was in the same range as the responses obtained from mice immunized with the native peptide emulsified in Freund's adjuvant. ENV-specific T cell responses are clearly amplified after a first and a second boost with the FAVS-1-ENV formulation (FIG. 5C, D, E, F) as summarized in FIG. 6.

[0074] This clearly demonstrates the ability of the FAVS-peptides to be taken up by antigen presenting cells in vivo in order to reach the MHC class I and MHC class II pathways and thereby prime strong cellular immune responses.

Example 4

[0075] Immunogenicity of Fluorocarbon-Vectored Peptides Co-Administered with Synthetic Adjuvant

[0076] In order to assess the potential impact of a synthetic immunostimulant on the quantitative and qualitative immunogenicity of the FAVS-peptides, FAVS-1-ENV was injected alone and in combination with Murabutide. Murabutide (N-acetyl-muramyl-L-alanyl-D-glutamine-O-n-butyl-ester; a synthetic derivative of muramyl dipeptide and NOD-2 agonist) is a synthetic immune potentiator that activates innate immune mechanisms and is known to enhance both cellular and humoral responses when combined with immunogens (“Immune and antiviral effects of the synthetic immunomodulator murabutide: Molecular basis and clinical potential”, G. Bahr, in: “Vaccine adjuvants: Immunological and Clinical Principles”, eds Hacket and Harn (2004), Humana Press).

[0077] Specific-pathogen-free mice (6-8 week female Balb/c) were purchased from Harlan (UK). The FAVS-1-ENV construct was used at two different dose levels, one group of mice receiving 50 nmoles and a second group received 5 nmoles of construct. Mice (3 per group) were immunized subcutaneously under the skin of the interscapular area with FAVS-1-ENV either alone or in combination with 100 μg of Murabutide in a total volume of 100 μl PBS, pH 7.2. Three doses were administered at ten-day intervals. A control group receiving murabutide alone was also set up.

[0078] Ten days after the final immunisation mice were sacrificed and spleens removed to assess the cellular immune response to the T helper ENV(301-322) or P18-I10 CTL epitope peptides. Interferon-gamma Elispot and Th-1 and Th-2 cytokine measurements were performed on the isolated spleens as described in Example 3. Briefly, spleen cells were cultured with the appropriate concentration of peptide (10 or 0 μg/ml of T helper ENV (301-322) or P18-I10 CTL epitope) in culture medium during 18 hours at 37° C. under 5% CO.sub.2 atmosphere. IFN-g Elispot assay was then performed. The spots were counted using a Carl Zeiss Vision Elispot reader unit. The results correspond to mean values obtained with each conditions after background subtraction (<10 spots). Results are expressed as spot forming units (SFC) per million input spleen cells (FIG. 7).

[0079] Multiplex cytokine measurements (IL-2, IFN-g, IL4, IL5, IL-10, IL-13) were performed on fresh spleen cells re-stimulated with the ENV (301-322) peptide from mice immunised with the 5 nmol dose of FAVS-1-ENV. Supernatants were collected at 24 hours and 48 hours. Levels of cytokines (IL2, IL4, IL-5, IL-10, IL-13, IFN-7) in cell culture supernatant samples were measured using the Cytokine specific Sandwich ELISA according to the mutiplex format developed by SearchLight™ Proteomic Arrays (Pierce Biotechnology, Woburn, Mass.). Results were expressed in pg cytokine/ml.

[0080] FAVS-1-ENV administered alone was shown to induce predominantly Th-1 cytokine production (i.e. IL-2 and IFN-g)□ with □low levels of Th-2 cytokines also being produced. The inclusion of murabutide within the formulation led to the induction of a more balanced Th-1/Th-2 response with higher levels of Th-2 cytokines such as IL-5, IL-10 and IL-13 (FIG. 8).

Example 5

[0081] Immunogenicity of Fluorocarbon-Vectored Peptides Administered Mucosally

[0082] Specific-pathogen-free mice (6-8 week female Balb/c) were purchased from Harlan (UK).

[0083] FAVS-1-ENV (50 nmoles per mouse) was administered twice intranasally in 0.01M PBS alone or in combination with 100 μg of Murabutide with 10 days interval between both administration. Mice were slightly anaesthetised with Isoflurane (Isoflo, Solvay, UK). 20 μl of soluble peptide solution (10 μl/nostril) was administered using a micropipette. A control group received PBS only. Each dosing group comprised six animals. Mice were sacrificed 10 days after the last administration by carbon dioxide asphyxiation. Spleens were removed, pooled for each group of mice and spleen cells were isolated. Cells were washed three times with RPMI-1640 before counting. Counting was performed using a Thomas counting slide. Spleen cells from individual mice were cultured with the appropriate concentration of peptide (10 or 0 μg/ml of T helper ENV (301-322) or P18-110 CTL epitope) in culture medium during 18 hours at 37° C. under 5% CO.sub.2 atmosphere. IFN-g Elispot assay was then performed using the Diaclone Kit as described in Example 3. The spots were counted using a Carl Zeiss Vision Elispot reader unit. The results correspond to mean values obtained with each conditions after background subtraction (<10 spots). Results are expressed as spot forming units (SFC) per million input spleen cells. The data represent the average for 6 mice.

[0084] All six mice per group immunised intranasally either with FAVS-1-ENV alone or in combination with murabutide produced a robust systemic T-cell response. Combination with murabutide led to modest increases in the frequency of IFN-gamma producing T cells (FIG. 9).

Example 6

[0085] Example HIV Peptides

[0086] Candidate peptides for attachment to the fluorocarbon vector to produce a prophylactic or therapeutic vaccine for HIV may include the following one or more peptides or fragments thereof, or homologues (including the corresponding consensus, ancestral or central tree sequences from HIV-1 representing different clades such as but not limited to clades A, B, C, D, F, G and H as referred to in the 2004 Los Alamos National Laboratory database) or natural and non-natural variants thereof, but not necessarily exclusively. The standard one letter and three-letter amino acid codes have been utilised. Homologues have at least a 50% identity compared to a reference sequence. Preferably a homologue has 80, 85, 90, 95, 98 or 99% identity to a naturally occurring sequence. The sequences provided below are 35 amino acids in length. Fragments of these sequences that contain one or more epitopes are also candidate peptides for attachment to the fluorocarbon vector.

TABLE-US-00004 SEQ ID No 1 WKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAG Trp-Lys-Gly-Glu-Gly-Ala-Val-Val-Ile-Gln-Asp-Asn-Ser-Asp-Ile- Lys-Val-Val-Pro-Arg-Arg-Lys-Ala-Lys-Ile-Ile-Arg-Asp-Tyr-Gly- Lys-Gln-Met-Ala-Gly SEQ ID No 2 EIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFR Glu-Ile-Tyr-Lys-Arg-Trp-Ile-Ile-Leu-Gly-Leu-Asn-Lys-Ile-Val- Arg-Met-Tyr-Ser-Pro-Thr-Ser-Ile-Leu-Asp-Ile-Arg-Gln-Gly-Pro- Lys-Glu-Pro-Phe-Arg SEQ ID No 3 EHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDII Glu-His-Leu-Lys-Thr-Ala-Val-Gln-Met-Ala-Val-Phe-Ile-His-Asn- Phe-Lys-Arg-Lys-Gly-Gly-Ile-Gly-Gly-Tyr-Ser-Ala-Gly-Glu-Arg- Ile-Val-Asp-Ile-Ile SEQ ID No 4 WEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANR Trp-Glu-Phe-Val-Asn-Thr-Pro-Pro-Leu-Val-Lys-Leu-Trp-Tyr-Gln- Leu-Glu-Lys-Glu-Pro-Ile-Val-Gly-Ala-Glu-Thr-Phe-Tyr-Val-Asp- Gly-Ala-Ala-Asn-Arg SEQ ID No 5 GERIVDIIATDIQTKELQKQITKIQNFRVYYRDSR Gly-Glu-Arg-Ile-Val-Asp-Ile-Ile-Ala-Thr-Asp-Ile-Gln-Thr-Lys- Glu-Leu-Gln-Lys-Gln-Ile-Thr-Lys-Ile-Gln-Asn-Phe-Arg-Val-Tyr- Tyr-Arg-Asp-Ser-Arg SEQ ID No 6 FRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPA Phe-Arg-Lys-Tyr-Thr-Ala-Phe-Thr-Ile-Pro-Ser-Ile-Asn-Asn-Glu- Thr-Pro-Gly-Ile-Arg-Tyr-Gln-Tyr-Asn-Val-Leu-Pro-Gln-Gly-Trp- Lys-Gly-Ser-Pro-Ala SEQ ID No 7 NWFDITNWLWYIKIFIMIVGGLIGLRIVFAVLSIV Asn-Trp-Phe-Asp-Ile-Thr-Asn-Trp-Leu-Trp-Tyr-Ile-Lys-Ile-Phe- Ile-Met-Ile-Val-Gly-Gly-Leu-Ile-Gly-Leu-Arg-Ile-Val-Phe-Ala- Val-Leu-Ser-Ile-Val SEQ ID No 8 ENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDF Glu-Asn-Pro-Tyr-Asn-Thr-Pro-Val-Phe-Ala-Ile-Lys-Lys-Lys-Asp- Ser-Thr-Lys-Trp-Arg-Lys-Leu-Val-Asp-Phe-Arg-Glu-Leu-Asn-Lys- Arg-Thr-Gln-Asp-Phe SEQ ID No 9 VASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTI Val-Ala-Ser-Gly-Tyr-Ile-Glu-Ala-Glu-Val-Ile-Pro-Ala-Glu-Thr- Gly-Gln-Glu-Thr-Ala-Tyr-Phe-Leu-Leu-Lys-Leu-Ala-Gly-Arg-Trp- Pro-Val-Lys-Thr-Ile SEQ ID No 10 PDKSESELVSQIIEQLIKKEKVYLAWVPAHKGIGG Pro-Asp-Lys-Ser-Glu-Ser-Glu-Leu-Val-Ser-Gln-Ile-Ile-Glu-Gln- Leu-Ile-Lys-Lys-Glu-Lys-Val-Tyr-Leu-Ala-Trp-Val-Pro-Ala-His- Lys-Gly-Ile-Gly-Gly SEQ ID No 11 NRWQVMIVWQVDRMRIRTWKSLVKHHMYISRKAKG Asn-Arg-Trp-Gln-Val-Met-Ile-Val-Trp-Gln-Val-Asp-Arg-Met-Arg- Ile-Arg-Thr-Trp-Lys-Ser-Leu-Val-Lys-His-His-Met-Tyr-Ile-Ser- Arg-Lys-Ala-Lys-Gly SEQ ID No 12 HPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQ His-Pro-Asp-Lys-Trp-Thr-Val-Gln-Pro-Ile-Val-Leu-Pro-Glu-Lys- Asp-Ser-Trp-Thr-Val-Asn-Asp-Ile-Gln-Lys-Leu-Val-Gly-Lys-Leu- Asn-Trp-Ala-Ser-Gln SEQ ID No 13 PAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGS Pro-Ala-Ile-Phe-Gln-Ser-Ser-Met-Thr-Lys-Ile-Leu-Glu-Pro-Phe- Arg-Lys-Gln-Asn-Pro-Asp-Ile-Val-Ile-Tyr-Gln-Tyr-Met-Asp-Asp- Leu-Tyr-Val-Gly-Ser SEQ ID No 14 MRGAHTNDVKQLTEAVQKIATESIVIWGKTPKFKL Met-Arg-Gly-Ala-His-Thr-Asn-Asp-Val-Lys-Gln-Leu-Thr-Glu-Ala- Val-Gln-Lys-Ile-Ala-Thr-Glu-Ser-Ile-Val-Ile-Trp-Gly-Lys-Thr- Pro-Lys-Phe-Lys-Leu SEQ ID No 15 EKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQ Glu-Lys-Ala-Phe-Ser-Pro-Glu-Val-Ile-Pro-Met-Phe-Ser-Ala-Leu- Ser-Glu-Gly-Ala-Thr-Pro-Gln-Asp-Leu-Asn-Thr-Met-Leu-Asn-Thr- Val-Gly-Gly-His-Gln SEQ ID No 16 NLLRAIEAQQHLLQLTVWGIKQLQARVLAVERYLK Asn-Leu-Leu-Arg-Ala-Ile-Glu-Ala-Gln-Gln-His-Leu-Leu-Gln-Leu- Thr-Val-Trp-Gly-Ile-Lys-Gln-Leu-Gln-Ala-Arg-Val-Leu-Ala-Val- Glu-Arg-Tyr-Leu-Lys SEQ ID No 17 ASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASR Ala-Ser-Val-Leu-Ser-Gly-Gly-Glu-Leu-Asp-Arg-Trp-Glu-Lys-Ile- Arg-Leu-Arg-Pro-Gly-Gly-Lys-Lys-Lys-Tyr-Lys-Leu-Lys-His-Ile- Val-Trp-Ala-Ser-Arg SEQ ID No 18 ELYKYKVVKIEPLGVAPTKAKRRVVQREKRAVGIG Glu-Leu-Tyr-Lys-Tyr-Lys-Val-Val-Lys-Ile-Glu-Pro-Leu-Gly-Val- Ala-Pro-Thr-Lys-Ala-Lys-Arg-Arg-Val-Val-Gln-Arg-Glu-Lys-Arg- Ala-Val-Gly-Ile-Gly SEQ ID No 19 FPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKAL Phe-Pro-Ile-Ser-Pro-Ile-Glu-Thr-Val-Pro-Val-Lys-Leu-Lys-Pro- Gly-Met-Asp-Gly-Pro-Lys-Val-Lys-Gln-Trp-Pro-Leu-Thr-Glu-Glu- Lys-Ile-Lys-Ala-Leu SEQ ID No 20 QIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQK Gln-Ile-Tyr-Gln-Glu-Pro-Phe-Lys-Asn-Leu-Lys-Thr-Gly-Lys-Tyr- Ala-Arg-Met-Arg-Gly-Ala-His-Thr-Asn-Asp-Val-Lys-Gln-Leu-Thr- Glu-Ala-Val-Gln-Lys SEQ ID No 21 NLLRAIEAQQHLLQLTVWGIKQLQARVLAVERYLK Asn-Leu-Leu-Arg-Ala-Ile-Glu-Ala-Gln-Gln-His-Leu-Leu-Gln-Leu- Thr-Val-Trp-Gly-Ile-Lys-Gln-Leu-Gln-Ala-Arg-Val-Leu-Ala-Val- Glu-Arg-Tyr-Leu-Lys SEQ ID No 22 AGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTI Ala-Gly-Leu-Lys-Lys-Lys-Lys-Ser-Val-Thr-Val-Leu-Asp-Val-Gly- Asp-Ala-Tyr-Phe-Ser-Val-Pro-Leu-Asp-Lys-Asp-Phe-Arg-Lys-Tyr- Thr-Ala-Phe-Thr-Ile SEQ ID No 23 TTNQKTELQAIHLALQDSGLEVNIVTDSQYALGII Thr-Thr-Asn-Gln-Lys-Thr-Glu-Leu-Gln-Ala-Ile-His-Leu-Ala-Leu- Gln-Asp-Ser-Gly-Leu-Glu-Val-Asn-Ile-Val-Thr-Asp-Ser-Gln-Tyr- Ala-Leu-Gly-Ile-Ile SEQ ID No 24 VSQNYPIVQNLQGQMVHQAISPRTLNAWVKVVEEK Val-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-Asn-Leu-Gln-Gly-Gln-Met- Val-His-Gln-Ala-Ile-Ser-Pro-Arg-Thr-Leu-Asn-Ala-Trp-Val-Lys- Val-Val-Glu-Glu-Lys SEQ ID No 25 EAELELAENREILKEPVHGVYYDPSKDLIAEIQKQ Glu-Ala-Glu-Leu-Glu-Leu-Ala-Glu-Asn-Arg-Glu-Ile-Leu-Lys-Glu- Pro-Val-His-Gly-Val-Tyr-Tyr-Asp-Pro-Ser-Lys-Asp-Leu-Ile-Ala- Glu-Ile-Gln-Lys-Gln SEQ ID No 26 TPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKD Thr-Pro-Asp-Lys-Lys-His-Gln-Lys-Glu-Pro-Pro-Phe-Leu-Trp-Met- Gly-Tyr-Glu-Leu-His-Pro-Asp-Lys-Trp-Thr-Val-Gln-Pro-Ile-Val- Leu-Pro-Glu-Lys-Asp SEQ ID No 27 EPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQN Glu-Pro-Phe-Arg-Asp-Tyr-Val-Asp-Arg-Phe-Tyr-Lys-Thr-Leu-Arg- Ala-Glu-Gln-Ala-Ser-Gln-Glu-Val-Lys-Asn-Trp-Met-Thr-Glu-Thr- Leu-Leu-Val-Gln-Asn SEQ ID No 28 NEWTLELLEELKSEAVRHFPRIWLHGLGQHIYETY Asn-Glu-Trp-Thr-Leu-Glu-Leu-Leu-Glu-Glu-Leu-Lys-Ser-Glu-Ala- Val-Arg-His-Phe-Pro-Arg-Ile-Trp-Leu-His-Gly-Leu-Gly-Gln-His- Ile-Tyr-Glu-Thr-Tyr SEQ ID No 29 EGLIYSQKRQDILDLWVYHTQGYFPDWQNYTPGPG Glu-Gly-Leu-Ile-Tyr-Ser-Gln-Lys-Arg-Gln-Asp-Ile-Leu-Asp-Leu- Trp-Val-Tyr-His-Thr-Gln-Gly-Tyr-Phe-Pro-Asp-Trp-Gln-Asn-Tyr- Thr-Pro-Gly-Pro-Gly SEQ ID No 30 HFLKEKGGLEGLIYSQKRQDILDLWVYHTQGYFPD His-Phe-Leu-Lys-Glu-Lys-Gly-Gly-Leu-Glu-Gly-Leu-Ile-Tyr-Ser- Gln-Lys-Arg-Gln-Asp-Ile-Leu-Asp-Leu-Trp-Val-Tyr-His-Thr-Gln- Gly-Tyr-Phe-Pro-Asp SEQ ID No 31 FPVRPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIY Phe-Pro-Val-Arg-Pro-Gln-Val-Pro-Leu-Arg-Pro-Met-Thr-Tyr-Lys- Ala-Ala-Val-Asp-Leu-Ser-His-Phe-Leu-Lys-Glu-Lys-Gly-Gly-Leu- Glu-Gly-Leu-Ile-Tyr SEQ ID No 32 FPQITLWQRPLVTIKIGGQLKEALLDTGADDTVLE Phe-Pro-Gln-Ile-Thr-Leu-Trp-Gln-Arg-Pro-Leu-Val-Thr-Ile-Lys- Ile-Gly-Gly-Gln-Leu-Lys-Glu-Ala-Leu-Leu-Asp-Thr-Gly-Ala-Asp- Asp-Thr-Val-Leu-Glu SEQ ID No 33 LVITTYWGLHTGERDWHLGQGVSIEWRKKRYSTQV Leu-Val-Ile-Thr-Thr-Tyr-Trp-Gly-Leu-His-Thr-Gly-Glu-Arg-Asp- Trp-His-Leu-Gly-Gln-Gly-Val-Ser-Ile-Glu-Trp-Arg-Lys-Lys-Arg- Tyr-Ser-Thr-Gln-Val SEQ ID No 34 APPEESFRFGEETTTPSQKQEPIDKELYPLASLRS Ala-Pro-Pro-Glu-Glu-Ser-Phe-Arg-Phe-Gly-Glu-Glu-Thr-Thr-Thr- Pro-Ser-Gln-Lys-Gln-Glu-Pro-Ile-Asp-Lys-Glu-Leu-Tyr-Pro-Leu- Ala-Ser-Leu-Arg-Ser SEQ ID No 35 KRRVVQREKRAVGIGAMFLGFLGAAGSTMGAASMT Lys-Arg-Arg-Val-Val-Gln-Arg-Glu-Lys-Arg-Ala-Val-Gly-Ile-Gly- Ala-Met-Phe-Leu-Gly-Phe-Leu-Gly-Ala-Ala-Gly-Ser-Thr-Met-Gly- Ala-Ala-Ser-Met-Thr SEQ ID No 36 GLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRIG Gly-Leu-Gly-Gln-His-Ile-Tyr-Glu-Thr-Tyr-Gly-Asp-Thr-Trp-Ala- Gly-Val-Glu-Ala-Ile-Ile-Arg-Ile-Leu-Gln-Gln-Leu-Leu-Phe-Ile- His-Phe-Arg-Ile-Gly

[0087] Candidate peptides for inclusion into a prophylactic or therapeutic vaccine for HIV may be peptides from any of the structural or functional domains Gag, Pol, Nef, Env, Vif, Vpr, Vpu, Tat or Rev in any such combination.

INCORPORATION BY REFERENCE

[0088] The entire disclosure of each of the publications, web sites and patent documents referred to herein is incorporated by reference in its entirety for all purposes to the same extent as if each individual publication, web site or patent document were so individually denoted.

EQUIVALENTS

[0089] The invention may be embodied in other specific forms without departing form the spirit or essential characteristics thereof. The foregoing embodiments are therefore to be considered in all respects illustrative rather than limiting on the invention described herein. Scope of the invention is thus indicated by the appended claims rather than by the foregoing description, and all changes that come within the meaning and range of equivalency of the claims are intended to be embraced therein.