TALEN-BASED AND CRISPR/CAS-BASED GENE EDITING FOR BRUTON'S TYROSINE KINASE

20220064651 · 2022-03-03

    Inventors

    Cpc classification

    International classification

    Abstract

    The present disclosure provides improved genome editing compositions and methods for editing a human BTK gene. The disclosure further provides genome edited cells for the prevention, treatment, or amelioration of at least one symptom of X-linked agammaglobulinemia (XLA).

    Claims

    1. A gene editing composition comprising a TALEN that cleaves a target site in the human Bruton's tyrosine kinase (BTK) gene.

    2. The gene editing composition of claim 1, wherein the TALEN comprises a TAL effector domain having RVDs selected from the group comprising: a) T1-F RVDs HD NG HD NN NI HD NG NI NG NN NI NI NI NI HD NG; b) T1-R RVDs HD NG NI NI NN NN HD HD NI NI NN NG HD HD NG; c) T2-F RVDs NI NG HD NI NI NN NN NI HD NG NG NN NN HD HD NG; d) T2-R RVDs NI HD HD NI NI HD NN NI NI NI NI NG NG NG NI HD HD NG; e) T3-F RVDs NI NG NG NG HD HD NG NI NN HD HD NG NI NG NI NI HD NG; f) T3-R RVDs NN NN HD NG NG HD NG NG NI NN NN NI HD HD NG NG NG; g) T4-F RVDs HD HD NI NG NG NG NN NI NI NI HD NG NI NN NN NG; and h) T4-R RVDs HD HD NG HD NI NG HD HD HD NG HD NG NG NN NN NG NG; wherein the TAL effector domain is capable of binding target site T1, T2, T3, or T4.

    3. A gene editing composition comprising: a) a Cas protein or a polynucleotide encoding a Cas protein; b) a guide-RNA (gRNA); and c) a repair template comprising a functional BTK gene or fragment thereof; wherein the gene editing system is capable of repairing an endogenous BTK gene in the B cell or inserting a functional BTK gene into the genome of the B cell.

    4. The gene editing composition of claim 3, wherein the gRNA comprises a nucleotide sequence set forth in SEQ ID NOs: 9-17.

    5. A polynucleotide encoding the gene editing composition of claim 1, or a vector comprising the polynucleotide.

    6. The polynucleotide of claim 5, which is an mRNA encoding the gene editing composition or a cDNA encoding the gene editing composition.

    7-8. (canceled)

    9. An isolated cell comprising the gene editing composition of claim 1, or a polynucleotide encoding the gene editing composition, or a vector encoding the polynucleotide.

    10-11. (canceled)

    12. An isolated cell comprising one or more genome modifications introduced by the gene editing composition of claim 1.

    13. The isolated cell of claim 9, wherein the cell is a hematopoietic cell, or a hematopoietic stem or progenitor cell.

    14. (canceled)

    15. The isolated cell of claim 13, wherein the cell is a CD34.sup.+ cell or a CD133.sup.+ cell.

    16. (canceled)

    17. A composition comprising an isolated cell according to claim 9 and a physiologically acceptable carrier.

    18. (canceled)

    19. A method of editing a non-functional or disrupted, ablated, or partially deleted Bruton's tyrosine kinase (BTK) gene in a cell comprising: introducing the gene editing composition of claim 1; and a donor repair template into the cell, wherein expression of the gene editing composition creates a double strand break at a target site in the BTK gene and the donor repair template is incorporated into the BTK gene by homology directed repair (HDR) at the site of the double-strand break (DSB), thereby generating an edited cell comprising a functional BTK gene.

    20. The method of claim 19, wherein the non-functional or disrupted, ablated, or partially deleted Bruton's tyrosine kinase BTK gene comprises one or more amino acid mutations or deletions that result in X-linked agammaglobulinemia (XLA).

    21. The method of claim 19, wherein the cell is a hematopoietic cell, or a hematopoietic stem or progenitor cell.

    22. (canceled)

    23. The method of claim 19, wherein the cell is a CD34.sup.+ cell or a CD133.sup.+ cell.

    24. (canceled)

    25. The method claim 19, wherein the polynucleotide encoding the polypeptide is an mRNA.

    26. The method of claim 19, wherein a polynucleotide encoding a 5′-3′ exonuclease is introduced into the cell.

    27. The method of claim 19, wherein a polynucleotide encoding Trex2 or a biologically active fragment thereof is introduced into the cell.

    28. The method of claim 19, wherein the donor repair template comprises a 5′ homology arm homologous to a BTK gene sequence 5′ of the DSB, a donor polynucleotide, and a 3′ homology arm homologous to a BTK gene sequence 3′ of the DSB, wherein the donor polynucleotide is designed to repair one or more amino acid mutations or deletions in the BTK gene.

    29. (canceled)

    30. The method of claim 28, wherein the donor polynucleotide comprises a cDNA encoding a BTK polypeptide, optionally a promoter operably linked to a cDNA encoding a BTK polypeptide.

    31. (canceled)

    32. The method of claim 28, wherein the lengths of the 5′ and 3′ homology arms are independently selected from about 100 bp to about 2500 bp.

    33. The method of claim 28, wherein the lengths of the 5′ and 3′ homology arms are independently selected from about 600 bp to about 1500 bp.

    34. The method of claim 28, wherein the 5′ homology arm is about 1500 bp and the 3′ homology arm is about 1000 bp.

    35. The method of claim 28, wherein the 5′ homology arm is about 600 bp and the 3′ homology arm is about 600 bp.

    36. The method of claim 28, wherein a viral vector is used to introduce the donor repair template into the cell.

    37. The method of claim 36, wherein the viral vector is a recombinant adeno-associated viral vector (rAAV) or a retrovirus, optionally wherein the rAAV has one or more ITRs from AAV2.

    38. (canceled)

    39. The method of claim 37, wherein the rAAV has a serotype selected from the group consisting of: AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, and AAV10.

    40. (canceled)

    41. The method of claim 36, wherein the retrovirus is a lentivirus, optionally an integrase deficient lentivirus (IDLV).

    42. (canceled)

    43. A method of treating, preventing, or ameliorating at least one symptom of X-linked agammaglobulinemia (XLA), or condition associated therewith, comprising harvesting a population of cells from the subject; editing the population of cells according to the method of claim 19, and administering the edited population of cells to the subject.

    Description

    BRIEF DESCRIPTION OF SEVERAL VIEWS OF THE DRAWINGS

    [0058] FIG. 1A shows a schematic of the BTK locus annotated with the location of the TALENs (T1-T4) cleavage sites within the human BTK gene. Schema is not drawn to scale.

    [0059] FIG. 1B shows the percent disruption achieved with each TALEN in primary T cells. Primary human T cells were cultured in T cell growth medium supplemented with IL-2 (50 ng/ml), IL-7 (5 ng/ml), and IL-15 (5 ng/ml) and stimulated using CD3/CD28 beads (Dynabeads, Life Technologies) for 48 hours. Beads were removed and cells rested overnight followed by electroporation using Neon Transfection system with either TALEN mRNA (1 μg of each RNA monomer) Cells were cultured for 5 more days and genomic DNA was extracted. The region surrounding the cut site was amplified and purified using PCR purification kit. 200 ng of purified PCR product was incubated with T7 endonuclease (NEB), analyzed on a gel and percent disruption quantified using Licor Image Studio Lite software. TALEN T3 was used in experiments in subsequent figures.

    [0060] FIG. 1C shows a schematic of AAV donor templates for editing BTK gene using TALENs. DT AAV vector has 1 kb of homology arms flanking an MND promoter driven green fluorescent protein (GFP) cassette. DT-Del AAV donor has deletion of the genomic region spanning the end of the 5′ homology arm to the TAL spacer domain (SEQ ID NO: 72) resulting in a partial deletion of the second exon and intron to abolish cleavage by the TALEN.

    [0061] FIG. 1D shows editing in primary T cells using TALENs and AAV donor templates. Bar graphs depicts the time course of GFP expression. Percent homologous recombination (HR) is reported as percent (%) GFP at day 15.

    [0062] FIG. 1E shows representative FACS plots showing GFP expression at days 2 and 15 post-editing of primary T cells using co-delivery of TALENs and AAV donors.

    [0063] FIG. 2A shows a schematic of BTK locus with CRISPR guides annotated. Location of the guide RNAs (G1-G9) within the human BTK gene is shown. Schema is not drawn to scale.

    [0064] FIG. 2B shows percent (%) disruption at the BTK locus with guides G1 through G9 as determined by T7 endonuclease (New England Biolabs). Percent disruption was quantified using Licor Image Studio Lite software. Guide G3 was used in experiments in subsequent figures.

    [0065] FIG. 2C shows chematic of three exemplary AAV donor templates for editing BTK gene using CRISPR-Cas. DT AAV vector has 1 kb of homology arms flanking an MND promoter driven green fluorescent protein (GFP). DT-PAM AAV donor has mutations in PAM sequence (SEQ ID NO: 73) to abolish cleavage by guide G3. The DT-Del vector has a deletion (SEQ ID NO: 74) to abolish cleavage by guide G3.

    [0066] FIG. 2D shows editing in primary T cells using co-delivery of Cas9 plus guides and AAV donor templates. Primary human CD3+ T cells were cultured and bead stimulated. Cells were then transfected with Ribonucleoprotein complex (RNP) of Cas9 protein and single guide RNA and AAV donors added two hours later at 20% of culture volume. Cells were analyzed for GFP expression on Days 2, 8 and 15. GFP expression at day 15 is indicative of homology directed repair (HDR).

    [0067] FIG. 2E shows representative FACS plots showing GFP expression at days 2 and 15 post editing of primary T cells using RNPs plus AAV donors.

    [0068] FIG. 3A shows a schematic of human CD34.sup.+ cell editing protocol. Adult human Mobilized CD34.sup.+ cells were cultured in SCGM media supplemented with TPO, SCF, FLT3L (100 ng/ml) and IL3 (60 ng/ml) for 48 hours, followed by electroporation using Neon electroporation system with either TALENs or Ribonucleoprotein complex (RNP) of Cas9 protein and single guide RNA mixed in 1:1.2 ratio. The sgRNA was purchased from Trilink Biotechnologies and has chemically modified nucleotides at the three terminal positions at 5′ and 3′ ends. The cells were analyzed by flow cytometry on days 2 and 5.

    [0069] FIG. 3B shows editing of the BTK locus in CD34.sup.+ HSCs using co-delivery of TALEN mRNA and AAV donor template. Adult mobilized human CD34.sup.+ cells were cultured in SCGM media as described before followed by electroporation using Neon electroporation system with TALEN mRNA. AAV vector carrying the donor template was added immediately after electroporation. Controls included un-manipulated cells and cells transduced with AAV only without transfection of a nuclease (AAV). Bar graphs depict % GFP at day 5, indicative of HDR.

    [0070] FIG. 3C shows FACS plots depicting GFP expression from Mock, AAV or AAV plus TALEN treated CD34.sup.+ cells, 2 and 5 days post editing.

    [0071] FIG. 3D shows CD34.sup.+ cell viability post editing with TALENs and AAV donors. Bar graphs represent viability of mock and AAV only and AAV plus TALEN treated cells 2 and 5 days post editing.

    [0072] FIG. 3E shows CFU assay for TALEN edited CD34.sup.+ cells. TALEN edited, TALEN only, AAV only and mock cells were plated one day post editing onto Methocult media for colony formation unit (CFU) assay. Briefly, 500 cells were plated in duplicate in Methocult H4034 media (Stemcell Technologies), incubated at 37° C. for 12-14 days and colonies enumerated based on their morphology and GFP expression. CFU-E: Colony forming unit erythroid, M: Macrophage, GM: Granulocyte, macrophage, G: Granulocyte, GEMM: Granulocyte, erythroid, macrophage, megakaryocyte, BFU-E: Burst forming unit erythroid. n=3 independent donors. Data are presented as mean±SEM.

    [0073] FIG. 4A shows editing of the BTK locus in CD34.sup.+ HSCs using co-delivery of RNPs and AAV donor template. Adult mobilized human CD34.sup.+ cells were cultured in SCGM media as described before followed by electroporation using Neon electroporation system with RNP complex. AAV vector carrying the donor template was added immediately after electroporation. Controls included un-manipulated cells and cells transduced with AAV only without transfection of a nuclease (AAV). Bar graphs depict % GFP at day 5, indicative of HDR.

    [0074] FIG. 4B shows the same experiment as FIG. 4A and depicts representative FACs plots showing GFP expression at days 2 and 5.

    [0075] FIG. 4C shows CD34.sup.+ cell viability post editing with RNPs and AAV donors. Bar graphs represent viability of mock and AAV only and AAV plus RNP treated cells (at various RNP and AAV doses) 2 and 5 days post editing.

    [0076] FIG. 4D shows CFU assay for RNP edited CD34.sup.+ cells. RNP edited, AAV only and mock cells were plated one day post editing onto Methocult media for colony formation unit (CFU) assay. Briefly, 500 cells were plated in duplicate in Methocult H4034 media (Stemcell Technologies), incubated at 37° C. for 12-14 days and colonies enumerated based on their morphology and GFP expression. CFU-E: Colony forming unit erythroid, M: Macrophage, GM: Granulocyte, macrophage, G: Granulocyte, GEMM: Granulocyte, erythroid, macrophage, megakaryocyte, BFU-E: Burst forming unit erythroid. n=3 independent donors. Data are presented as mean±SEM.

    [0077] FIG. 5A shows schematic of promoter-less AAV donor template expressing GFP. This vector contains a GFP, a truncated woodchuck hepatitis virus posttranscriptional regulatory element (WPRE3) and an SV40 polyadenylation signal. This insert is flanked on either side by 0.5 kb homology arms to the BTK locus.

    [0078] FIG. 5B shows editing of the BTK locus using promoterless GFP vector in CD34.sup.+ HSCs using co-delivery of RNPs and AAV donor template. Bar graphs depict % GFP at days 1, 2 and 5, % GFP at day 5 is indicative of HDR.

    [0079] FIG. 5C shows the same experiment as FIG. 4A and depicts representative FACs plots showing GFP expression at days 2 and 5.

    [0080] FIG. 5D shows CD34.sup.+ cell viability post editing with RNPs and promoter-less AAV donor. Bar graphs represent viability of mock and AAV only and AAV plus RNP treated cells (at various RNP and AAV doses) 1, 2 and 5 days post editing. % GFP at day 5 is indicative of % HDR.

    [0081] FIG. 5E shows digital droplet PCR assay for determining HDR. Genomic DNA was isolated from hematopoietic stem and progenitor cells (HSPCs) using a DNeasy Blood and Tissue kit (Qiagen). To assess editing rates, “in-out” droplet digital PCR was performed with the forward primer binding within the AAV insert and the reverse primer binding the BTK locus outside the region of homology. A control amplicon of similar size was generated for the ActB gene to serve as a control. All reactions were performed in duplicate. The PCR reactions were partitioned into droplets using a QX200 Droplet Generator (Bio-Rad). Amplification was performed using ddPCR Supermix for Probes without UTP (Bio-Rad), 900 nM of primers, 250 nM of Probe, 50 ng of genomic DNA, and 1% DMSO. Droplets were analyzed on the QX200 Droplet Digital PCR System (Bio-Rad) using QuantaSoft software (Bio-Rad).

    [0082] FIG. 6 shows a schematic of AAV donor template expressing codon optimized BTK.

    [0083] FIG. 7 shows a comparison of ratio of HDR (homology directed repair) versus NHEJ (non-homologous end joining) in cells edited with TALEN plus AAV or RNP plus AAV.

    [0084] FIG. 8A is a schematic of the rAAV6 donor vector expressing codon optimized BTK cDNA from the endogenous promoter.

    [0085] FIG. 8B shows data from a single CD34.sup.+ donor demonstrating that ability to introduce the BTK cDNA into the endogenous BTK locus at levels predicted to readily provide clinical benefit in XLA.

    BRIEF DESCRIPTION OF THE SEQUENCE IDENTIFIERS

    [0086] SEQ ID NOs: 1-8 are TALEN target sites in the first and second introns of the human BTK gene.

    [0087] SEQ ID NOs: 9-17 are gRNA sequences G1-G9.

    [0088] SEQ ID NO: 18 is an amino acid sequence of a human BTK polypeptide.

    [0089] SEQ ID NOs: 19-24 are the sequences of an AAV targeting vectors for BTK locus.

    [0090] SEQ ID NOs: 25-35 are oligos and probes used for determining HDR in CD34+ cells either using RNP or TALEN plus AAV.MND.GFP vectors or using RNPs and ATG.coBTK expressing AAV vectors.

    DETAILED DESCRIPTION

    A. Overview

    [0091] The present disclosure generally relates to, in part, improved genome editing compositions and methods of use thereof. Without wishing to be bound by any particular theory, the genome editing compositions contemplated herein are used to increase the amount of Bruton's tyrosine kinase (BTK) in a cell to treat, prevent, or ameliorate symptoms associated with X-linked agammaglobulinemia (XLA). Thus, the compositions contemplated herein offer a potentially curative solution to subjects that have XLA. Without wishing to be bound to any particular theory, it is contemplated that a gene editing approach that introduces a polynucleotide encoding a functional BTK protein into a BTK gene that has one or more mutations and/or deletions that leads to XLA, will rescue the immunologic and functional deficits caused by XLA and to provide a potentially curative therapy.

    [0092] In various embodiments, genome editing strategies, compositions, genetically modified cells, and methods of use thereof to increase or restore BTK function are contemplated. Without wishing to be bound by any particular theory, it is contemplated that genome editing of the BTK gene to introduce a polynucleotide encoding a functional copy of the BTK protein. In one embodiment, editing the BTK gene comprises introducing a polynucleotide encoding a functional copy of the BTK protein in such a way that it is under control of the endogenous promoter and enhancer in hematopoietic stem cells (HSC). Restoration of functional BTK in immune cells will effectively treat, prevent, and/or ameliorate one or more symptoms associated with subjects that have XLA.

    [0093] Genome editing methods contemplated in various embodiments comprise TALEN (Transcription activator-like effector nuclease) variants designed to bind and cleave a target binding site in the BTK gene. The TALEN variants contemplated in particular embodiments, can be used to introduce a double-strand break in a target polynucleotide sequence, and in the presence of a polynucleotide template, e.g., a donor repair template, result in homology directed repair (HDR), i.e., homologous recombination of the donor repair template into the BTK gene. TALEN variants contemplated in certain embodiments, can also be designed as nickases, which generate single-stranded DNA breaks that can be repaired using the cell's base-excision-repair (BER) machinery or homologous recombination in the presence of a donor repair template. Homologous recombination requires homologous DNA as a template for repairing the double-stranded DNA break and can be leveraged to create a limitless variety of modifications specified by the introduction of donor DNA comprising an expression cassette or polynucleotide encoding a therapeutic gene, e.g., BTK, at the target site, flanked on either side by sequences bearing homology to regions flanking the target site.

    [0094] Genome editing methods contemplated in various other embodiments comprise CRISPR/Cas systems designed to bind and cleave a target binding site in the BTK gene. The CRISPR/Cas systems contemplated in particular embodiments, can be used to introduce a double-strand break in a target polynucleotide sequence, and in the presence of a polynucleotide template, e.g., a donor repair template, result in homology directed repair (HDR), i.e., homologous recombination of the donor repair template into the BTK gene. CRISPR/Cas systems complemplated in certain embodiments can also be guided to one or more cleavage sites by one or more guide RNAs (gRNAs). CRISPR/Cas systems contemplated in certain embodiments, can also be designed as nickases, which generate single-stranded DNA breaks that can be repaired using the cell's base-excision-repair (BER) machinery or homologous recombination in the presence of a donor repair template. Homologous recombination requires homologous DNA as a template for repairing the double-stranded DNA break and can be leveraged to create a limitless variety of modifications specified by the introduction of donor DNA comprising an expression cassette or polynucleotide encoding a therapeutic gene, e.g., BTK, at the target site, flanked on either side by sequences bearing homology to regions flanking the target site.

    [0095] In one preferred embodiment, the genome editing compositions contemplated herein comprise a Transcription activator-like effector nucleases (TALEN) that target the human BTK gene.

    [0096] In one preferred embodiment, the genome editing compositions contemplated herein comprise a CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats)/Cas (CRISPR Associated) nuclease systems that target the human BTK gene. In such embodiments, the site-directed nuclease is a CRISPR-associated endonuclease (a “Cas “endonuclease”) and the nucleic acid guide molecule is a guide RNA (gRNA).

    [0097] In various embodiments, wherein a DNA break is generated in the first or second intron of the BTK gene and a donor repair template, i.e., a donor repair template, comprising a polynucleotide encoding a functional BTK polypeptide is provided, the DSB is repaired with the sequence of the template by homologous recombination at the DNA break-site. In preferred embodiments, the repair template comprises a polynucleotide sequence that encodes a functional BTK polypeptide designed to be inserted at a site where the expression of the polynucleotide and BTK polypeptide is under the control of the endogenous BTK promoter and/or enhancers.

    [0098] In one preferred embodiment, the genome editing compositions contemplated herein comprise TALEN variants and one or more end-processing enzymes to increase HDR efficiency.

    [0099] In one preferred embodiment, the genome editing compositions contemplated herein comprise a TALEN or CRISPR/Cas nuclease system that targets a human BTK gene, a donor repair template encoding a functional BTK protein, and an end-processing enzyme, e.g., Trex2.

    [0100] In various embodiments, genome edited cells are contemplated. The genome edited cells comprise a functional BTK polypeptide, rescue B cell development, and prevent XLA.

    [0101] Accordingly, the methods and compositions contemplated herein represent a quantum improvement compared to existing gene editing strategies for the treatment of XLA.

    [0102] Techniques for recombinant (i.e., engineered) DNA, peptide and oligonucleotide synthesis, immunoassays, tissue culture, transformation (e.g., electroporation, lipofection), enzymatic reactions, purification and related techniques and procedures may be generally performed as described in various general and more specific references in microbiology, molecular biology, biochemistry, molecular genetics, cell biology, virology and immunology as cited and discussed throughout the present specification. See, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual, 3d ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Current Protocols in Molecular Biology (John Wiley and Sons, updated July 2008); Short Protocols in Molecular Biology: A Compendium of Methods from Current Protocols in Molecular Biology, Greene Pub. Associates and Wiley-Interscience; Glover, DNA Cloning: A Practical Approach, vol. I & II (IRL Press, Oxford Univ. Press USA, 1985); Current Protocols in Immunology (Edited by: John E. Coligan, Ada M. Kruisbeek, David H. Margulies, Ethan M. Shevach, Warren Strober 2001 John Wiley & Sons, NY, NY); Real-Time PCR: Current Technology and Applications, Edited by Julie Logan, Kirstin Edwards and Nick Saunders, 2009, Caister Academic Press, Norfolk, UK; Anand, Techniques for the Analysis of Complex Genomes, (Academic Press, New York, 1992); Guthrie and Fink, Guide to Yeast Genetics and Molecular Biology (Academic Press, New York, 1991); Oligonucleotide Synthesis (N. Gait, Ed., 1984); Nucleic Acid The Hybridization (B. Hames & S. Higgins, Eds., 1985); Transcription and Translation (B. Hames & S. Higgins, Eds., 1984); Animal Cell Culture (R. Freshney, Ed., 1986); Perbal, A Practical Guide to Molecular Cloning (1984); Next-Generation Genome Sequencing (Janitz, 2008 Wiley-VCH); PCR Protocols (Methods in Molecular Biology) (Park, Ed., 3rd Edition, 2010 Humana Press); Immobilized Cells And Enzymes (IRL Press, 1986); the treatise, Methods In Enzymology (Academic Press, Inc., N.Y.); Gene Transfer Vectors For Mammalian Cells (J. H. Miller and M. P. Calos eds., 1987, Cold Spring Harbor Laboratory); Harlow and Lane, Antibodies, (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1998); Immunochemical Methods In Cell And Molecular Biology (Mayer and Walker, eds., Academic Press, London, 1987); Handbook Of Experimental Immunology, Volumes I-IV (D. M. Weir and C C Blackwell, eds., 1986); Roitt, Essential Immunology, 6th Edition, (Blackwell Scientific Publications, Oxford, 1988); Current Protocols in Immunology (Q. E. Coligan, A. M. Kruisbeek, D. H. Margulies, E. M. Shevach and W. Strober, eds., 1991); Annual Review of Immunology; as well as monographs in journals such as Advances in Immunology.

    B. Definitions

    [0103] Prior to setting forth this disclosure in more detail, it may be helpful to an understanding thereof to provide definitions of certain terms to be used herein.

    [0104] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by those of ordinary skill in the art to which the invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of particular embodiments, preferred embodiments of compositions, methods and materials are described herein. For the purposes of the present disclosure, the following terms are defined below. Additional definitions are set forth throughout this disclosure.

    [0105] The articles “a,” “an,” and “the” are used herein to refer to one or to more than one (i.e., to at least one, or to one or more) of the grammatical object of the article. By way of example, “an element” means one element or one or more elements.

    [0106] The use of the alternative (e.g., “or”) should be understood to mean either one, both, or any combination thereof of the alternatives.

    [0107] The term “and/or” should be understood to mean either one, or both of the alternatives.

    [0108] As used herein, the term “about” or “approximately” refers to a quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length that varies by as much as 15%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2% or 1% to a reference quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length. In one embodiment, the term “about” or “approximately” refers a range of quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length ±15%, ±10%, ±9%, ±8%, ±7%, ±6%, ±5%, ±4%, ±3%, ±2%, or ±1% about a reference quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length.

    [0109] In one embodiment, a range, e.g., 1 to 5, about 1 to 5, or about 1 to about 5, refers to each numerical value encompassed by the range. For example, in one non-limiting and merely illustrative embodiment, the range “1 to 5” is equivalent to the expression 1, 2, 3, 4, 5; or 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, or 5.0; or 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, or 5.0.

    [0110] As used herein, the term “substantially” refers to a quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length that is 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher compared to a reference quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length. In one embodiment, “substantially the same” refers to a quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length that produces an effect, e.g., a physiological effect, that is approximately the same as a reference quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length.

    [0111] Throughout this specification, unless the context requires otherwise, the words “comprise”, “comprises” and “comprising” will be understood to imply the inclusion of a stated step or element or group of steps or elements but not the exclusion of any other step or element or group of steps or elements. By “consisting of” is meant including, and limited to, whatever follows the phrase “consisting of” Thus, the phrase “consisting of” indicates that the listed elements are required or mandatory, and that no other elements may be present. By “consisting essentially of” is meant including any elements listed after the phrase, and limited to other elements that do not interfere with or contribute to the activity or action specified in the disclosure for the listed elements. Thus, the phrase “consisting essentially of” indicates that the listed elements are required or mandatory, but that no other elements are present that materially affect the activity or action of the listed elements.

    [0112] Reference throughout this specification to “one embodiment,” “an embodiment,” “a particular embodiment,” “a related embodiment,” “a certain embodiment,” “an additional embodiment,” or “a further embodiment” or combinations thereof means that a particular feature, structure or characteristic described in connection with the embodiment is included in at least one embodiment. Thus, the appearances of the foregoing phrases in various places throughout this specification are not necessarily all referring to the same embodiment. Furthermore, the particular features, structures, or characteristics may be combined in any suitable manner in one or more embodiments. It is also understood that the positive recitation of a feature in one embodiment, serves as a basis for excluding the feature in a particular embodiment.

    [0113] The term “ex vivo” refers generally to activities that take place outside an organism, such as experimentation or measurements done in or on living tissue in an artificial environment outside the organism, preferably with minimum alteration of the natural conditions. In particular embodiments, “ex vivo” procedures involve living cells or tissues taken from an organism and cultured or modulated in a laboratory apparatus, usually under sterile conditions, and typically for a few hours or up to about 24 hours, but including up to 48 or 72 hours, depending on the circumstances. In certain embodiments, such tissues or cells can be collected and frozen, and later thawed for ex vivo treatment. Tissue culture experiments or procedures lasting longer than a few days using living cells or tissue are typically considered to be “in vitro,” though in certain embodiments, this term can be used interchangeably with ex vivo.

    [0114] The term “in vivo” refers generally to activities that take place inside an organism. In one embodiment, cellular genomes are engineered, edited, or modified in vivo.

    [0115] By “enhance” or “promote” or “increase” or “expand” or “potentiate” refers generally to the ability of a TALEN variant, genome editing composition, or genome edited cell contemplated herein to produce, elicit, or cause a greater response (i.e., physiological response) compared to the response caused by either vehicle or control. A measurable response may include an increase in HDR, and/or BTK expression, among others apparent from the understanding in the art and the description herein. An “increased” or “enhanced” amount is typically a “statistically significant” amount, and may include an increase that is 1.1, 1.2, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30 or more times (e.g., 500, 1000 times) (including all integers and decimal points in between and above 1, e.g., 1.5, 1.6, 1.7. 1.8, etc.) the response produced by vehicle or control.

    [0116] By “decrease” or “lower” or “lessen” or “reduce” or “abate” or “ablate” or “inhibit” or “dampen” refers generally to the ability of TALEN variant, CRISPR/Cas system, genome editing composition, or genome edited cell contemplated herein to produce, elicit, or cause a lesser response (i.e., physiological response) compared to the response caused by either vehicle or control. A measurable response may include a decrease in one or more symptoms associated with XLA. A “decrease” or “reduced” amount is typically a “statistically significant” amount, and may include a decrease that is 1.1, 1.2, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30 or more times (e.g., 500, 1000 times) (including all integers and decimal points in between and above 1, e.g., 1.5, 1.6, 1.7. 1.8, etc.) the response (reference response) produced by vehicle, or control.

    [0117] By “maintain,” or “preserve,” or “maintenance,” or “no change,” or “no substantial change,” or “no substantial decrease” refers generally to the ability of a TALEN variant, genome editing composition, or genome edited cell contemplated herein to produce, elicit, or cause a substantially similar or comparable physiological response (i.e., downstream effects) in as compared to the response caused by either vehicle or control. A comparable response is one that is not significantly different or measurable different from the reference response.

    [0118] The terms “specific binding affinity” or “specifically binds” or “specifically bound” or “specific binding” or “specifically targets” as used herein, describe binding of one molecule to another, e.g., DNA binding domain of a polypeptide binding to DNA, at greater binding affinity than background binding. A binding domain “specifically binds” to a target site if it binds to or associates with a target site with an affinity or K.sub.a (i.e., an equilibrium association constant of a particular binding interaction with units of 1/M) of, for example, greater than or equal to about 10.sup.5M.sup.−1. In certain embodiments, a binding domain binds to a target site with a K.sub.a greater than or equal to about 10.sup.6 M.sup.−1, 10.sup.7 M.sup.−1, 10.sup.8 M.sup.−1, 10.sup.9M.sup.−1, 10.sup.10 M.sup.−1, 10.sup.11M.sup.−1, 10.sup.12 M.sup.−1, or 10.sup.13M.sup.−1. “High affinity” binding domains refers to those binding domains with a K.sub.a of at least 10.sup.7 M.sup.−1, at least 10.sup.8M.sup.−1, at least 10.sup.9 M.sup.−1, at least 10.sup.10 M.sup.−1, at least 10.sup.11M.sup.−1, at least 10.sup.12 M.sup.−1, at least 10.sup.13M.sup.−1, or greater.

    [0119] Alternatively, affinity may be defined as an equilibrium dissociation constant (K.sub.a) of a particular binding interaction with units of M (e.g., 10.sup.−5M to 10.sup.−13 M, or less). Affinities of TALEN variants comprising one or more DNA binding domains for DNA target sites contemplated in particular embodiments can be readily determined using conventional techniques, e.g., yeast cell surface display, or by binding association, or displacement assays using labeled ligands.

    [0120] In one embodiment, the affinity of specific binding is about 2 times greater than background binding, about 5 times greater than background binding, about 10 times greater than background binding, about 20 times greater than background binding, about 50 times greater than background binding, about 100 times greater than background binding, or about 1000 times greater than background binding or more.

    [0121] The terms “selectively binds” or “selectively bound” or “selectively binding” or “selectively targets” and describe preferential binding of one molecule to a target molecule (on-target binding) in the presence of a plurality of off-target molecules. In particular embodiments, a TALEN selectively binds an on-target DNA binding site about 5, 10, 15, 20, 25, 50, 100, or 1000 times more frequently than the TALEN binds an off-target DNA target binding site.

    [0122] “On-target” refers to a target site sequence.

    [0123] “Off-target” refers to a sequence similar to but not identical to a target site sequence.

    [0124] A “target site” or “target sequence” is a chromosomal or extrachromosomal nucleic acid sequence that defines a portion of a nucleic acid to which a binding molecule will bind and/or cleave, provided sufficient conditions for binding and/or cleavage exist. When referring to a polynucleotide sequence or SEQ ID NO. that references only one strand of a target site or target sequence, it would be understood that the target site or target sequence bound and/or cleaved by a TALEN variant or CRISPR/Cas system is double-stranded and comprises the reference sequence and its complement. In a preferred embodiment, the target site is a sequence in the human BTK gene.

    [0125] “Recombination” refers to a process of exchange of genetic information between two polynucleotides, including but not limited to, donor capture by non-homologous end joining (NHEJ) and homologous recombination. For the purposes of this disclosure, “homologous recombination (HR)” refers to the specialized form of such exchange that takes place, for example, during repair of double-strand breaks in cells via homology-directed repair (HDR) mechanisms. This process requires nucleotide sequence homology, uses a “donor” molecule as a template to repair a “target” molecule (i.e., the one that experienced the double-strand break), and is variously known as “non-crossover gene conversion” or “short tract gene conversion,” because it leads to the transfer of genetic information from the donor to the target. Without wishing to be bound by any particular theory, such transfer can involve mismatch correction of heteroduplex DNA that forms between the broken target and the donor, and/or “synthesis-dependent strand annealing,” in which the donor is used to resynthesize genetic information that will become part of the target, and/or related processes. Such specialized HR often results in an alteration of the sequence of the target molecule such that part or all of the sequence of the donor polynucleotide is incorporated into the target polynucleotide.

    [0126] “Cleavage” refers to the breakage of the covalent backbone of a DNA molecule. Cleavage can be initiated by a variety of methods including, but not limited to, enzymatic or chemical hydrolysis of a phosphodiester bond. Both single-stranded cleavage and double-stranded cleavage are possible. Double-stranded cleavage can occur as a result of two distinct single-stranded cleavage events. DNA cleavage can result in the production of either blunt ends or staggered ends. In certain embodiments, polypeptides and TALENs variants, e.g., TALENs, etc. contemplated herein are used for targeted double-stranded DNA cleavage. Endonuclease cleavage recognition sites may be on either DNA strand or both DNA strands.

    [0127] An “exogenous” molecule is a molecule that is not normally present in a cell, but that is introduced into a cell by one or more genetic, biochemical or other methods. Exemplary exogenous molecules include, but are not limited to small organic molecules, protein, nucleic acid, carbohydrate, lipid, glycoprotein, lipoprotein, polysaccharide, any modified derivative of the above molecules, or any complex comprising one or more of the above molecules. Methods for the introduction of exogenous molecules into cells are known to those of skill in the art and include, but are not limited to, lipid-mediated transfer (i.e., liposomes, including neutral and cationic lipids), electroporation, direct injection, cell fusion, particle bombardment, biopolymer nanoparticle, calcium phosphate co-precipitation, DEAE-dextran-mediated transfer and viral vector-mediated transfer.

    [0128] An “endogenous” molecule is one that is normally present in a particular cell at a particular developmental stage under particular environmental conditions. Additional endogenous molecules can include proteins.

    [0129] A “gene,” refers to a DNA region encoding a gene product, as well as all DNA regions which regulate the production of the gene product, whether or not such regulatory sequences are adjacent to coding and/or transcribed sequences. A gene includes, but is not limited to, promoter sequences, enhancers, silencers, insulators, boundary elements, terminators, polyadenylation sequences, post-transcription response elements, translational regulatory sequences such as ribosome binding sites and internal ribosome entry sites, replication origins, matrix attachment sites, and locus control regions.

    [0130] “Gene expression” refers to the conversion of the information, contained in a gene, into a gene product. A gene product can be the direct transcriptional product of a gene (e.g., mRNA, tRNA, rRNA, antisense RNA, ribozyme, structural RNA or any other type of RNA) or a protein produced by translation of an mRNA. Gene products also include RNAs which are modified, by processes such as capping, polyadenylation, methylation, and editing, and proteins modified by, for example, methylation, acetylation, phosphorylation, ubiquitination, ADP-ribosylation, myristilation, and glycosylation.

    [0131] As used herein, the term “genetically engineered” or “genetically modified” refers to the chromosomal or extrachromosomal addition of extra genetic material in the form of DNA or RNA to the total genetic material in a cell. Genetic modifications may be targeted or non-targeted to a particular site in a cell's genome. In one embodiment, genetic modification is site specific. In one embodiment, genetic modification is not site specific.

    [0132] As used herein, the term “genome editing” refers to the substitution, deletion, and/or introduction of genetic material at a target site in the cell's genome, which restores, corrects, disrupts, and/or modifies expression of a gene or gene product. Genome editing contemplated in particular embodiments comprises introducing one or more TALEN variants into a cell to generate DNA lesions at or proximal to a target site in the cell's genome, optionally in the presence of a donor repair template.

    [0133] As used herein, the term “gene therapy” refers to the introduction of extra genetic material into the total genetic material in a cell that restores, corrects, or modifies expression of a gene or gene product, or for the purpose of expressing a therapeutic polypeptide. In particular embodiments, introduction of genetic material into the cell's genome by genome editing that restores, corrects, disrupts, or modifies expression of a gene or gene product, or for the purpose of expressing a therapeutic polypeptide is considered gene therapy.

    C. TALEN-Based Systems

    [0134] TALEN variants contemplated in particular embodiments herein that are suitable for genome editing a target site in the BTK gene comprise one or more DNA binding domains and one or more DNA cleavage domains (e.g., one or more endonuclease and/or exonuclease domains), and optionally, one or more linkers contemplated herein. The terms “reprogrammed nuclease,” “engineered nuclease,” “nuclease variant,” or “TALEN variant” are used interchangeably and refer to a TALEN comprising one or more DNA binding domains and one or more DNA cleavage domains, wherein the TALEN has been designed and/or modified from a parental or naturally occurring TALEN, to bind and cleave a double-stranded DNA target sequence in a BTK gene, preferably a target sequence in the first or second intron of the human BTK gene, and more preferably a target sequence in the first or second intron of the human BTK gene as set forth in SEQ ID NOS: 1-8. The TALEN variant may be designed and/or modified from a naturally occurring effector domain or from a previous TALEN variant. TALEN variants contemplated in particular embodiments may further comprise one or more additional functional domains, e.g., an end-processing enzymatic domain of an end-processing enzyme that exhibits 5′-3′ exonuclease, 5′-3′ alkaline exonuclease, 3′-5′exonuclease (e.g., Trex2), 5′ flap endonuclease, helicase, template-dependent DNA polymerase or template-independent DNA polymerase activity.

    [0135] In various embodiments, a TALEN is reprogrammed to introduce double-strand breaks (DSBs) in a BTK gene, preferably a target sequence in the first or second intron of the human BTK gene, and more preferably a target sequence in the first or second intron of the human BTK gene as set forth in SEQ ID NOS: 1-8. “TALEN” refers to a protein comprising a TAL effector DNA binding domain and an enzymatic domain. They are made by fusing a TAL effector DNA-binding domain to a DNA cleavage domain (a nuclease which cuts DNA strands). The FokI restriction enzyme described above is an exemplary enzymatic domain suitable for use in TALEN-based gene regulating systems.

    [0136] TAL effectors are proteins that are secreted by Xanthomonas bacteria via their type III secretion system when they infect plants. The DNA binding domain contains a repeated, highly conserved, 33-34 amino acid sequence with divergent 12th and 13th amino acids. These two positions, referred to as the Repeat Variable Diresidue (RVD), are highly variable and strongly correlated with specific nucleotide recognition. Therefore, the TAL effector domains can be engineered to bind specific target DNA sequences by selecting a combination of repeat segments containing the appropriate RVDs. The nucleic acid specificity for RVD combinations is as follows: HD targets cytosine, NI targets adenenine, NG targets thymine, and NN targets guanine (though, in some embodiments, NN can also bind adenenine with lower specificity).

    [0137] In some embodiments, the TAL effector domains bind to a target DNA sequence that is at least 90% identical to a target DNA sequence within a target locus of the BTK gene. In some embodiments, the TAL effector domains bind to a target DNA sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to a target DNA sequence within a target locus of a target gene selected those listed in Table 1. In some embodiments, the TAL effector domains bind to a target DNA sequence that is 100% identical to a target DNA sequence within a target locus of a target gene selected those listed in Table 1.

    [0138] In some embodiments, the TAL effector domains bind to a target DNA sequence that is at least 90% identical to a target DNA sequence within a target locus within an exon or within an intron of the BTK gene, preferably within the second or third exon of the BTK gene. In some embodiments, the TAL effector domains bind to a target DNA sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to a target DNA sequence within a target locus within an exon or within an intron of the BTK gene, preferably within the second or third exon of the BTK gene. In some embodiments, the TAL effector domains bind to a target DNA sequence that is 100% identical to a target DNA sequence within a target locus within an exon or within an intron of the BTK gene, preferably within the second or third exon of the BTK gene.

    [0139] In some embodiments, the TAL effector domains bind to a target DNA sequence that is at least 90% identical to one of SEQ ID NOS: 1-8. In some embodiments, the TAL effector domains bind to a target DNA sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to one of SEQ ID NOS: 1-8. In some embodiments, the TAL effector domains bind to a target DNA sequence that is 100% identical to one of SEQ ID NOS: 1-8.

    [0140] In some embodiments, the TAL effector domains bind to a target DNA sequence that is at least 90% identical to a target DNA sequence within a target locus of the BTK gene. In some embodiments, the TAL effector domains bind to a target DNA sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to a target DNA sequence within a target locus of a target gene selected those listed in Table 1. In some embodiments, the TAL effector domains bind to a target DNA sequence that is 100% identical to a target DNA sequence within a target locus of a target gene selected those listed in Table 1.

    TABLE-US-00001 TABLE 1 Target Sites SEQ ID NO: 1 TALEN TCTCGACTA 1-F target site TGAAAACT SEQ ID NO: 2 TALEN TCTAAGGC 1-R target site CAAGTCCT SEQ ID NO: 3 TALEN TATCAAGGA 2-F target site CTTGGCCT SEQ ID NO: 4 TALEN TACCAACGAA 2-R target site AATTTACCT SEQ ID NO: 5 TALEN TATTTCCTAG 3-F target site CCTATAACT SEQ ID NO: 6 TALEN TGGCTTCTT 3-R target site AGGACCTTT SEQ ID NO: 7 TALEN CCATTTGA 4-F target site AACTAGGT SEQ ID NO: 8 TALEN CCTCATCCC 4-R target site TCTTGGTT

    [0141] In some embodiments, the TAL effector domains bind to a target DNA sequence that is at least 90% identical to a target DNA sequence within a target locus within an exon or within an intron of the BTK gene, preferably within the second or third exon of the BTK gene. In some embodiments, the TAL effector domains bind to a target DNA sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to a target DNA sequence within a target locus within an exon or within an intron of the BTK gene, preferably within the second or third exon of the BTK gene. In some embodiments, the TAL effector domains bind to a target DNA sequence that is 100% identical to a target DNA sequence within a target locus within an exon or within an intron of the BTK gene, preferably within the second or third exon of the BTK gene.

    [0142] In some embodiments, the TAL effector domains bind to a target DNA sequence that is at least 90% identical to one of SEQ ID NOS: 1-8. In some embodiments, the TAL effector domains bind to a target DNA sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to one of SEQ ID NOS: 1-8. In some embodiments, the TAL effector domains bind to a target DNA sequence that is 100% identical to one of SEQ ID NOS: 1-8.

    [0143] In some embodiments, the gene editing composition comprises two or more TAL effector-fusion proteins each comprising a TAL effector domain, wherein at least one of the TAL effector domains bind to a target DNA sequence that is at least 90% identical to a target DNA sequence within a target locus of the BTK gene. In some embodiments, the gene editing composition comprises two or more TAL effector-fusion proteins each comprising a TAL effector domain, wherein at least one of the TAL effector domains bind to a target DNA sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to a target DNA sequence within a target locus of a target gene selected those listed in Table 1. In some embodiments, the gene editing composition comprises two or more TAL effector-fusion proteins each comprising a TAL effector domain, wherein at least one of the TAL effector domains bind to a target DNA sequence that is 100% identical to a target DNA sequence within a target locus of a target gene selected those listed in Table 1. In some embodiments, the gene editing composition comprises two or more TAL effector-fusion proteins each comprising a TAL effector domain, wherein at least one of the TAL effector domains bind bind to a target DNA sequence that is at least 90% identical to a target DNA sequence within a target locus within an exon or within an intron of the BTK gene, preferably within the second or third exon of the BTK gene. In some embodiments, the gene editing composition comprises two or more TAL effector-fusion proteins each comprising a TAL effector domain, wherein at least one of the TAL effector domains bind to a target DNA sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to a target DNA sequence within a target locus within an exon or within an intron of the BTK gene, preferably within the second or third exon of the BTK gene. In some embodiments, the gene editing composition comprises two or more TAL effector-fusion proteins each comprising a TAL effector domain, wherein at least one of the TAL effector domains bind to a target DNA sequence that is 100% identical to a target DNA sequence within a target locus within an exon or within an intron of the BTK gene, preferably within the second or third exon of the BTK gene.

    [0144] In some embodiments, the gene editing composition comprises two or more TAL effector-fusion proteins each comprising a TAL effector domain, wherein at least one of the TAL effector domains bind to a target DNA sequence that is at least 90% identical to one of SEQ ID NOS: 1-8. In some embodiments, the gene editing composition comprises two or more TAL effector-fusion proteins each comprising a TAL effector domain, wherein at least one of the TAL effector domains bind to a target DNA sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to one of SEQ ID NOS: 1-8. In some embodiments, the gene editing composition comprises two or more TAL effector-fusion proteins each comprising a TAL effector domain, wherein at least one of the TAL effector domains bind to a target DNA sequence that is 100% identical to one of SEQ ID NOS: 1-8.

    [0145] In some embodiments, the TAL effectors domain comprises RVD sequences as shown in Table 2.

    TABLE-US-00002 TABLE 2 TAL effector domain RVDs T1 (#1181) T1-F RVDs HD NG HD NN NI HD NG NI NG NN NI NI NI NI HD NG T1-R RVDs HD NG NI NI NN NN HD HD NI NI NN NG HD HD NG T2 (#1182) T2-F RVDs NI NG HD NI NI NN NN NI HD NG NG NN NN HD HD NG T2-R RVDs NI HD HD NI NI HD NN NI NI NI NI NG NG NG NI HD HD NG T3 (#1183) T3-F RVDs NI NG NG NG HD HD NG NI NN HD HD NG NI NG NI NI HD NG T3-R RVDs NN NN HD NG NG HD NG NG NI NN NN NI HD HD NG NG NG T4 T4-F RVDs HD HD NI NG NG NG NN NI NI NI HD NG NI NN NN NG T4-R RVDs HD HD NG HD NI NG HD HD HD NG HD NG NG NN NN NG NG

    [0146] Methods and compositions for assembling the TAL-effector repeats are known in the art. See e.g., Cermak et al, Nucleic Acids Research, 39:12, 2011, e82. Plasmids for constructions of the TAL-effector repeats are commercially available from Addgene.

    D. CRISPR/Cas-Based Systems

    [0147] Combination gene-regulating systems comprise a site-directed modifying polypeptide and a nucleic acid guide molecule. Herein, a “site-directed modifying polypeptide” refers to a polypeptide that binds to a nucleic acid guide molecule, is targeted to a target nucleic acid sequence, such as, for example, a DNA sequence, by the nucleic acid guide molecule to which it is bound, and modifies the target DNA sequence (e.g., cleavage, mutation, or methylation of target DNA). A site-directed modifying polypeptide comprises two portions, a portion that binds the nucleic acid guide and an activity portion. In some embodiments, a site-directed modifying polypeptide comprises an activity portion that exhibits site-directed enzymatic activity (e.g., DNA methylation, DNA cleavage, histone acetylation, histone methylation, etc.), wherein the site of enzymatic activity is determined by the guide nucleic acid. In some cases, a site-directed modifying polypeptide has enzymatic activity that modifies target DNA (e.g., nuclease activity, methyltransferase activity, demethylase activity, DNA repair activity, DNA damage activity, deamination activity, dismutase activity, alkylation activity, depurination activity, oxidation activity, pyrimidine dimer forming activity, integrase activity, transposase activity, recombinase activity, polymerase activity, ligase activity, helicase activity, photolyase activity or glycosylase activity). In other cases, a site-directed modifying polypeptide has enzymatic activity that modifies a polypeptide (e.g., a histone) associated with target DNA (e.g., methyltransferase activity, demethylase activity, acetyltransferase activity, deacetylase activity, kinase activity, phosphatase activity, ubiquitin ligase activity, deubiquitinating activity, adenylation activity, deadenylation activity, SUMOylating activity, deSUMOylating activity, ribosylation activity, deribosylation activity, myristoylation activity or demyristoylation activity). In some embodiments, the activity portion modulates transcription of the target DNA sequence (e.g., to increase or decrease transcription).

    [0148] The nucleic acid guide comprises two portions: a first portion that is complementary to, and capable of binding with, an endogenous target DNA sequence (referred to herein as a “DNA-binding segment”), and a second portion that is capable of interacting with the site-directed modifying polypeptide (referred to herein as a “protein-binding segment”). In some embodiments, the DNA-binding segment and protein-binding segment of a nucleic acid guide are comprised within a single polynucleotide molecule. In some embodiments, the DNA-binding segment and protein-binding segment of a nucleic acid guide are each comprised within separate polynucleotide molecules, such that the nucleic acid guide comprises two polynucleotide molecules that associate with each other to form the functional guide.

    [0149] The nucleic acid guide mediates the target specificity of the combined protein/nucleic gene regulating systems by specifically hybridizing with a target DNA sequence comprised within the DNA sequence of a target gene. Reference herein to a target gene encompasses the full-length DNA sequence for that particular gene and a full-length DNA sequence for a particular target gene will comprise a plurality of target genetic loci, which refer to portions of a particular target gene sequence (e.g., an exon or an intron). Within each target genetic loci are shorter stretches of DNA sequences referred to herein as “target DNA sequences” or “target sequences” that can be modified by the gene-regulating systems described herein. Further, each target genetic loci comprises a “target modification site,” which refers to the precise location of the modification induced by the gene-regulating system (e.g., the location of an insertion, a deletion, or mutation, the location of a DNA break, or the location of an epigenetic modification). The gene-regulating systems described herein may comprise a single nucleic acid guide, or may comprise a plurality of nucleic acid guides (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, or more nucleic acid guides).

    [0150] The CRISPR/Cas systems described below are exemplary embodiments of a combination protein/nucleic acid system.

    [0151] In some embodiments, the gene editing systems described herein are CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats)/Cas (CRISPR Associated) nuclease systems. In such embodiments, the site-directed modifying polypeptide is a CRISPR-associated endonuclease (a “Cas” endonuclease) and the nucleic acid guide molecule is a guide RNA (gRNA).

    [0152] A Cas polypeptide refers to a polypeptide that can interact with a gRNA molecule and, in concert with the gRNA molecule, homes or localizes to a target DNA sequence and includes naturally occurring Cas proteins and engineered, altered, or otherwise modified Cas proteins that differ by one or more amino acid residues from a naturally-occurring Cas sequence.

    [0153] In some embodiments, the Cas protein is a Cas9 protein. Cas9 is a multi-domain enzyme that uses an HNH nuclease domain to cleave the target strand of DNA and a RuvC-like domain to cleave the non-target strand. In some embodiments, mutants of Cas9 can be generated by selective domain inactivation enabling the conversion of WT Cas9 into an enzymatically inactive mutant (e.g., dCas9), which is unable to cleave DNA, or a nickase mutant, which is able to produce single-stranded DNA breaks by cleaving one or the other of the target or non-target strand.

    [0154] A guide RNA (gRNA) comprises two segments, a DNA-binding segment and a protein-binding segment. In some embodiments, the protein-binding segment of a gRNA is comprised in one RNA molecule and the DNA-binding segment is comprised in another separate RNA molecule. Such embodiments are referred to herein as “double-molecule gRNAs” or “two-molecule gRNA” or “dual gRNAs.” In some embodiments, the gRNA is a single RNA molecule and is referred to herein as a “single-guide RNA” or an “sgRNA.” The term “guide RNA” or “gRNA” is inclusive, referring both to two-molecule guide RNAs and sgRNAs.

    [0155] The protein-binding segment of a gRNA comprises, in part, two complementary stretches of nucleotides that hybridize to one another to form a double stranded RNA duplex (dsRNA duplex), which facilitates binding to the Cas protein.

    [0156] The DNA-binding segment (or “DNA-binding sequence”) of a gRNA comprises a nucleotide sequence that is complementary to and capable of binding to a specific sequence target DNA sequence. The protein-binding segment of the gRNA interacts with a Cas polypeptide and the interaction of the gRNA molecule and site-directed modifying polypeptide results in Cas binding to the endogenous DNA and produces one or more modifications within or around the target DNA sequence. The precise location of the target modification site is determined by both (i) base-pairing complementarity between the gRNA and the target DNA sequence; and (ii) the location of a short motif, referred to as the protospacer adjacent motif (PAM), in the target DNA sequence. The PAM sequence is required for Cas binding to the target DNA sequence. A variety of PAM sequences are known in the art and are suitable for use with a particular Cas endonuclease (e.g., a Cas9 endonuclease) are known in the art (See e.g., Nat Methods. 2013 November; 10(11): 1116-1121 and Sci Rep. 2014; 4: 5405). In some embodiments, the PAM sequence is located within 50 base pairs of the target modification site. In some embodiments, the PAM sequence is located within 10 base pairs of the target modification site. The DNA sequences that can be targeted by this method are limited only by the relative distance of the PAM sequence to the target modification site and the presence of a unique 20 base pair sequence to mediate sequence-specific, gRNA-mediated Cas binding. In some embodiments, the target modification site is located at the 5′ terminus of the target locus. In some embodiments, the target modification site is located at the 3′ end of the target locus. In some embodiments, the target modification site is located within an intron or an exon of the target locus.

    [0157] In some embodiments, the present disclosure provides a polynucleotide encoding a gRNA. In some embodiments, a gRNA-encoding nucleic acid is comprised in an expression vector, e.g., a recombinant expression vector. In some embodiments, the present disclosure provides a polynucleotide encoding a site-directed modifying polypeptide. In some embodiments, the polynucleotide encoding a site-directed modifying polypeptide is comprised in an expression vector, e.g., a recombinant expression vector.

    [0158] Cas Proteins

    [0159] In some embodiments, the site-directed modifying polypeptide is a Cas protein. Cas molecules of a variety of species can be used in the methods and compositions described herein, including Cas molecules derived from S. pyogenes, S. aureus, N. meningitidis, S. thermophiles, Acidovorax avenae, Actinobacillus pleuropneumoniae, Actinobacillus succinogenes, Actinobacillus suis, Actinomyces sp., Cychphilusdenitrificans, Aminomonas paucivorans, Bacillus cereus, Bacillus smithii, Bacillus thuringiensis, Bacteroides sp., Blastopirellula marina, Bradyrhizobium sp., Brevibacillus laterospoxus, Campylobacter coli, Campylobacter jejuni, Campylobacter lari, Candidatus puniceispirillum, Clostridium cellulolyticum, Clostridium perfringens, Corynebacterium accolens, Corynebacterium diphtheria, Corynebacterium matruchotii, Dinoroseobacter shibae, Eubacterium dolichum, Gammaproteobacterium, Gluconacetobacter diazotrophicus, Haemophilus parainjluenzae, Haemophilus sputomm, Helicobacter canadensis, Helicobacter cinaedi, Helicobacter mustelae, Ilyobacter polytropus, Kingella kingae, Lactobacillus crispatus, Listeria ivanovii, Listeria monocytogenes, Listeriaceae bacterium, Methylocystis sp., Methylosinus trichosporium, Mobiluncus mulieris, Neisseria bacilliformis, Neisseria cinerea, Neisseria flavescens, Neisseria lactamica, Neisseria meningitidis, Neisseria sp., Neisseria wadsworthii, Nitrosomonas sp., Parvibaculum lavamentivorans, Pasteurella multocida, Phascolarctobacterium succinatutens, Ralstonia syzygii, Rhodopseudomonas palustris, Rhodovulum sp., Simonsiella muelleri, Sphingomonas sp., Sporolactobacillus vineae, Staphylococcus aureus, Staphylococcus lugdunensis, Streptococcus sp., Subdoligranulum sp., Tistrella mobilis, Treponema sp., or Verminephrobacter eiseniae.

    [0160] In some embodiments, the Cas protein is a Cas9 protein or a Cas9 ortholog and is selected from the group consisting of SpCas9, SpCas9-HF1, SpCas9-HF2, SpCas9-HF3, SpCas9-HF4, SaCas9, FnCpf, FnCas9, eSpCas9, and NmeCas9. In some embodiments, the endonuclease is selected from the group consisting of C2C1, C2C3, Cpf1 (also referred to as Cas12a), Casl, CaslB, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9 (also known as Csnl and Csx12), Cas10, Csyl, Csy2, Csy3, Csel, Cse2, Cscl, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmrl, Cmr3, Cmr4, Cmr5, Cmr6, Csbl, Csb2, Csb3, Csx17, Csxl4, Csx10, Csx16, CsaX, Csx3, Csxl, Csx15, Csfl, Csf2, Csf3, and Csf4. Additional Cas9 orthologs are described in International PCT Publication No. WO 2015/071474.

    [0161] In some embodiments, the Cas9 protein is a naturally-occurring Cas9 protein. Exemplary naturally occurring Cas9 molecules are described in Chylinski et al., RNA Biology 2013 10:5, 727-737. Such Cas9 molecules include Cas9 molecules of a cluster 1 bacterial family, cluster 2 bacterial family, cluster 3 bacterial family, cluster 4 bacterial family, cluster 5 bacterial family, cluster 6 bacterial family, a cluster 7 bacterial family, a cluster 8 bacterial family, a cluster 9 bacterial family, a cluster 10 bacterial family, a cluster 1 1 bacterial family, a cluster 12 bacterial family, a cluster 13 bacterial family, a cluster 14 bacterial family, a cluster 15 bacterial family, a cluster 16 bacterial family, a cluster 17 bacterial family, a cluster 18 bacterial family, a cluster 19 bacterial family, a cluster 20 bacterial family, a cluster 21 bacterial family, a cluster 22 bacterial family, a cluster 23 bacterial family, a cluster 24 bacterial family, a cluster 25 bacterial family, a cluster 26 bacterial family, a cluster 27 bacterial family, a cluster 28 bacterial family, a cluster 29 bacterial family, a cluster 30 bacterial family, a cluster 31 bacterial family, a cluster 32 bacterial family, a cluster 33 bacterial family, a cluster 34 bacterial family, a cluster 35 bacterial family, a cluster 36 bacterial family, a cluster 37 bacterial family, a cluster 38 bacterial family, a cluster 39 bacterial family, a cluster 40 bacterial family, a cluster 41 bacterial family, a cluster 42 bacterial family, a cluster 43 bacterial family, a cluster 44 bacterial family, a cluster 45 bacterial family, a cluster 46 bacterial family, a cluster 47 bacterial family, a cluster 48 bacterial family, a cluster 49 bacterial family, a cluster 50 bacterial family, a cluster 51 bacterial family, a cluster 52 bacterial family, a cluster 53 bacterial family, a cluster 54 bacterial family, a cluster 55 bacterial family, a cluster 56 bacterial family, a cluster 57 bacterial family, a cluster 58 bacterial family, a cluster 59 bacterial family, a cluster 60 bacterial family, a cluster 61 bacterial family, a cluster 62 bacterial family, a cluster 63 bacterial family, a cluster 64 bacterial family, a cluster 65 bacterial family, a cluster 66 bacterial family, a cluster 67 bacterial family, a cluster 68 bacterial family, a cluster 69 bacterial family, a cluster 70 bacterial family, a cluster 71 bacterial family, a cluster 72 bacterial family, a cluster 73 bacterial family, a cluster 74 bacterial family, a cluster 75 bacterial family, a cluster 76 bacterial family, a cluster 77 bacterial family, or a cluster 78 bacterial family.

    [0162] In some embodiments, a Cas9 protein comprises an amino acid sequence having at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a Cas9 amino acid sequence described in Chylinski et al., RNA Biology 2013 10:5, 727-737; Hou et al., PNAS Early Edition 2013, 1-6).

    [0163] In some embodiments, a Cas polypeptide comprises one or more of the following activities: [0164] a) a nickase activity, i.e., the ability to cleave a single strand, e.g., the non-complementary strand or the complementary strand, of a nucleic acid molecule; [0165] b) a double stranded nuclease activity, i.e., the ability to cleave both strands of a double stranded nucleic acid and create a double stranded break, which in an embodiment is the presence of two nickase activities; [0166] c) an endonuclease activity; [0167] d) an exonuclease activity; and/or [0168] e) a helicase activity, i.e., the ability to unwind the helical structure of a double stranded nucleic acid.

    [0169] In some embodiments, the Cas9 is a wildtype (WT) Cas9 protein or ortholog. WT Cas9 comprises two catalytically active domains (HNH and RuvC). Binding of WT Cas9 to DNA based on gRNA specificity results in double-stranded DNA breaks that can be repaired by non-homologous end joining (NHEJ) or homology-directed repair (HDR). In some embodiments, Cas9 is fused to heterologous proteins that recruit DNA-damage signaling proteins, exonucleases, or phosphatases to further increase the likelihood or the rate of repair of the target sequence by one repair mechanism or another. In some embodiments, a WT Cas9 is co-expressed with a nucleic acid repair template to facilitate the incorporation of an exogenous nucleic acid sequence by homology-directed repair.

    [0170] In some embodiments, different Cas9 proteins (i.e., Cas9 proteins from various species) may be advantageous to use in the various provided methods in order to capitalize on various enzymatic characteristics of the different Cas9 proteins (e.g., for different PAM sequence preferences; for increased or decreased enzymatic activity; for an increased or decreased level of cellular toxicity; to change the balance between NHEJ, homology-directed repair, single strand breaks, double strand breaks, etc.).

    [0171] In some embodiments, the Cas protein is a Cas9 protein derived from S. pyogenes and recognizes the PAM sequence motif NGG, NAG, NGA (Mali et al, Science 2013; 339(6121): 823-826). In some embodiments, the Cas protein is a Cas9 protein derived from S. thermophiles and recognizes the PAM sequence motif NGGNG and/or NNAGAAW (W=A or T) (See, e.g., Horvath et al, Science, 2010; 327(5962): 167-170, and Deveau et al, J BACTERIOL 2008; 190(4): 1390-1400). In some embodiments, the Cas protein is a Cas9 protein derived from S. mutans and recognizes the PAM sequence motif NGG and/or NAAR (R=A or G) (See, e.g., Deveau et al, J BACTERIOL 2008; 190(4): 1390-1400). In some embodiments, the Cas protein is a Cas9 protein derived from S. aureus and recognizes the PAM sequence motif NNGRR (R=A or G). In some embodiments, the Cas protein is a Cas9 protein derived from S. aureus and recognizes the PAM sequence motif N GRRT (R=A or G). In some embodiments, the Cas protein is a Cas9 protein derived from S. aureus and recognizes the PAM sequence motif N GRRV (R=A or G). In some embodiments, the Cas protein is a Cas9 protein derived from N. meningitidis and recognizes the PAM sequence motif N GATT or N GCTT (R=A or G, V=A, G or C) (See, e.g., Hou et ah, PNAS 2013, 1-6). In the aforementioned embodiments, N can be any nucleotide residue, e.g., any of A, G, C or T.

    [0172] In some embodiments, a polynucleotide encoding a Cas protein is provided. In some embodiments, the polynucleotide encodes a Cas protein that is at least 90% identical to a Cas protein described in International PCT Publication No. WO 2015/071474 or Chylinski et al., RNA Biology 2013 10:5, 727-737. In some embodiments, the polynucleotide encodes a Cas protein that is at least 95%, 96%, 97%, 98%, or 99% identical to a Cas protein described in International PCT Publication No. WO 2015/071474 or Chylinski et al., RNA Biology 2013 10:5, 727-737. In some embodiments, the polynucleotide encodes a Cas protein that is 100% identical to a Cas protein described in International PCT Publication No. WO 2015/071474 or Chylinski et al., RNA Biology 2013 10:5, 727-737.

    [0173] Cas Mutants

    [0174] In some embodiments, the Cas polypeptides are engineered to alter one or more properties of the Cas polypeptide. For example, in some embodiments, the Cas polypeptide comprises altered enzymatic properties, e.g., altered nuclease activity, (as compared with a naturally occurring or other reference Cas molecule) or altered helicase activity. In some embodiments, an engineered Cas polypeptide can have an alteration that alters its size, e.g., a deletion of amino acid sequence that reduces its size without significant effect on another property of the Cas polypeptide. In some embodiments, an engineered Cas polypeptide comprises an alteration that affects PAM recognition. For example, an engineered Cas polypeptide can be altered to recognize a PAM sequence other than the PAM sequence recognized by the corresponding wild-type Cas protein.

    [0175] Cas polypeptides with desired properties can be made in a number of ways, including alteration of a naturally occurring Cas polypeptide or parental Cas polypeptide, to provide a mutant or altered Cas polypeptide having a desired property. For example, one or more mutations can be introduced into the sequence of a parental Cas polypeptide (e.g., a naturally occurring or engineered Cas polypeptide). Such mutations and differences may comprise substitutions (e.g., conservative substitutions or substitutions of non-essential amino acids); insertions; or deletions. In some embodiments, a mutant Cas polypeptide comprises one or more mutations (e.g., at least 1, 2, 3, 4, 5, 10, 15, 20, 30, 40 or 50 mutations) relative to a parental Cas polypeptide.

    [0176] In an embodiment, a mutant Cas polypeptide comprises a cleavage property that differs from a naturally occurring Cas polypeptide. In some embodiments, the Cas is a Cas nickase mutant. Cas nickase mutants comprise only one catalytically active domain (either the HNH domain or the RuvC domain). The Cas nickase mutants retain DNA binding based on gRNA specificity, but are capable of cutting only one strand of DNA resulting in a single-strand break (e.g. a “nick”). In some embodiments, two complementary Cas nickase mutants (e.g., one Cas nickase mutant with an inactivated RuvC domain, and one Cas nickase mutant with an inactivated HNH domain) are expressed in the same cell with two gRNAs corresponding to two respective target sequences; one target sequence on the sense DNA strand, and one on the antisense DNA strand. This dual-nickase system results in staggered double stranded breaks and can increase target specificity, as it is unlikely that two off-target nicks will be generated close enough to generate a double stranded break. In some embodiments, a Cas nickase mutant is co-expressed with a nucleic acid repair template to facilitate the incorporation of an exogenous nucleic acid sequence by homology-directed repair.

    [0177] In some embodiments, the Cas is a deactivated Cas (dCas) mutant. In such embodiments, the Cas polypeptide does not comprise any intrinsic enzymatic activity and is unable to mediate DNA cleavage. In such embodiments, the dCas may be fused with a heterologous protein that is capable of modifying the DNA in a non-cleavage based manner. For example, in some embodiments, a dCas protein is fused to transcription activator or transcription repressor domains (e.g., the Kruppel associated box (KRAB or SKD); the Mad mSIN3 interaction domain (SID or SID4X); the ERF repressor domain (ERD); the MAX-interacting protein 1 (MXI1); etc). In some such cases, the dCas fusion protein is targeted by the guide RNA to a specific location (i.e., sequence) in the target DNA and exerts locus-specific regulation such as blocking RNA polymerase binding to a promoter (which selectively inhibits transcription activator function), and/or modifying the local chromatin status (e.g., when a fusion sequence is used that modifies the target DNA or modifies a polypeptide associated with the target DNA). In some cases, the changes are transient (e.g., transcription repression or activation). In some cases, the changes are inheritable (e.g., when epigenetic modifications are made to the target DNA or to proteins associated with the target DNA, e.g., nucleosomal histones).

    [0178] In some embodiments, the Cas polypeptides described herein can be engineered to alter the PAM specificity of the Cas polypeptide. In some embodiments, a mutant Cas polypeptide has a PAM specificity that is different from the PAM specificity of the parental Cas polypeptide. For example, a naturally occurring Cas protein can be modified to alter the PAM sequence that the mutant Cas polypeptide recognizes to decrease off target sites, improve specificity, or eliminate a PAM recognition requirement. In some embodiments, a Cas protein can be modified to increase the length of the PAM recognition sequence. In some embodiments, the length of the PAM recognition sequence is at least 4, 5, 6, 7, 8, 9, 10 or 15 amino acids in length. Cas polypeptides that recognize different PAM sequences and/or have reduced off-target activity can be generated using directed evolution. Exemplary methods and systems that can be used for directed evolution of Cas polypeptides are described, e.g., in Esvelt et al. Nature 2011, 472(7344): 499-503.

    [0179] Exemplary Cas mutants are described in International PCT Publication No. WO 2015/161276, which is incorporated herein by reference in its entirety.

    [0180] gRNAs

    [0181] The present disclosure provides guide RNAs (gRNAs) that direct a site-directed modifying polypeptide to a specific target DNA sequence. A gRNA comprises a DNA-targeting segment and protein-binding segment. The DNA-targeting segment of a gRNA comprises a nucleotide sequence that is complementary to a sequence in the target DNA sequence. As such, the DNA-targeting segment of a gRNA interacts with a target DNA in a sequence-specific manner via hybridization (i.e., base pairing), and the nucleotide sequence of the DNA-targeting segment determines the location within the target DNA that the gRNA will bind. The DNA-targeting segment of a gRNA can be modified (e.g., by genetic engineering) to hybridize to any desired sequence within a target DNA sequence.

    [0182] The protein-binding segment of a guide RNA interacts with a site-directed modifying polypeptide (e.g. a Cas9 protein) to form a complex. The guide RNA guides the bound polypeptide to a specific nucleotide sequence within target DNA via the above-described DNA-targeting segment. The protein-binding segment of a guide RNA comprises two stretches of nucleotides that are complementary to one another and which form a double stranded RNA duplex.

    [0183] In some embodiments, a gRNA comprises two separate RNA molecules. In such embodiments, each of the two RNA molecules comprises a stretch of nucleotides that are complementary to one another such that the complementary nucleotides of the two RNA molecules hybridize to form the double-stranded RNA duplex of the protein-binding segment. In some embodiments, a gRNA comprises a single RNA molecule (sgRNA).

    [0184] The specificity of a gRNA for a target loci is mediated by the sequence of the DNA-binding segment, which comprises about 20 nucleotides that are complementary to a target DNA sequence within the target locus. In some embodiments, the corresponding target DNA sequence is approximately 20 nucleotides in length. In some embodiments, the DNA-binding segments of the gRNA sequences of the present invention are at least 90% complementary to a target DNA sequence within a target locus. In some embodiments, the DNA-binding segments of the gRNA sequences of the present invention are at least 95%, 96%, 97%, 98%, or 99% complementary to a target DNA sequence within a target locus. In some embodiments, the DNA-binding segments of the gRNA sequences of the present invention are 100% complementary to a target DNA sequence within a target locus.

    [0185] In some embodiments, the DNA-binding segments of the gRNA sequences bind to a target DNA sequence that is at least 90% identical to a target DNA sequence within a target locus of the BTK gene. In some embodiments, the DNA-binding segments of the gRNA sequences bind to a target DNA sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to a target DNA sequence within a target locus of a target gene selected those listed in Table 1. In some embodiments, the DNA-binding segments of the gRNA sequences bind to a target DNA sequence that is 100% identical to a target DNA sequence within a target locus of a target gene selected those listed in Table 1. In some embodiments, the DNA-binding segments of the gRNA sequences bind to a target DNA sequence that is at least 90% identical to a target DNA sequence within a target locus within an exon or within an intron of the BTK gene, preferably within the second or third exon of the BTK gene. In some embodiments, the DNA-binding segments of the gRNA sequences bind to a target DNA sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to a target DNA sequence within a target locus within an exon or within an intron of the BTK gene, preferably within the second or third exon of the BTK gene. In some embodiments, t the DNA-binding segments of the gRNA sequences bind to a target DNA sequence that is 100% identical to a target DNA sequence within a target locus within an exon or within an intron of the BTK gene, preferably within the second or third exon of the BTK gene.

    [0186] In some embodiments, the DNA-binding segments of the gRNA sequences bind to a target DNA sequence that is at least 90% identical to one of the sequences in Table 3.

    TABLE-US-00003 TABLE 3 Exemplary Guide Sequences Guide Sequence G1 AGCTATGGCCGCAGTGATTC (SEQ ID NO: 9) G2 AGGCGCTTCTTGAAGTTTAG (SEQ ID NO: 10) G3 ATGAGTATGACTTTGAACGT (SEQ ID NO: 11) G4 AGGGATGAGGATTAATGTCC (SEQ ID NO: 12) G5 ACACTGAATTGGGGGGGGAT (SEQ ID NO: 13) G6 AACTAGGTAGCTAGGCTGAG (SEQ ID NO: 14) G7 GCTTTAGCTAGTTATAGGCT (SEQ ID NO: 15) G8 AGAGGTAAATTTTCGTTGGT (SEQ ID NO: 16) G9 GATGCACACTGAATTGGGGG (SEQ ID NO: 17)

    [0187] In some embodiments, the DNA-binding segments of the gRNA sequences bind to a target DNA sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to one of the sequences in Table 3. In some embodiments, the DNA-binding segments of the gRNA sequences bind to a target DNA sequence that is 100% identical to one of the sequences in Table 3.

    [0188] In some embodiments, the gene editing composition comprises two or more gRNA molecules each comprising a DNA-binding segment, wherein at least one of the DNA-binding segments bind to a target DNA sequence that is at least 90% identical to a target DNA sequence within a target locus of the BTK gene. In some embodiments, the gene editing composition comprises two or more gRNA molecules each comprising a DNA-binding segment, wherein at least one of the DNA-binding segments bind to a target DNA sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to a target DNA sequence within a target locus of a target gene selected those listed in Table 1. In some embodiments, the gene editing composition comprises two or more gRNA molecules each comprising a DNA-binding segment, wherein at least one of the DNA-binding segments bind to a target DNA sequence that is 100% identical to a target DNA sequence within a target locus of a target gene selected those listed in Table 1. In some embodiments, the gene editing composition comprises two or more gRNA molecules each comprising a DNA-binding segment, wherein at least one of the DNA-binding segments bind bind to a target DNA sequence that is at least 90% identical to a target DNA sequence within a target locus within an exon or within an intron of the BTK gene, preferably within the second or third exon of the BTK gene. In some embodiments, the gene editing composition comprises two or more gRNA molecules each comprising a DNA-binding segment, wherein at least one of the DNA-binding segments bind to a target DNA sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to a target DNA sequence within a target locus within an exon or within an intron of the BTK gene, preferably within the second or third exon of the BTK gene. In some embodiments, the gene editing composition comprises two or more gRNA molecules each comprising a DNA-binding segment, wherein at least one of the DNA-binding segments bind to a target DNA sequence that is 100% identical to a target DNA sequence within a target locus within an exon or within an intron of the BTK gene, preferably within the second or third exon of the BTK gene.

    [0189] In some embodiments, the gene editing composition comprises two or more gRNA molecules each comprising a DNA-binding segment, wherein at least one of the DNA-binding segments bind to a target DNA sequence that is at least 90% identical to one of SEQ ID NOS: 1-8. In some embodiments, the gene editing composition comprises two or more gRNA molecules each comprising a DNA-binding segment, wherein at least one of the DNA-binding segments bind to a target DNA sequence that is at least 95%, 96%, 97%, 98%, or 99% identical to one of SEQ ID NOS: 1-8. In some embodiments, the gene editing composition comprises two or more gRNA molecules each comprising a DNA-binding segment, wherein at least one of the DNA-binding segments bind to a target DNA sequence that is 100% identical to one of SEQ ID NOS: 1-8.

    [0190] In some embodiments, the DNA-binding segments of the gRNA sequences described herein are designed to minimize off-target binding using algorithms known in the art (e.g., Cas-OFF finder) to identify target sequences that are unique to a particular target locus or target gene.

    [0191] In some embodiments, the gRNAs described herein can comprise one or more modified nucleosides or nucleotides which introduce stability toward nucleases. In such embodiments, these modified gRNAs may elicit a reduced innate immune as compared to a non-modified gRNA. The term “innate immune response” includes a cellular response to exogenous nucleic acids, including single stranded nucleic acids, generally of viral or bacterial origin, which involves the induction of cytokine expression and release, particularly the interferons, and cell death.

    [0192] In some embodiments, the gRNAs described herein are modified at or near the 5′ end (e.g., within 1-10, 1-5, or 1-2 nucleotides of their 5′ end). In some embodiments, the 5′ end of a gRNA is modified by the inclusion of a eukaryotic mRNA cap structure or cap analog (e.g., a G(5′)ppp(5′)G cap analog, a m7G(5′)ppp(5′)G cap analog, or a 3′-0-Me-m7G(5′)ppp(5′)G anti reverse cap analog (ARCA)). In some embodiments, an in vitro transcribed gRNA is modified by treatment with a phosphatase (e.g., calf intestinal alkaline phosphatase) to remove the 5′ triphosphate group. In some embodiments, a gRNA comprises a modification at or near its 3′ end (e.g., within 1-10, 1-5, or 1-2 nucleotides of its 3′ end). For example, in some embodiments, the 3′ end of a gRNA is modified by the addition of one or more (e.g., 25-200) adenine (A) residues.

    [0193] In some embodiments, modified nucleosides and modified nucleotides can be present in a gRNA, but also may be present in other gene-regulating systems, e.g., mRNA, RNAi, or siRNA-based systems. In some embodiments, modified nucleosides and nucleotides can include one or more of: [0194] a) alteration, e.g., replacement, of one or both of the non-linking phosphate oxygens and/or of one or more of the linking phosphate oxygens in the phosphodiester backbone linkage; [0195] b) alteration, e.g., replacement, of a constituent of the ribose sugar, e.g., of the 2′ hydroxyl on the ribose sugar; [0196] c) wholesale replacement of the phosphate moiety with “dephospho” linkers; [0197] d) modification or replacement of a naturally occurring nucleobase; [0198] e) replacement or modification of the ribose-phosphate backbone; [0199] f) modification of the 3′ end or 5′ end of the oligonucleotide, e.g., removal, modification or replacement of a terminal phosphate group or conjugation of a moiety; and [0200] g) modification of the sugar.

    [0201] In some embodiments, the modifications listed above can be combined to provide modified nucleosides and nucleotides that can have two, three, four, or more modifications. For example, in some embodiments, a modified nucleoside or nucleotide can have a modified sugar and a modified nucleobase. In some embodiments, every base of a gRNA is modified. In some embodiments, each of the phosphate groups of a gRNA molecule are replaced with phosphorothioate groups.

    [0202] In some embodiments, a software tool can be used to optimize the choice of gRNA within a user's target sequence, e.g., to minimize total off-target activity across the genome. Off target activity may be other than cleavage. For example, for each possible gRNA choice using S. pyogenes Cas9, software tools can identify all potential off-target sequences (preceding either NAG or NGG PAMs) across the genome that contain up to a certain number (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) of mismatched base-pairs. The cleavage efficiency at each off-target sequence can be predicted, e.g., using an experimentally-derived weighting scheme. Each possible gRNA can then be ranked according to its total predicted off-target cleavage; the top-ranked gRNAs represent those that are likely to have the greatest on-target and the least off-target cleavage. Other functions, e.g., automated reagent design for gRNA vector construction, primer design for the on-target Surveyor assay, and primer design for high-throughput detection and quantification of off-target cleavage via next-generation sequencing, can also be included in the tool.

    [0203] End-Processing Enzymes

    [0204] Genome editing compositions and methods contemplated in particular embodiments comprise editing cellular genomes using a TALEN variant or Cas protein and an end-processing enzyme. In particular embodiments, a single polynucleotide encodes a TALEN or Cas protein and an end-processing enzyme, separated by a linker, a self-cleaving peptide sequence, e.g., 2A sequence, or by an IRES sequence. In particular embodiments, genome editing compositions comprise a polynucleotide encoding a TALEN variant or Cas protein and a separate polynucleotide encoding an end-processing enzyme.

    [0205] The term “end-processing enzyme” refers to an enzyme that modifies the exposed ends of a polynucleotide chain. The polynucleotide may be double-stranded DNA (dsDNA), single-stranded DNA (ssDNA), RNA, double-stranded hybrids of DNA and RNA, and synthetic DNA (for example, containing bases other than A, C, G, and T). An end-processing enzyme may modify exposed polynucleotide chain ends by adding one or more nucleotides, removing one or more nucleotides, removing or modifying a phosphate group and/or removing or modifying a hydroxyl group. An end-processing enzyme may modify ends at endonuclease cut sites or at ends generated by other chemical or mechanical means, such as shearing (for example by passing through fine-gauge needle, heating, sonicating, mini bead tumbling, and nebulizing), ionizing radiation, ultraviolet radiation, oxygen radicals, chemical hydrolysis and chemotherapy agents.

    [0206] In particular embodiments, genome editing compositions and methods contemplated in particular embodiments comprise editing cellular genomes using a TALEN or a CRISPR/Cas system and a DNA end-processing enzyme.

    [0207] The term “DNA end-processing enzyme” refers to an enzyme that modifies the exposed ends of DNA. A DNA end-processing enzyme may modify blunt ends or staggered ends (ends with 5′ or 3′ overhangs). A DNA end-processing enzyme may modify single stranded or double stranded DNA. A DNA end-processing enzyme may modify ends at endonuclease cut sites or at ends generated by other chemical or mechanical means, such as shearing (for example by passing through fine-gauge needle, heating, sonicating, mini bead tumbling, and nebulizing), ionizing radiation, ultraviolet radiation, oxygen radicals, chemical hydrolysis and chemotherapy agents. DNA end-processing enzyme may modify exposed DNA ends by adding one or more nucleotides, removing one or more nucleotides, removing or modifying a phosphate group and/or removing or modifying a hydroxyl group.

    [0208] Illustrative examples of DNA end-processing enzymes suitable for use in particular embodiments contemplated herein include, but are not limited to: 5′-3′ exonucleases, 5′-3′ alkaline exonucleases, 3′-5′ exonucleases, 5′ flap endonucleases, helicases, phosphatases, hydrolases and template-independent DNA polymerases.

    [0209] Additional illustrative examples of DNA end-processing enzymes suitable for use in particular embodiments contemplated herein include, but are not limited to, Trex2, Trex1, Trex1 without transmembrane domain, Apollo, Artemis, DNA2, Exo1, ExoT, ExoIII, Fen1, Fan1, MreII, Rad2, Rad9, TdT (terminal deoxynucleotidyl transferase), PNKP, RecE, RecJ, RecQ, Lambda exonuclease, Sox, Vaccinia DNA polymerase, exonuclease I, exonuclease III, exonuclease VII, NDK1, NDK5, NDK7, NDK8, WRN, T7-exonuclease Gene 6, avian myeloblastosis virus integration protein (IN), Bloom, Antartic Phophatase, Alkaline Phosphatase, Poly nucleotide Kinase (PNK), ApeI, Mung Bean nuclease, Hex1, TTRAP (TDP2), Sgs1, Sae2, CUP, Pol mu, Pol lambda, MUS81, EME1, EME2, SLX1, SLX4 and UL-12.

    [0210] In particular embodiments, genome editing compositions and methods for editing cellular genomes contemplated herein comprise polypeptides comprising a TALEN or Cas protein and an exonuclease. The term “exonuclease” refers to enzymes that cleave phosphodiester bonds at the end of a polynucleotide chain via a hydrolyzing reaction that breaks phosphodiester bonds at either the 3′ or 5′ end.

    [0211] Illustrative examples of exonucleases suitable for use in particular embodiments contemplated herein include, but are not limited to: hExoI, Yeast ExoI, E. coli ExoI, hTREX2, mouse TREX2, rat TREX2, hTREX1, mouse TREX1, rat TREX1, and Rat TREX1.

    [0212] In particular embodiments, the DNA end-processing enzyme is a 3′ or 5′ exonuclease, preferably Trex 1 or Trex2, more preferably Trex2, and even more preferably human or mouse Trex2.

    E. Target Sites

    [0213] Nuclease variants contemplated in particular embodiments can be designed to bind to any suitable target sequence in a BTK gene and can have a novel binding specificity, compared to a naturally-occurring effector domain. In particular embodiments, the target site is a regulatory region of a gene including, but not limited to promoters, enhancers, repressor elements, and the like. In particular embodiments, the target site is a coding region of a gene or a splice site. In particular embodiments, a TALEN variant or CRISPR/Cas system and donor repair template can be designed to insert a therapeutic polynucleotide. In particular embodiments, a TALEN variant or CRISPR/Cas system and donor repair template can be designed to insert a therapeutic polynucleotide under control of the endogenous BTK gene regulatory elements or expression control sequences.

    [0214] In various embodiments, TALEN variants or CRISPR/Cas systems bind to and cleave a target sequence in the Bruton's tyrosine kinase (BTK) gene, which is located on the X chromosome. The BTK gene encodes a tyrosine kinase, which is essential for the development and maturation of B cells. BTK is also referred to as Bruton Agammaglobulinemia Tyrosine Kinase, B-Cell Progenitor Kinase (BPK), Tyrosine-Protein Kinase BTK Isoform (Lacking Exon 13 To 17), Dominant-Negative Kinase-Deficient Brutons Tyrosine Kinase, Tyrosine-Protein Kinase BTK Isoform (Lacking Exon 14), Truncated Bruton Agammaglobulinemia Tyrosine Kinase, PSCTK1, AGMX1, Agammaglobulinaemia Tyrosine Kinase (ATK), Agammaglobulinemia Tyrosine Kinase, Tyrosine-Protein Kinase BTK, and IMD1, among others. Exemplary BTK reference sequences numbers used in particular embodiments include, but are not limited to NM_000061.2, NP_000052.1, AK057105, BC109079, DA619542, DB636737, CCDS14482.1, Q06187, Q5JY90, ENSP00000308176.7, OTTHUMP00000023676, ENST00000308731.7, OTTHUMT00000057532, NM_001287344.1, NP_001274273.1, NM_001287345.1, and NP_001274274.1.

    [0215] In particular embodiments, a TALEN variant or CRISPR/Cas system introduces a double-strand break (DSB) in a BTK gene, preferably a target sequence in the first or second intron of the human BTK gene, and more preferably a target sequence in the first or second intron of the human BTK gene as set forth in SEQ ID NOS: 1-8. In particular embodiments, the TALEN or CRISPR/Cas system comprises a nuclease that introduces a double strand break at the target site in the first or second intron of the BTK gene as set forth in SEQ ID NOS: 1-8 by cleaving the sequence “ACTT.”

    [0216] In a preferred embodiment, a TALEN or CRISPR/Cas system cleaves double-stranded DNA and introduces a DSB into the polynucleotide sequence set forth in SEQ ID NOS: 1-8.

    [0217] In a preferred embodiment, the BTK gene is a human BTK gene.

    F. Donor Repair Templates

    [0218] Nuclease variants may be used to introduce a DSB in a target sequence; the DSB may be repaired through homology directed repair (HDR) mechanisms in the presence of one or more donor repair templates. In particular embodiments, the donor repair template is used to insert a sequence into the genome. In particular preferred embodiments, the donor repair template is used to insert a polynucleotide sequence encoding a therapeutic BTK polypeptide, e.g., SEQ ID NO: 18.

    TABLE-US-00004 (SEQ ID NO: 18) MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGR RGSKKGSIDVEKITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIE RFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHP CFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTP EEDQILKKPLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDE YFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTR SQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVV CSTPQSQYYLAEKHLFSTIPELINYHQHNSAGLISRLKYPVSQQNKNA PSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMI KEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG CLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCL VNDQGVVKVSDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSS KSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASE KVYTIMYSCWHEKADERPTFKILLSNILDVMDEES

    [0219] In particular preferred embodiments, the donor repair template is used to insert a polynucleotide sequence encoding a therapeutic BTK polypeptide, such that the expression of the BTK polypeptide is under control of the endogenous BTK promoter and/or enhancers.

    [0220] In various embodiments, a donor repair template is introduced into a hematopoietic cell, e.g., a hematopoietic stem or progenitor cell, or CD34.sup.+ cell, by transducing the cell with an adeno-associated virus (AAV), retrovirus, e.g., lentivirus, IDLV, etc., herpes simplex virus, adenovirus, or vaccinia virus vector comprising the donor repair template.

    [0221] In particular embodiments, the donor repair template comprises one or more homology arms that flank the DSB site.

    [0222] As used herein, the term “homology arms” refers to a nucleic acid sequence in a donor repair template that is identical, or nearly identical, to DNA sequence flanking the DNA break introduced by the nuclease at a target site. In one embodiment, the donor repair template comprises a 5′ homology arm that comprises a nucleic acid sequence that is identical or nearly identical to the DNA sequence 5′ of the DNA break site. In one embodiment, the donor repair template comprises a 3′ homology arm that comprises a nucleic acid sequence that is identical or nearly identical to the DNA sequence 3′ of the DNA break site. In a preferred embodiment, the donor repair template comprises a 5′ homology arm and a 3′ homology arm. The donor repair template may comprise homology to the genome sequence immediately adjacent to the DSB site, or homology to the genomic sequence within any number of base pairs from the DSB site. In one embodiment, the donor repair template comprises a nucleic acid sequence that is homologous to a genomic sequence about 5 bp, about 10 bp, about 25 bp, about 50 bp, about 100 bp, about 250 bp, about 500 bp, about 1000 bp, about 2500 bp, about 5000 bp, about 10000 bp or more, including any intervening length of homologous sequence.

    [0223] Illustrative examples of suitable lengths of homology arms contemplated in particular embodiments, may be independently selected, and include but are not limited to: about 100 bp, about 200 bp, about 300 bp, about 400 bp, about 500 bp, about 600 bp, about 700 bp, about 800 bp, about 900 bp, about 1000 bp, about 1100 bp, about 1200 bp, about 1300 bp, about 1400 bp, about 1500 bp, about 1600 bp, about 1700 bp, about 1800 bp, about 1900 bp, about 2000 bp, about 2100 bp, about 2200 bp, about 2300 bp, about 2400 bp, about 2500 bp, about 2600 bp, about 2700 bp, about 2800 bp, about 2900 bp, or about 3000 bp, or longer homology arms, including all intervening lengths of homology arms.

    [0224] Additional illustrative examples of suitable homology arm lengths include, but are not limited to: about 100 bp to about 3000 bp, about 200 bp to about 3000 bp, about 300 bp to about 3000 bp, about 400 bp to about 3000 bp, about 500 bp to about 3000 bp, about 500 bp to about 2500 bp, about 500 bp to about 2000 bp, about 750 bp to about 2000 bp, about 750 bp to about 1500 bp, or about 1000 bp to about 1500 bp, including all intervening lengths of homology arms.

    [0225] In a particular embodiment, the lengths of the 5′ and 3′ homology arms are independently selected from about 500 bp to about 1500 bp. In one embodiment, the 5′homology arm is about 1500 bp and the 3′ homology arm is about 1000 bp. In one embodiment, the 5′homology arm is between about 200 bp to about 600 bp and the 3′ homology arm is between about 200 bp to about 600 bp. In one embodiment, the 5′homology arm is about 200 bp and the 3′ homology arm is about 200 bp. In one embodiment, the 5′homology arm is about 300 bp and the 3′ homology arm is about 300 bp. In one embodiment, the 5′homology arm is about 400 bp and the 3′ homology arm is about 400 bp. In one embodiment, the 5′homology arm is about 500 bp and the 3′ homology arm is about 500 bp. In one embodiment, the 5′homology arm is about 600 bp and the 3′ homology arm is about 600 bp.

    G. Polypeptides

    [0226] Various polypeptides are contemplated herein, including, but not limited to, TALENs and Cas proteins. In preferred embodiments, a polypeptide comprises the amino acid sequence encoding one or more of the RVDs set forth in Table 2. “Polypeptide,” “polypeptide fragment,” “peptide” and “protein” are used interchangeably, unless specified to the contrary, and according to conventional meaning, i.e., as a sequence of amino acids. In one embodiment, a “polypeptide” includes fusion polypeptides and other variants. Polypeptides can be prepared using any of a variety of well-known recombinant and/or synthetic techniques. Polypeptides are not limited to a specific length, e.g., they may comprise a full-length protein sequence, a fragment of a full length protein, or a fusion protein, and may include post-translational modifications of the polypeptide, for example, glycosylations, acetylations, phosphorylations and the like, as well as other modifications known in the art, both naturally occurring and non-naturally occurring.

    [0227] An “isolated protein,” “isolated peptide,” or “isolated polypeptide” and the like, as used herein, refer to in vitro synthesis, isolation, and/or purification of a peptide or polypeptide molecule from a cellular environment, and from association with other components of the cell, i.e., it is not significantly associated with in vivo substances.

    [0228] Illustrative examples of polypeptides contemplated in particular embodiments include, but are not limited to TALENs, Cas proteins, end-processing nucleases, fusion polypeptides and variants thereof.

    [0229] Polypeptides include “polypeptide variants.” Polypeptide variants may differ from a naturally occurring polypeptide in one or more amino acid substitutions, deletions, additions and/or insertions. Such variants may be naturally occurring or may be synthetically generated, for example, by modifying one or more amino acids of the above polypeptide sequences. For example, in particular embodiments, it may be desirable to improve the biological properties of a TALEN, CRISPR/Cas or the like that binds and cleaves a target site in the human BTK gene by introducing one or more substitutions, deletions, additions and/or insertions into the polypeptide. In particular embodiments, polypeptides include polypeptides having at least about 65%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid identity to any of the reference sequences contemplated herein, typically where the variant maintains at least one biological activity of the reference sequence.

    [0230] Polypeptides variants include biologically active “polypeptide fragments.” Illustrative examples of biologically active polypeptide fragments include DNA binding domains, nuclease domains, and the like. As used herein, the term “biologically active fragment” or “minimal biologically active fragment” refers to a polypeptide fragment that retains at least 100%, at least 90%, at least 80%, at least 70%, at least 60%, at least 50%, at least 40%, at least 30%, at least 20%, at least 10%, or at least 5% of the naturally occurring polypeptide activity. In preferred embodiments, the biological activity is binding affinity and/or cleavage activity for a target sequence. In certain embodiments, a polypeptide fragment can comprise an amino acid chain at least 5 to about 1700 amino acids long. It will be appreciated that in certain embodiments, fragments are at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700 or more amino acids long. In particular embodiments, a polypeptide comprises a biologically active fragment of a TALEN variant. In particular embodiments, the polypeptides set forth herein may comprise one or more amino acids denoted as “X.” “X” if present in an amino acid SEQ ID NO, refers to any amino acid. One or more “X” residues may be present at the N- and C-terminus of an amino acid sequence set forth in particular SEQ ID NOs contemplated herein. If the “X” amino acids are not present the remaining amino acid sequence set forth in a SEQ ID NO may be considered a biologically active fragment.

    [0231] The biologically active fragment may comprise an N-terminal truncation and/or C-terminal truncation. In a particular embodiment, a biologically active fragment lacks or comprises a deletion of the 1, 2, 3, 4, 5, 6, 7, or 8 N-terminal amino acids of a TALEN or TAL effector domain compared to a corresponding wild type TALEN or TAL effector domain sequence, more preferably a deletion of the 4 N-terminal amino acids of a TALEN or TAL effector domain compared to a corresponding wild type TALEN or TAL effector domain sequence. In a particular embodiment, a biologically active fragment lacks or comprises a deletion of the 1, 2, 3, 4, or 5 C-terminal amino acids of a TALEN or TAL effector domain compared to a corresponding wild type TALEN or TAL effector domain, more preferably a deletion of the 2 C-terminal amino acids of a TALEN or TAL effector domain compared to a corresponding wild type TALEN or TAL effector domain. In a particular preferred embodiment, a biologically active fragment lacks or comprises a deletion of the 4 N-terminal amino acids and 2 C-terminal amino acids of a TALEN or TAL effector domain compared to a corresponding wild type TALEN or TAL effector domain.

    [0232] As noted above, polypeptides may be altered in various ways including amino acid substitutions, deletions, truncations, and insertions. Methods for such manipulations are generally known in the art. For example, amino acid sequence variants of a reference polypeptide can be prepared by mutations in the DNA. Methods for mutagenesis and nucleotide sequence alterations are well known in the art. See, for example, Kunkel (1985, Proc. Natl. Acad. Sci. USA. 82: 488-492), Kunkel et al., (1987, Methods in Enzymol, 154: 367-382), U.S. Pat. No. 4,873,192, Watson, J. D. et al., (Molecular Biology of the Gene, Fourth Edition, Benjamin/Cummings, Menlo Park, Calif., 1987) and the references cited therein. Guidance as to appropriate amino acid substitutions that do not affect biological activity of the protein of interest may be found in the model of Dayhoff et al., (1978) Atlas of Protein Sequence and Structure (Natl. Biomed. Res. Found., Washington, D.C.).

    [0233] In certain embodiments, a variant will contain one or more conservative substitutions. A “conservative substitution” is one in which an amino acid is substituted for another amino acid that has similar properties, such that one skilled in the art of peptide chemistry would expect the secondary structure and hydropathic nature of the polypeptide to be substantially unchanged. Modifications may be made in the structure of the polynucleotides and polypeptides contemplated in particular embodiments, polypeptides include polypeptides having at least about and still obtain a functional molecule that encodes a variant or derivative polypeptide with desirable characteristics. When it is desired to alter the amino acid sequence of a polypeptide to create an equivalent, or even an improved, variant polypeptide, one skilled in the art, for example, can change one or more of the codons of the encoding DNA sequence, e.g., according to Table 1.

    TABLE-US-00005 TABLE 1 Amino Acid Codons One Three letter letter Amino Acids code code Codons Alanine A Ala GCA GCC GCG GCU Cysteine C Cys UGC UGU Aspartic D Asp GAC GAU acid Glutamic E Glu GAA GAG acid Phenyl- F Phe UUC UUU alanine  Glycine G Gly GGA GGC GGG GGU Histidine H His CAC CAU Isoleucine I Iso AUA AUC AUU Lysine K Lys AAA AAG Leucine L Leu UUA UUG CUA CUC CUG CUU Methionine M Met AUG Asparagine N Asn AAC AAU Proline P Pro CCA CCC CCG CCU Glutamine Q Gln CAA CAG Arginine R Arg AGA AGG CGA CGC CGG CGU Serine S Ser AGC AGU UCA UCC UCG UCU Threonine T Thr ACA ACC ACG ACU Valine V Val GUA GUC GUG GUU Tryptophan W Trp UGG Tyrosine Y Tyr UAC UAU

    [0234] Guidance in determining which amino acid residues can be substituted, inserted, or deleted without abolishing biological activity can be found using computer programs well known in the art, such as DNASTAR, DNA Strider, Geneious, Mac Vector, or Vector NTI software. Preferably, amino acid changes in the protein variants disclosed herein are conservative amino acid changes, i.e., substitutions of similarly charged or uncharged amino acids. A conservative amino acid change involves substitution of one of a family of amino acids which are related in their side chains. Naturally occurring amino acids are generally divided into four families: acidic (aspartate, glutamate), basic (lysine, arginine, histidine), non-polar (alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), and uncharged polar (glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine) amino acids. Phenylalanine, tryptophan, and tyrosine are sometimes classified jointly as aromatic amino acids. In a peptide or protein, suitable conservative substitutions of amino acids are known to those of skill in this art and generally can be made without altering a biological activity of a resulting molecule. Those of skill in this art recognize that, in general, single amino acid substitutions in non-essential regions of a polypeptide do not substantially alter biological activity (see, e.g., Watson et al. Molecular Biology of the Gene, 4th Edition, 1987, The Benjamin/Cummings Pub. Co., p. 224).

    [0235] In one embodiment, where expression of two or more polypeptides is desired, the polynucleotide sequences encoding them can be separated by and IRES sequence as disclosed elsewhere herein.

    [0236] Polypeptides contemplated in particular embodiments include fusion polypeptides In particular embodiments, fusion polypeptides and polynucleotides encoding fusion polypeptides are provided. Fusion polypeptides and fusion proteins refer to a polypeptide having at least two, three, four, five, six, seven, eight, nine, or ten polypeptide segments.

    [0237] In another embodiment, two or more polypeptides can be expressed as a fusion protein that comprises one or more self-cleaving polypeptide sequences as disclosed elsewhere herein.

    [0238] In one embodiment, a fusion protein contemplated herein comprises one or more TAL effector domain and one or more nucleases, and one or more linker and/or self-cleaving polypeptides.

    [0239] In one embodiment, a fusion protein contemplated herein comprises a TALEN variant; a linker or self-cleaving peptide; and an end-processing enzyme including but not limited to a 5′-3′ exonuclease, a 5′-3′ alkaline exonuclease, and a 3′-5′ exonuclease (e.g., Trex2).

    [0240] Fusion polypeptides can comprise one or more polypeptide domains or segments including, but are not limited to signal peptides, cell permeable peptide domains (CPP), DNA binding domains, nuclease domains, etc., epitope tags (e.g., maltose binding protein (“MBP”), glutathione S transferase (GST), HIS6, MYC, FLAG, V5, VSV-G, and HA), polypeptide linkers, and polypeptide cleavage signals. Fusion polypeptides are typically linked C-terminus to N-terminus, although they can also be linked C-terminus to C-terminus, N-terminus to N-terminus, or N-terminus to C-terminus. In particular embodiments, the polypeptides of the fusion protein can be in any order. Fusion polypeptides or fusion proteins can also include conservatively modified variants, polymorphic variants, alleles, mutants, subsequences, and interspecies homologs, so long as the desired activity of the fusion polypeptide is preserved. Fusion polypeptides may be produced by chemical synthetic methods or by chemical linkage between the two moieties or may generally be prepared using other standard techniques. Ligated DNA sequences comprising the fusion polypeptide are operably linked to suitable transcriptional or translational control elements as disclosed elsewhere herein.

    [0241] Fusion polypeptides may optionally comprise a linker that can be used to link the one or more polypeptides or domains within a polypeptide. A peptide linker sequence may be employed to separate any two or more polypeptide components by a distance sufficient to ensure that each polypeptide folds into its appropriate secondary and tertiary structures so as to allow the polypeptide domains to exert their desired functions. Such a peptide linker sequence is incorporated into the fusion polypeptide using standard techniques in the art. Suitable peptide linker sequences may be chosen based on the following factors: (1) their ability to adopt a flexible extended conformation; (2) their inability to adopt a secondary structure that could interact with functional epitopes on the first and second polypeptides; and (3) the lack of hydrophobic or charged residues that might react with the polypeptide functional epitopes. Preferred peptide linker sequences contain Gly, Asn and Ser residues. Other near neutral amino acids, such as Thr and Ala may also be used in the linker sequence. Amino acid sequences which may be usefully employed as linkers include those disclosed in Maratea et al., Gene 40:39-46, 1985; Murphy et al., Proc. Natl. Acad. Sci. USA 83:8258-8262, 1986; U.S. Pat. Nos. 4,935,233 and 4,751,180. Linker sequences are not required when a particular fusion polypeptide segment contains non-essential N-terminal amino acid regions that can be used to separate the functional domains and prevent steric interference. Preferred linkers are typically flexible amino acid subsequences which are synthesized as part of a recombinant fusion protein. Linker polypeptides can be between 1 and 200 amino acids in length, between 1 and 100 amino acids in length, or between 1 and 50 amino acids in length, including all integer values in between.

    [0242] Exemplary linkers include, but are not limited to the following amino acid sequences: glycine polymers (G).sub.n; glycine-serine polymers (G1-5S1-5).sub.n, where n is an integer of at least one, two, three, four, or five; glycine-alanine polymers; alanine-serine polymers; GGG; DGGGS (SEQ ID NO: 36); TGEKP (SEQ ID NO: 37) (see e.g., Liu et al., PNAS 5525-5530 (1997)); GGRR (SEQ ID NO: 38) (Pomerantz et al. 1995, supra); (GGGGS).sub.n wherein n=1, 2, 3, 4 or 5 (SEQ ID NO: 39) (Kim et al., PNAS 93, 1156-1160 (1996.); EGKSSGSGSESKVD (SEQ ID NO: 40) (Chaudhary et al., 1990, Proc. Natl. Acad. Sci. U.S.A. 87:1066-1070); KESGSVSSEQLAQFRSLD (SEQ ID NO 41) (Bird et al., 1988, Science 242:423-426), GGRRGGGS (SEQ ID NO: 42); LRQRDGERP (SEQ ID NO: 43); LRQKDGGGSERP (SEQ ID NO:44); LRQKD(GGGS).sub.2ERP (SEQ ID NO: 45). Alternatively, flexible linkers can be rationally designed using a computer program capable of modeling both DNA-binding sites and the peptides themselves (Desjarlais & Berg, PNAS 90:2256-2260 (1993), PNAS 91:11099-11103 (1994) or by phage display methods.

    [0243] Fusion polypeptides may further comprise a polypeptide cleavage signal between each of the polypeptide domains described herein or between an endogenous open reading frame and a polypeptide encoded by a donor repair template. In addition, a polypeptide cleavage site can be put into any linker peptide sequence. Exemplary polypeptide cleavage signals include polypeptide cleavage recognition sites such as protease cleavage sites, nuclease cleavage sites (e.g., rare restriction enzyme recognition sites, self-cleaving ribozyme recognition sites), and self-cleaving viral oligopeptides (see deFelipe and Ryan, 2004. Traffic, 5(8); 616-26).

    [0244] Suitable protease cleavages sites and self-cleaving peptides are known to the skilled person (see, e.g., in Ryan et al., 1997. J. Gener. Virol. 78, 699-722; Scymczak et al. (2004) Nature Biotech. 5, 589-594). Exemplary protease cleavage sites include, but are not limited to the cleavage sites of potyvirus NIa proteases (e.g., tobacco etch virus protease), potyvirus HC proteases, potyvirus P1 (P35) proteases, byovirus NIa proteases, byovirus RNA-2-encoded proteases, aphthovirus L proteases, enterovirus 2A proteases, rhinovirus 2A proteases, picorna 3C proteases, comovirus 24K proteases, nepovirus 24K proteases, RTSV (rice tungro spherical virus) 3C-like protease, PYVF (parsnip yellow fleck virus) 3C-like protease, heparin, thrombin, factor Xa and enterokinase. Due to its high cleavage stringency, TEV (tobacco etch virus) protease cleavage sites are preferred in one embodiment, e.g., EXXYXQ(G/S) (SEQ ID NO: 46), for example, ENLYFQG (SEQ ID NO: 47) and ENLYFQS (SEQ ID NO: 48), wherein X represents any amino acid (cleavage by TEV occurs between Q and G or Q and S).

    [0245] In certain embodiments, the self-cleaving polypeptide site comprises a 2A or 2A-like site, sequence or domain (Donnelly et al., 2001. J. Gen. Virol. 82:1027-1041). In a particular embodiment, the viral 2A peptide is an aphthovirus 2A peptide, a potyvirus 2A peptide, or a cardiovirus 2A peptide.

    [0246] In one embodiment, the viral 2A peptide is selected from the group consisting of: a foot-and-mouth disease virus (FMDV) 2A peptide, an equine rhinitis A virus (ERAV) 2A peptide, a Thosea asigna virus (TaV) 2A peptide, a porcine teschovirus-1 (PTV-1) 2A peptide, a Theilovirus 2A peptide, and an encephalomyocarditis virus 2A peptide.

    [0247] Illustrative examples of 2A sites are provided in Table 2.

    TABLE-US-00006 TABLE 2 Exemplary 2A sites include the following sequences: SEQ ID NO: 49 GSGATNFSLLKQAGDVEENPGP SEQ ID NO: 50 ATNFSLLKQAGDVEENPGP SEQ ID NO: 51 LLKQAGDVEENPGP SEQ ID NO: 52 GSGEGRGSLLTCGDVEENPGP SEQ ID NO: 53 EGRGSLLTCGDVEENPGP SEQ ID NO: 54 LLTCGDVEENPGP SEQ ID NO: 55 GSGQCTNYALLKLAGDVESNPGP SEQ ID NO: 56 QCTNYALLKLAGDVESNPGP SEQ ID NO: 57 LLKLAGDVESNPGP SEQ ID NO: 58 GSGVKQTLNFDLLKLAGDVESNPGP SEQ ID NO: 59 VKQTLNFDLLKLAGDVESNPGP SEQ ID NO: 60 LLKLAGDVESNPGP SEQ ID NO: 61 LLNFDLLKLAGDVESNPGP SEQ ID NO: 62 TLNFDLLKLAGDVESNPGP SEQ ID NO: 63 LLKLAGDVESNPGP SEQ ID NO: 64 NFDLLKLAGDVESNPGP SEQ ID NO: 65 QLLNFDLLKLAGDVESNPGP SEQ ID NO: 66 APVKQTLNFDLLKLAGDVESNPGP SEQ ID NO: 67 VTELLYRMKRAETYCPRPLLAIHPT EARHKQKIVAPVKQT SEQ ID NO: 68 LNFDLLKLAGDVESNPGP SEQ ID NO: 69 LLAIHPTEARHKQKIVAPVKQTLNF DLLKLAGDVESNPGP SEQ ID NO: 70 EARHKQKIVAPVKQTLNFDLLKLAG DVESNPGP

    H. Polynucleotides

    [0248] In particular embodiments, polynucleotides encoding one or more TALENs, TAL effector domains, Cas proteins, guide RNAs (gRNA), end-processing enzymes, and fusion polypeptides contemplated herein are provided. As used herein, the terms “polynucleotide” or “nucleic acid” refer to deoxyribonucleic acid (DNA), ribonucleic acid (RNA) and DNA/RNA hybrids. Polynucleotides may be single-stranded or double-stranded and either recombinant, synthetic, or isolated. Polynucleotides include, but are not limited to: pre-messenger RNA (pre-mRNA), messenger RNA (mRNA), synthetic RNA, synthetic mRNA, genomic DNA (gDNA), PCR amplified DNA, complementary DNA (cDNA), synthetic DNA, and recombinant DNA. Polynucleotides refer to a polymeric form of nucleotides of at least 5, at least 10, at least 15, at least 20, at least 25, at least 30, at least 40, at least 50, at least 100, at least 200, at least 300, at least 400, at least 500, at least 1000, at least 5000, at least 10000, or at least 15000 or more nucleotides in length, either ribonucleotides or deoxyribonucleotides or a modified form of either type of nucleotide, as well as all intermediate lengths. It will be readily understood that “intermediate lengths,” in this context, means any length between the quoted values, such as 6, 7, 8, 9, etc., 101, 102, 103, etc.; 151, 152, 153, etc.; 201, 202, 203, etc. In particular embodiments, polynucleotides or variants have at least or about 50%, 55%, 60%, 65%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a reference sequence.

    [0249] In particular embodiments, polynucleotides may be codon-optimized. As used herein, the term “codon-optimized” refers to substituting codons in a polynucleotide encoding a polypeptide in order to increase the expression, stability and/or activity of the polypeptide. Factors that influence codon optimization include, but are not limited to one or more of: (i) variation of codon biases between two or more organisms or genes or synthetically constructed bias tables, (ii) variation in the degree of codon bias within an organism, gene, or set of genes, (iii) systematic variation of codons including context, (iv) variation of codons according to their decoding tRNAs, (v) variation of codons according to GC %, either overall or in one position of the triplet, (vi) variation in degree of similarity to a reference sequence for example a naturally occurring sequence, (vii) variation in the codon frequency cutoff, (viii) structural properties of mRNAs transcribed from the DNA sequence, (ix) prior knowledge about the function of the DNA sequences upon which design of the codon substitution set is to be based, and/or (x) systematic variation of codon sets for each amino acid, and/or (xi) isolated removal of spurious translation initiation sites.

    [0250] As used herein the term “nucleotide” refers to a heterocyclic nitrogenous base in N-glycosidic linkage with a phosphorylated sugar. Nucleotides are understood to include natural bases, and a wide variety of art-recognized modified bases. Such bases are generally located at the 1′ position of a nucleotide sugar moiety. Nucleotides generally comprise a base, sugar and a phosphate group. In ribonucleic acid (RNA), the sugar is a ribose, and in deoxyribonucleic acid (DNA) the sugar is a deoxyribose, i.e., a sugar lacking a hydroxyl group that is present in ribose. Exemplary natural nitrogenous bases include the purines, adenosine (A) and guanidine (G), and the pyrimidines, cytidine (C) and thymidine (T) (or in the context of RNA, uracil (U)). The C-1 atom of deoxyribose is bonded to N-1 of a pyrimidine or N-9 of a purine. Nucleotides are usually mono, di- or triphosphates. The nucleotides can be unmodified or modified at the sugar, phosphate and/or base moiety, (also referred to interchangeably as nucleotide analogs, nucleotide derivatives, modified nucleotides, non-natural nucleotides, and non-standard nucleotides; see for example, WO 92/07065 and WO 93/15187). Examples of modified nucleic acid bases are summarized by Limbach et al., (1994, Nucleic Acids Res. 22, 2183-2196).

    [0251] A nucleotide may also be regarded as a phosphate ester of a nucleoside, with esterification occurring on the hydroxyl group attached to C-5 of the sugar. As used herein, the term “nucleoside” refers to a heterocyclic nitrogenous base in N-glycosidic linkage with a sugar. Nucleosides are recognized in the art to include natural bases, and also to include well known modified bases. Such bases are generally located at the 1′ position of a nucleoside sugar moiety. Nucleosides generally comprise a base and sugar group. The nucleosides can be unmodified or modified at the sugar, and/or base moiety, (also referred to interchangeably as nucleoside analogs, nucleoside derivatives, modified nucleosides, non-natural nucleosides, or non-standard nucleosides). As also noted above, examples of modified nucleic acid bases are summarized by Limbach et al., (1994, Nucleic Acids Res. 22, 2183-2196).

    [0252] In various illustrative embodiments, polynucleotides contemplated herein include, but are not limited to polynucleotides encoding TALEN, CRISPR/Cas systems, guide RNAs, end-processing enzymes, fusion polypeptides, and expression vectors, viral vectors, and transfer plasmids comprising polynucleotides contemplated herein.

    [0253] As used herein, the terms “polynucleotide variant” and “variant” and the like refer to polynucleotides displaying substantial sequence identity with a reference polynucleotide sequence or polynucleotides that hybridize with a reference sequence under stringent conditions that are defined hereinafter. These terms also encompass polynucleotides that are distinguished from a reference polynucleotide by the addition, deletion, substitution, or modification of at least one nucleotide. Accordingly, the terms “polynucleotide variant” and “variant” include polynucleotides in which one or more nucleotides have been added or deleted, or modified, or replaced with different nucleotides. In this regard, it is well understood in the art that certain alterations inclusive of mutations, additions, deletions and substitutions can be made to a reference polynucleotide whereby the altered polynucleotide retains the biological function or activity of the reference polynucleotide.

    [0254] In one embodiment, a polynucleotide comprises a nucleotide sequence that hybridizes to a target nucleic acid sequence under stringent conditions. To hybridize under “stringent conditions” describes hybridization protocols in which nucleotide sequences at least 60% identical to each other remain hybridized. Generally, stringent conditions are selected to be about 5° C. lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH. The Tm is the temperature (under defined ionic strength, pH and nucleic acid concentration) at which 50% of the probes complementary to the target sequence hybridize to the target sequence at equilibrium. Since the target sequences are generally present at excess, at Tm, 50% of the probes are occupied at equilibrium.

    [0255] The recitations “sequence identity” or, for example, comprising a “sequence 50% identical to,” as used herein, refer to the extent that sequences are identical on a nucleotide-by-nucleotide basis or an amino acid-by-amino acid basis over a window of comparison. Thus, a “percentage of sequence identity” may be calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical nucleic acid base (e.g., A, T, C, G, I) or the identical amino acid residue (e.g., Ala, Pro, Ser, Thr, Gly, Val, Leu, Ile, Phe, Tyr, Trp, Lys, Arg, His, Asp, Glu, Asn, Gln, Cys and Met) occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity. Included are nucleotides and polypeptides having at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to any of the reference sequences described herein, typically where the polypeptide variant maintains at least one biological activity of the reference polypeptide.

    [0256] Terms used to describe sequence relationships between two or more polynucleotides or polypeptides include “reference sequence,” “comparison window,” “sequence identity,” “percentage of sequence identity,” and “substantial identity”. A “reference sequence” is at least 12 but frequently 15 to 18 and often at least 25 monomer units, inclusive of nucleotides and amino acid residues, in length. Because two polynucleotides may each comprise (1) a sequence (i.e., only a portion of the complete polynucleotide sequence) that is similar between the two polynucleotides, and (2) a sequence that is divergent between the two polynucleotides, sequence comparisons between two (or more) polynucleotides are typically performed by comparing sequences of the two polynucleotides over a “comparison window” to identify and compare local regions of sequence similarity. A “comparison window” refers to a conceptual segment of at least 6 contiguous positions, usually about 50 to about 100, more usually about 100 to about 150 in which a sequence is compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. The comparison window may comprise additions or deletions (i.e., gaps) of about 20% or less as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. Optimal alignment of sequences for aligning a comparison window may be conducted by computerized implementations of algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package Release 7.0, Genetics Computer Group, 575 Science Drive Madison, Wis., USA) or by inspection and the best alignment (i.e., resulting in the highest percentage homology over the comparison window) generated by any of the various methods selected. Reference also may be made to the BLAST family of programs as for example disclosed by Altschul et al., 1997, Nucl. Acids Res. 25:3389. A detailed discussion of sequence analysis can be found in Unit 19.3 of Ausubel et at, Current Protocols in Molecular Biology, John Wiley & Sons Inc., 1994-1998, Chapter 15.

    [0257] An “isolated polynucleotide,” as used herein, refers to a polynucleotide that has been purified from the sequences which flank it in a naturally-occurring state, e.g., a DNA fragment that has been removed from the sequences that are normally adjacent to the fragment. In particular embodiments, an “isolated polynucleotide” refers to a complementary DNA (cDNA), a recombinant polynucleotide, a synthetic polynucleotide, or other polynucleotide that does not exist in nature and that has been made by the hand of man.

    [0258] In some embodiments, the present disclosure provides a polynucleotide encoding a gRNA. In some embodiments, a gRNA-encoding nucleic acid is comprised in an expression vector, e.g., a recombinant expression vector. In some embodiments, the present disclosure provides a polynucleotide encoding a site-directed modifying polypeptide. In some embodiments, the polynucleotide encoding a site-directed modifying polypeptide is comprised in an expression vector, e.g., a recombinant expression vector.

    [0259] In various embodiments, a polynucleotide comprises an mRNA encoding a polypeptide contemplated herein including, but not limited to, a TALEN, TAL effector domain, Cas protein, and an end-processing enzyme. In certain embodiments, the mRNA comprises a cap, one or more nucleotides and/or modified nucleotides, and a poly(A) tail.

    [0260] In particular embodiments, an mRNA contemplated herein comprises a poly(A) tail to help protect the mRNA from exonuclease degradation, stabilize the mRNA, and facilitate translation. In certain embodiments, an mRNA comprises a 3′ poly(A) tail structure.

    [0261] In particular embodiments, the length of the poly(A) tail is at least about 10, 25, 50, 75, 100, 150, 200, 250, 300, 350, 400, 450, or at least about 500 or more adenine nucleotides or any intervening number of adenine nucleotides. In particular embodiments, the length of the poly(A) tail is at least about 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 202, 203, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, or 275 or more adenine nucleotides.

    [0262] In particular embodiments, the length of the poly(A) tail is about 10 to about 500 adenine nucleotides, about 50 to about 500 adenine nucleotides, about 100 to about 500 adenine nucleotides, about 150 to about 500 adenine nucleotides, about 200 to about 500 adenine nucleotides, about 250 to about 500 adenine nucleotides, about 300 to about 500 adenine nucleotides, about 50 to about 450 adenine nucleotides, about 50 to about 400 adenine nucleotides, about 50 to about 350 adenine nucleotides, about 100 to about 500 adenine nucleotides, about 100 to about 450 adenine nucleotides, about 100 to about 400 adenine nucleotides, about 100 to about 350 adenine nucleotides, about 100 to about 300 adenine nucleotides, about 150 to about 500 adenine nucleotides, about 150 to about 450 adenine nucleotides, about 150 to about 400 adenine nucleotides, about 150 to about 350 adenine nucleotides, about 150 to about 300 adenine nucleotides, about 150 to about 250 adenine nucleotides, about 150 to about 200 adenine nucleotides, about 200 to about 500 adenine nucleotides, about 200 to about 450 adenine nucleotides, about 200 to about 400 adenine nucleotides, about 200 to about 350 adenine nucleotides, about 200 to about 300 adenine nucleotides, about 250 to about 500 adenine nucleotides, about 250 to about 450 adenine nucleotides, about 250 to about 400 adenine nucleotides, about 250 to about 350 adenine nucleotides, or about 250 to about 300 adenine nucleotides or any intervening range of adenine nucleotides.

    [0263] Terms that describe the orientation of polynucleotides include: 5′ (normally the end of the polynucleotide having a free phosphate group) and 3′ (normally the end of the polynucleotide having a free hydroxyl (OH) group). Polynucleotide sequences can be annotated in the 5′ to 3′ orientation or the 3′ to 5′ orientation. For DNA and mRNA, the 5′ to 3′ strand is designated the “sense,” “plus,” or “coding” strand because its sequence is identical to the sequence of the pre-messenger (pre-mRNA) [except for uracil (U) in RNA, instead of thymine (T) in DNA]. For DNA and mRNA, the complementary 3′ to 5′ strand which is the strand transcribed by the RNA polymerase is designated as “template,” “antisense,” “minus,” or “non-coding” strand. As used herein, the term “reverse orientation” refers to a 5′ to 3′ sequence written in the 3′ to 5′ orientation or a 3′ to 5′ sequence written in the 5′ to 3′ orientation.

    [0264] The terms “complementary” and “complementarity” refer to polynucleotides (i.e., a sequence of nucleotides) related by the base-pairing rules. For example, the complementary strand of the DNA sequence 5′ A G T C A T G 3′ is 3′ T C A G T A C 5′. The latter sequence is often written as the reverse complement with the 5′ end on the left and the 3′ end on the right, 5′ C A T G A C T 3′. A sequence that is equal to its reverse complement is said to be a palindromic sequence. Complementarity can be “partial,” in which only some of the nucleic acids' bases are matched according to the base pairing rules. Or, there can be “complete” or “total” complementarity between the nucleic acids.

    [0265] The term “nucleic acid cassette” or “expression cassette” as used herein refers to genetic sequences within the vector which can express an RNA, and subsequently a polypeptide. In one embodiment, the nucleic acid cassette contains a gene(s)-of-interest, e.g., a polynucleotide(s)-of-interest. In another embodiment, the nucleic acid cassette contains one or more expression control sequences, e.g., a promoter, enhancer, poly(A) sequence, and a gene(s)-of-interest, e.g., a polynucleotide(s)-of-interest. Vectors may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 or more nucleic acid cassettes. The nucleic acid cassette is positionally and sequentially oriented within the vector such that the nucleic acid in the cassette can be transcribed into RNA, and when necessary, translated into a protein or a polypeptide, undergo appropriate post-translational modifications required for activity in the transformed cell, and be translocated to the appropriate compartment for biological activity by targeting to appropriate intracellular compartments or secretion into extracellular compartments. Preferably, the cassette has its 3′ and 5′ ends adapted for ready insertion into a vector, e.g., it has restriction endonuclease sites at each end. In a preferred embodiment, the nucleic acid cassette contains the sequence of a therapeutic gene used to treat, prevent, or ameliorate a genetic disorder. The cassette can be removed and inserted into a plasmid or viral vector as a single unit.

    [0266] Polynucleotides include polynucleotide(s)-of-interest. As used herein, the term “polynucleotide-of-interest” refers to a polynucleotide encoding a polypeptide or fusion polypeptide or a polynucleotide that serves as a template for the transcription of an inhibitory polynucleotide, as contemplated herein.

    [0267] Moreover, it will be appreciated by those of ordinary skill in the art that, as a result of the degeneracy of the genetic code, there are many nucleotide sequences that may encode a polypeptide, or fragment of variant thereof, as contemplated herein. Some of these polynucleotides bear minimal homology to the nucleotide sequence of any native gene. Nonetheless, polynucleotides that vary due to differences in codon usage are specifically contemplated in particular embodiments, for example polynucleotides that are optimized for human and/or primate codon selection. In one embodiment, polynucleotides comprising particular allelic sequences are provided. Alleles are endogenous polynucleotide sequences that are altered as a result of one or more mutations, such as deletions, additions and/or substitutions of nucleotides.

    [0268] In a certain embodiment, a polynucleotide-of-interest comprises a donor repair template.

    [0269] The polynucleotides contemplated in particular embodiments, regardless of the length of the coding sequence itself, may be combined with other DNA sequences, such as promoters and/or enhancers, untranslated regions (UTRs), Kozak sequences, polyadenylation signals, additional restriction enzyme sites, multiple cloning sites, internal ribosomal entry sites (IRES), recombinase recognition sites (e.g., LoxP, FRT, and Att sites), termination codons, transcriptional termination signals, post-transcription response elements, and polynucleotides encoding self-cleaving polypeptides, epitope tags, as disclosed elsewhere herein or as known in the art, such that their overall length may vary considerably. It is therefore contemplated in particular embodiments that a polynucleotide fragment of almost any length may be employed, with the total length preferably being limited by the ease of preparation and use in the intended recombinant DNA protocol.

    [0270] Polynucleotides can be prepared, manipulated, expressed and/or delivered using any of a variety of well-established techniques known and available in the art. In order to express a desired polypeptide, a nucleotide sequence encoding the polypeptide, can be inserted into appropriate vector. A desired polypeptide can also be expressed by delivering an mRNA encoding the polypeptide into the cell.

    [0271] Illustrative examples of vectors include, but are not limited to plasmid, autonomously replicating sequences, and transposable elements, e.g., Sleeping Beauty, PiggyBac.

    [0272] Additional illustrative examples of vectors include, without limitation, plasmids, phagemids, cosmids, artificial chromosomes such as yeast artificial chromosome (YAC), bacterial artificial chromosome (BAC), or P1-derived artificial chromosome (PAC), bacteriophages such as lambda phage or M13 phage, and animal viruses.

    [0273] Illustrative examples of viruses useful as vectors include, without limitation, retrovirus (including lentivirus), adenovirus, adeno-associated virus, herpesvirus (e.g., herpes simplex virus), poxvirus, baculovirus, papillomavirus, and papovavirus (e.g., SV40).

    [0274] Illustrative examples of expression vectors include, but are not limited to pClneo vectors (Promega) for expression in mammalian cells; pLenti4N5-DEST™, pLenti6N5-DEST™, and pLenti6.2N5-GW/lacZ (Invitrogen) for lentivirus-mediated gene transfer and expression in mammalian cells. In particular embodiments, coding sequences of polypeptides disclosed herein can be ligated into such expression vectors for the expression of the polypeptides in mammalian cells.

    [0275] In particular embodiments, the vector is an episomal vector or a vector that is maintained extrachromosomally. As used herein, the term “episomal” refers to a vector that is able to replicate without integration into host's chromosomal DNA and without gradual loss from a dividing host cell also meaning that said vector replicates extrachromosomally or episomally.

    [0276] “Expression control sequences,” “control elements,” or “regulatory sequences” present in an expression vector are those non-translated regions of the vector—origin of replication, selection cassettes, promoters, enhancers, translation initiation signals (Shine Dalgarno sequence or Kozak sequence) introns, post-transcriptional regulatory elements, a polyadenylation sequence, 5′ and 3′ untranslated regions—which interact with host cellular proteins to carry out transcription and translation. Such elements may vary in their strength and specificity. Depending on the vector system and host utilized, any number of suitable transcription and translation elements, including ubiquitous promoters and inducible promoters may be used.

    [0277] In particular embodiments, a polynucleotide comprises a vector, including but not limited to expression vectors and viral vectors. A vector may comprise one or more exogenous, endogenous, or heterologous control sequences such as promoters and/or enhancers. An “endogenous control sequence” is one which is naturally linked with a given gene in the genome. An “exogenous control sequence” is one which is placed in juxtaposition to a gene by means of genetic manipulation (i.e., molecular biological techniques) such that transcription of that gene is directed by the linked enhancer/promoter. A “heterologous control sequence” is an exogenous sequence that is from a different species than the cell being genetically manipulated. A “synthetic” control sequence may comprise elements of one more endogenous and/or exogenous sequences, and/or sequences determined in vitro or in silico that provide optimal promoter and/or enhancer activity for the particular therapy.

    [0278] The term “promoter” as used herein refers to a recognition site of a polynucleotide (DNA or RNA) to which an RNA polymerase binds. An RNA polymerase initiates and transcribes polynucleotides operably linked to the promoter. In particular embodiments, promoters operative in mammalian cells comprise an AT-rich region located approximately 25 to 30 bases upstream from the site where transcription is initiated and/or another sequence found 70 to 80 bases upstream from the start of transcription, a CNCAAT region where N may be any nucleotide.

    [0279] The term “enhancer” refers to a segment of DNA which contains sequences capable of providing enhanced transcription and in some instances can function independent of their orientation relative to another control sequence. An enhancer can function cooperatively or additively with promoters and/or other enhancer elements. The term “promoter/enhancer” refers to a segment of DNA which contains sequences capable of providing both promoter and enhancer functions.

    [0280] The term “operably linked”, refers to a juxtaposition wherein the components described are in a relationship permitting them to function in their intended manner. In one embodiment, the term refers to a functional linkage between a nucleic acid expression control sequence (such as a promoter, and/or enhancer) and a second polynucleotide sequence, e.g., a polynucleotide-of-interest, wherein the expression control sequence directs transcription of the nucleic acid corresponding to the second sequence.

    [0281] As used herein, the term “constitutive expression control sequence” refers to a promoter, enhancer, or promoter/enhancer that continually or continuously allows for transcription of an operably linked sequence. A constitutive expression control sequence may be a “ubiquitous” promoter, enhancer, or promoter/enhancer that allows expression in a wide variety of cell and tissue types or a “cell specific,” “cell type specific,” “cell lineage specific,” or “tissue specific” promoter, enhancer, or promoter/enhancer that allows expression in a restricted variety of cell and tissue types, respectively.

    [0282] Illustrative ubiquitous expression control sequences suitable for use in particular embodiments include, but are not limited to, a cytomegalovirus (CMV) immediate early promoter, a viral simian virus 40 (SV40) (e.g., early or late), a Moloney murine leukemia virus (MoMLV) LTR promoter, a Rous sarcoma virus (RSV) LTR, a herpes simplex virus (HSV) (thymidine kinase) promoter, H5, P7.5, and P11 promoters from vaccinia virus, a short elongation factor 1-alpha (EF1a-short) promoter, a long elongation factor 1-alpha (EF1a-long) promoter, early growth response 1 (EGR1), ferritin H (FerH), ferritin L (FerL), Glyceraldehyde 3-phosphate dehydrogenase (GAPDH), eukaryotic translation initiation factor 4A1 (EIF4A1), heat shock 70 kDa protein 5 (HSPA5), heat shock protein 90 kDa beta, member 1 (HSP90B1), heat shock protein 70 kDa (HSP70), β-kinesin (β-KIN), the human ROSA 26 locus (Irions et al., Nature Biotechnology 25, 1477-1482 (2007)), a Ubiquitin C promoter (UBC), a phosphoglycerate kinase-1 (PGK) promoter, a cytomegalovirus enhancer/chicken (3-actin (CAG) promoter, a β-actin promoter and a myeloproliferative sarcoma virus enhancer, negative control region deleted, dl587rev primer-binding site substituted (MND) promoter (Challita et al., J Virol. 69(2):748-55 (1995)).

    [0283] In a particular embodiment, it may be desirable to use a cell, cell type, cell lineage or tissue specific expression control sequence to achieve cell type specific, lineage specific, or tissue specific expression of a desired polynucleotide sequence (e.g., to express a particular nucleic acid encoding a polypeptide in only a subset of cell types, cell lineages, or tissues or during specific stages of development).

    [0284] As used herein, “conditional expression” may refer to any type of conditional expression including, but not limited to, inducible expression; repressible expression; expression in cells or tissues having a particular physiological, biological, or disease state, etc. This definition is not intended to exclude cell type or tissue specific expression. Certain embodiments provide conditional expression of a polynucleotide-of-interest, e.g., expression is controlled by subjecting a cell, tissue, organism, etc., to a treatment or condition that causes the polynucleotide to be expressed or that causes an increase or decrease in expression of the polynucleotide encoded by the polynucleotide-of-interest.

    [0285] Illustrative examples of inducible promoters/systems include, but are not limited to, steroid-inducible promoters such as promoters for genes encoding glucocorticoid or estrogen receptors (inducible by treatment with the corresponding hormone), metallothionine promoter (inducible by treatment with various heavy metals), MX-1 promoter (inducible by interferon), the “GeneSwitch” mifepristone-regulatable system (Sinn et al., 2003, Gene, 323:67), the cumate inducible gene switch (WO 2002/088346), tetracycline-dependent regulatory systems, etc.

    [0286] Conditional expression can also be achieved by using a site specific DNA recombinase. According to certain embodiments, polynucleotides comprise at least one (typically two) site(s) for recombination mediated by a site specific recombinase. As used herein, the terms “recombinase” or “site specific recombinase” include excisive or integrative proteins, enzymes, co-factors or associated proteins that are involved in recombination reactions involving one or more recombination sites (e.g., two, three, four, five, six, seven, eight, nine, ten or more.), which may be wild-type proteins (see Landy, Current Opinion in Biotechnology 3:699-707 (1993)), or mutants, derivatives (e.g., fusion proteins containing the recombination protein sequences or fragments thereof), fragments, and variants thereof. Illustrative examples of recombinases suitable for use in particular embodiments include, but are not limited to: Cre, Int, IHF, Xis, Flp, Fis, Hin, Gin, ΦC31, Cin, Tn3 resolvase, TndX, XerC, XerD, TnpX, Hjc, Gin, SpCCE1, and ParA.

    [0287] The polynucleotides may comprise one or more recombination sites for any of a wide variety of site specific recombinases. It is to be understood that the target site for a site specific recombinase is in addition to any site(s) required for integration of a vector, e.g., a retroviral vector or lentiviral vector. As used herein, the terms “recombination sequence,” “recombination site,” or “site specific recombination site” refer to a particular nucleic acid sequence to which a recombinase recognizes and binds.

    [0288] In particular embodiments, polynucleotides contemplated herein, include one or more polynucleotides-of-interest that encode one or more polypeptides. In particular embodiments, to achieve efficient translation of each of the plurality of polypeptides, the polynucleotide sequences can be separated by one or more IRES sequences or polynucleotide sequences encoding self-cleaving polypeptides.

    [0289] As used herein, an “internal ribosome entry site” or “IRES” refers to an element that promotes direct internal ribosome entry to the initiation codon, such as ATG, of a cistron (a protein encoding region), thereby leading to the cap-independent translation of the gene. See, e.g., Jackson et al., 1990. Trends Biochem Sci 15(12):477-83) and Jackson and Kaminski. 1995. RNA 1(10):985-1000. Examples of IRES generally employed by those of skill in the art include those described in U.S. Pat. No. 6,692,736. Further examples of “IRES” known in the art include, but are not limited to IRES obtainable from picornavirus (Jackson et al., 1990) and IRES obtainable from viral or cellular mRNA sources, such as for example, immunoglobulin heavy-chain binding protein (BiP), the vascular endothelial growth factor (VEGF) (Huez et al. 1998. Mol. Cell. Biol. 18(11):6178-6190), the fibroblast growth factor 2 (FGF-2), and insulin-like growth factor (IGFII), the translational initiation factor eIF4G and yeast transcription factors TFIID and HAP4, the encephelomycarditis virus (EMCV) which is commercially available from Novagen (Duke et al., 1992. J. Virol 66(3):1602-9) and the VEGF IRES (Huez et al., 1998. Mol Cell Biol 18(11):6178-90). IRES have also been reported in viral genomes of Picornaviridae, Dicistroviridae and Flaviviridae species and in HCV, Friend murine leukemia virus (FrMLV) and Moloney murine leukemia virus (MoMLV).

    [0290] In particular embodiments, the polynucleotides comprise polynucleotides that have a consensus Kozak sequence and that encode a desired polypeptide. As used herein, the term “Kozak sequence” refers to a short nucleotide sequence that greatly facilitates the initial binding of mRNA to the small subunit of the ribosome and increases translation. The consensus Kozak sequence is (GCC)RCCATGG (SEQ ID NO: 71), where R is a purine (A or G) (Kozak, 1986. Cell. 44(2):283-92, and Kozak, 1987. Nucleic Acids Res. 15(20):8125-48).

    [0291] Elements directing the efficient termination and polyadenylation of the heterologous nucleic acid transcripts increases heterologous gene expression. Transcription termination signals are generally found downstream of the polyadenylation signal. In particular embodiments, vectors comprise a polyadenylation sequence 3′ of a polynucleotide encoding a polypeptide to be expressed. The term “polyA site” or “polyA sequence” as used herein denotes a DNA sequence which directs both the termination and polyadenylation of the nascent RNA transcript by RNA polymerase II. Polyadenylation sequences can promote mRNA stability by addition of a polyA tail to the 3′ end of the coding sequence and thus, contribute to increased translational efficiency. Cleavage and polyadenylation is directed by a poly(A) sequence in the RNA. The core poly(A) sequence for mammalian pre-mRNAs has two recognition elements flanking a cleavage-polyadenylation site. Typically, an almost invariant AAUAAA hexamer lies 20-50 nucleotides upstream of a more variable element rich in U or GU residues. Cleavage of the nascent transcript occurs between these two elements and is coupled to the addition of up to 250 adenosines to the 5′ cleavage product. In particular embodiments, the core poly(A) sequence is an ideal polyA sequence (e.g., AATAAA, ATTAAA, AGTAAA). In particular embodiments, the poly(A) sequence is an SV40 polyA sequence, a bovine growth hormone polyA sequence (BGHpA), a rabbit β-globin polyA sequence (rβgpA), variants thereof, or another suitable heterologous or endogenous polyA sequence known in the art.

    [0292] In particular embodiments, polynucleotides encoding one or more TALENs, CRISPR/Cas systems, end-processing enzymes, or fusion polypeptides may be introduced into hematopoietic cells, e.g., CD34.sup.+ cells, by both non-viral and viral methods. In particular embodiments, delivery of one or more polynucleotides encoding TALEN or Cas nucleases and/or donor repair templates may be provided by the same method or by different methods, and/or by the same vector or by different vectors.

    [0293] The term “vector” is used herein to refer to a nucleic acid molecule capable transferring or transporting another nucleic acid molecule. The transferred nucleic acid is generally linked to, e.g., inserted into, the vector nucleic acid molecule. A vector may include sequences that direct autonomous replication in a cell, or may include sequences sufficient to allow integration into host cell DNA. In particular embodiments, non-viral vectors are used to deliver one or more polynucleotides contemplated herein to a CD34.sup.+ cell.

    [0294] Illustrative examples of non-viral vectors include, but are not limited to plasmids (e.g., DNA plasmids or RNA plasmids), transposons, cosmids, and bacterial artificial chromosomes.

    [0295] Illustrative methods of non-viral delivery of polynucleotides contemplated in particular embodiments include, but are not limited to: electroporation, sonoporation, lipofection, microinjection, biolistics, virosomes, liposomes, immunoliposomes, nanoparticles, polycation or lipid:nucleic acid conjugates, naked DNA, artificial virions, DEAE-dextran-mediated transfer, gene gun, and heat-shock.

    [0296] Illustrative examples of polynucleotide delivery systems suitable for use in particular embodiments contemplated in particular embodiments include, but are not limited to those provided by Amaxa Biosystems, Maxcyte, Inc., BTX Molecular Delivery Systems, and Copernicus Therapeutics Inc. Lipofection reagents are sold commercially (e.g., Transfectam™ and Lipofectin™). Cationic and neutral lipids that are suitable for efficient receptor-recognition lipofection of polynucleotides have been described in the literature. See e.g., Liu et al. (2003) Gene Therapy. 10:180-187; and Balazs et al. (2011) Journal of Drug Delivery. 2011:1-12. Antibody-targeted, bacterially derived, non-living nanocell-based delivery is also contemplated in particular embodiments.

    [0297] Viral vectors comprising polynucleotides contemplated in particular embodiments can be delivered in vivo by administration to an individual patient, typically by systemic administration (e.g., intravenous, intraperitoneal, intramuscular, subdermal, or intracranial infusion) or topical application, as described below. Alternatively, vectors can be delivered to cells ex vivo, such as cells explanted from an individual patient (e.g., mobilized peripheral blood, lymphocytes, bone marrow aspirates, tissue biopsy, etc.) or universal donor hematopoietic stem cells, followed by reimplantation of the cells into a patient.

    [0298] In one embodiment, viral vectors comprising TALEN variants or CRISPR/Cas systems and/or donor repair templates are administered directly to an organism for transduction of cells in vivo. Alternatively, naked DNA or mRNA can be administered. Administration is by any of the routes normally used for introducing a molecule into ultimate contact with blood or tissue cells including, but not limited to, injection, infusion, topical application and electroporation. Suitable methods of administering such nucleic acids are available and well known to those of skill in the art, and, although more than one route can be used to administer a particular composition, a particular route can often provide a more immediate and more effective reaction than another route.

    [0299] Illustrative examples of viral vector systems suitable for use in particular embodiments contemplated herein include, but are not limited to adeno-associated virus (AAV), retrovirus, herpes simplex virus, adenovirus, and vaccinia virus vectors.

    I. Genome Edited Cells

    [0300] The genome edited cells manufactured by the methods contemplated in particular embodiments provide improved cell-based therapeutics for the treatment of X-linked agammaglobulinemia (XLA). Without wishing to be bound to any particular theory, it is believed that the compositions and methods contemplated herein can be used to introduce a polynucleotide encoding a functional BTK polypeptide into a BTK gene that comprises one or more mutations and/or deletions that result in little or no endogenous BTK expression and XLA; and thus, provide a more robust genome edited cell composition that may be used to treat, and in some embodiments potentially cure, XLA.

    [0301] Genome edited cells contemplated in particular embodiments may be autologous/autogeneic (“self”) or non-autologous (“non-self,” e.g., allogeneic, syngeneic or xenogeneic). “Autologous,” as used herein, refers to cells from the same subject. “Allogeneic,” as used herein, refers to cells of the same species that differ genetically to the cell in comparison. “Syngeneic,” as used herein, refers to cells of a different subject that are genetically identical to the cell in comparison. “Xenogeneic,” as used herein, refers to cells of a different species to the cell in comparison. In preferred embodiments, the cells are obtained from a mammalian subject. In a more preferred embodiment, the cells are obtained from a primate subject, optionally a non-human primate. In the most preferred embodiment, the cells are obtained from a human subject.

    [0302] An “isolated cell” refers to a non-naturally occurring cell, e.g., a cell that does not exist in nature, a modified cell, an engineered cell, etc., that has been obtained from an in vivo tissue or organ and is substantially free of extracellular matrix.

    [0303] Illustrative examples of cell types whose genome can be edited using the compositions and methods contemplated herein include, but are not limited to, cell lines, primary cells, stem cells, progenitor cells, and differentiated cells.

    [0304] The term “stem cell” refers to a cell which is an undifferentiated cell capable of (1) long term self-renewal, or the ability to generate at least one identical copy of the original cell, (2) differentiation at the single cell level into multiple, and in some instance only one, specialized cell type and (3) of in vivo functional regeneration of tissues. Stem cells are subclassified according to their developmental potential as totipotent, pluripotent, multipotent and oligo/unipotent. “Self-renewal” refers a cell with a unique capacity to produce unaltered daughter cells and to generate specialized cell types (potency). Self-renewal can be achieved in two ways. Asymmetric cell division produces one daughter cell that is identical to the parental cell and one daughter cell that is different from the parental cell and is a progenitor or differentiated cell. Symmetric cell division produces two identical daughter cells. “Proliferation” or “expansion” of cells refers to symmetrically dividing cells.

    [0305] As used herein, the term “progenitor” or “progenitor cells” refers to cells have the capacity to self-renew and to differentiate into more mature cells. Many progenitor cells differentiate along a single lineage, but may have quite extensive proliferative capacity.

    [0306] In particular embodiments, the cell is a primary cell. The term “primary cell” as used herein is known in the art to refer to a cell that has been isolated from a tissue and has been established for growth in vitro or ex vivo. Corresponding cells have undergone very few, if any, population doublings and are therefore more representative of the main functional component of the tissue from which they are derived in comparison to continuous cell lines, thus representing a more representative model to the in vivo state. Methods to obtain samples from various tissues and methods to establish primary cell lines are well-known in the art (see, e.g., Jones and Wise, Methods Mol Biol. 1997). Primary cells for use in the methods contemplated herein are derived from umbilical cord blood, placental blood, mobilized peripheral blood and bone marrow. In one embodiment, the primary cell is a hematopoietic stem or progenitor cell.

    [0307] In one embodiment, the genome edited cell is an embryonic stem cell.

    [0308] In one embodiment, the genome edited cell is an adult stem or progenitor cell.

    [0309] In one embodiment, the genome edited cell is primary cell.

    [0310] In a preferred embodiment, the genome edited cell is a hematopoietic cell, e.g., hematopoietic stem cell, hematopoietic progenitor cell, such as a B cell progenitor cell, or cell population comprising hematopoietic cells.

    [0311] As used herein, the term “population of cells” refers to a plurality of cells that may be made up of any number and/or combination of homogenous or heterogeneous cell types, as described elsewhere herein. For example, for transduction of hematopoietic stem or progenitor cells, a population of cells may be isolated or obtained from umbilical cord blood, placental blood, bone marrow, or mobilized peripheral blood. A population of cells may comprise about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or about 100% of the target cell type to be edited. In certain embodiments, hematopoietic stem or progenitor cells may be isolated or purified from a population of heterogeneous cells using methods known in the art.

    [0312] Illustrative sources to obtain hematopoietic cells include, but are not limited to: cord blood, bone marrow or mobilized peripheral blood.

    [0313] Hematopoietic stem cells (HSCs) give rise to committed hematopoietic progenitor cells (HPCs) that are capable of generating the entire repertoire of mature blood cells over the lifetime of an organism. The term “hematopoietic stem cell” or “HSC” refers to multipotent stem cells that give rise to the all the blood cell types of an organism, including myeloid (e.g., monocytes and macrophages, neutrophils, basophils, eosinophils, erythrocytes, megakaryocytes/platelets, dendritic cells), and lymphoid lineages (e.g., T-cells, B-cells, NK-cells), and others known in the art (See Fei, R., et al., U.S. Pat. No. 5,635,387; McGlave, et al., U.S. Pat. No. 5,460,964; Simmons, P., et al., U.S. Pat. No. 5,677,136; Tsukamoto, et al., U.S. Pat. No. 5,750,397; Schwartz, et al., U.S. Pat. No. 5,759,793; DiGuisto, et al., U.S. Pat. No. 5,681,599; Tsukamoto, et al., U.S. Pat. No. 5,716,827). When transplanted into lethally irradiated animals or humans, hematopoietic stem and progenitor cells can repopulate the erythroid, neutrophil-macrophage, megakaryocyte and lymphoid hematopoietic cell pool.

    [0314] Additional illustrative examples of hematopoietic stem or progenitor cells suitable for use with the methods and compositions contemplated herein include hematopoietic cells that are CD34.sup.+CD38.sup.LoCD90.sup.+CD45.sup.RA−, hematopoietic cells that are CD34.sup.+, CD59.sup.+, Thy1/CD90.sup.+, CD38.sup.Lo/−, C-kit/CD117.sup.+, and Lin.sup.(−), and hematopoietic cells that are CD133.sup.+.

    [0315] In a preferred embodiment, the hematopoietic cells that are CD133.sup.+CD90.sup.+.

    [0316] In a preferred embodiment, the hematopoietic cells that are CD133.sup.+CD34.sup.+.

    [0317] In a preferred embodiment, the hematopoietic cells that are CD133.sup.+CD90.sup.+CD34.sup.+.

    [0318] Various methods exist to characterize hematopoietic hierarchy. One method of characterization is the SLAM code. The SLAM (Signaling lymphocyte activation molecule) family is a group of >10 molecules whose genes are located mostly tandemly in a single locus on chromosome 1 (mouse), all belonging to a subset of immunoglobulin gene superfamily, and originally thought to be involved in T-cell stimulation. This family includes CD48, CD150, CD244, etc., CD150 being the founding member, and, thus, also called slamF1, i.e., SLAM family member 1. The signature SLAM code for the hematopoietic hierarchy is hematopoietic stem cells (HSC)—CD150.sup.+CD48.sup.−CD244.sup.−; multipotent progenitor cells (MPPs)—CD150.sup.−CD48.sup.−CD244.sup.+; lineage-restricted progenitor cells (LRPs)—CD150.sup.−CD48.sup.+CD244.sup.+; common myeloid progenitor (CMP)—lin-SCA-1-c-kit.sup.+CD34.sup.+CD16/32.sup.mid; granulocyte-macrophage progenitor (GMP)-kit.sup.+CD34.sup.+CD16/32.sup.hi; and megakaryocyte-erythroid progenitor (MEP)-kit.sup.+CD34.sup.−CD16/32.sup.low.

    [0319] Preferred target cell types edited with the compositions and methods contemplated herein include, hematopoietic cells, preferably human hematopoietic cells, more preferably human hematopoietic stem and progenitor cells, and even more preferably CD34.sup.+ human hematopoietic stem cells. The term “CD34+ cell,” as used herein refers to a cell expressing the CD34 protein on its cell surface. “CD34,” as used herein refers to a cell surface glycoprotein (e.g., sialomucin protein) that often acts as a cell-cell adhesion factor. CD34+ is a cell surface marker of both hematopoietic stem and progenitor cells.

    [0320] In one embodiment, the genome edited hematopoietic cells are CD150.sup.+CD48.sup.−CD244.sup.− cells.

    [0321] In one embodiment, the genome edited hematopoietic cells are CD34.sup.+CD133.sup.+ cells.

    [0322] In one embodiment, the genome edited hematopoietic cells are CD133.sup.+ cells.

    [0323] In one embodiment, the genome edited hematopoietic cells are CD34.sup.+ cells.

    [0324] In particular embodiments, a population of hematopoietic cells comprising hematopoietic stem and progenitor cells (HSPCs) comprises a defective BTK gene edited to express a functional BTK polypeptide, wherein the edit is a DSB repaired by HDR.

    [0325] In particular embodiments, the genome edited cells comprise B cell progenitor cells.

    [0326] In particular embodiments, the genome edited cells comprise one or more mutations and/or deletions in a BTK gene that result in little or no endogenous BTK expression.

    J. Compositions and Formulations

    [0327] The compositions contemplated in particular embodiments may comprise one or more polypeptides, polynucleotides, vectors comprising same, and genome editing compositions and genome edited cell compositions, as contemplated herein. The genome editing compositions and methods contemplated in particular embodiments are useful for editing a target site in the human BTK gene in a cell or a population of cells. In preferred embodiments, a genome editing composition is used to edit a BTK gene by HDR in a hematopoietic cell, e.g., a hematopoietic stem or progenitor cell, or a CD34.sup.+ cell.

    [0328] In various embodiments, the compositions contemplated herein comprise a TALEN variant or CRISPR/Cas system, and optionally an end-processing enzyme, e.g., a 3′-5′ exonuclease (Trex2). The TALEN variant or Cas protein may be in the form of an mRNA that is introduced into a cell via polynucleotide delivery methods disclosed supra, e.g., electroporation, lipid nanoparticles, etc. In one embodiment, a composition comprising an mRNA encoding a TALEN or a Cas protein, along with a guide RNA if a Cas protein is used, and optionally a 3′-5′ exonuclease, is introduced in a cell via polynucleotide delivery methods disclosed supra.

    [0329] In particular embodiments, the compositions contemplated herein comprise a population of cells, a TALEN variant or CRISPR/Cas system, and optionally, a donor repair template. In particular embodiments, the compositions contemplated herein comprise a population of cells, a TALEN variant or CRISPR/Cas system, an end-processing enzyme, and optionally, a donor repair template. The TALEN variant, or CRISPR/Cas system, and/or end-processing enzyme may be in the form of an mRNA that is introduced into the cell via polynucleotide delivery methods disclosed supra. The donor repair template may also be introduced into the cell by means of a separate composition.

    [0330] In particular embodiments, the compositions contemplated herein comprise a population of cells, a TALEN or CRISPR/Cas and gRNA, and optionally, a donor repair template. In particular embodiments, the compositions contemplated herein comprise a population of cells, a TALEN or CRISPR/Cas and gRNA, a 3′-5′ exonuclease, and optionally, a donor repair template. The TALEN, or CRISPR/Cas and gRNA, and/or 3′-5′ exonuclease may be in the form of an mRNA that is introduced into the cell via polynucleotide delivery methods disclosed supra. The donor repair template may also be introduced into the cell by means of a separate composition. The gRNA and Cas protein may also be introduced into the cell together or by means of separate compositions. The Cas protein can be supplied as a protein or as a polynucleotide encoding the protein.

    [0331] In particular embodiments, the population of cells comprise genetically modified hematopoietic cells including, but not limited to, hematopoietic stem cells, hematopoietic progenitor cells, CD133.sup.+ cells, and CD34.sup.+ cells.

    [0332] Compositions include, but are not limited to pharmaceutical compositions. A “pharmaceutical composition” refers to a composition formulated in pharmaceutically-acceptable or physiologically-acceptable solutions for administration to a cell or an animal, either alone, or in combination with one or more other modalities of therapy. It will also be understood that, if desired, the compositions may be administered in combination with other agents as well, such as, e.g., cytokines, growth factors, hormones, small molecules, chemotherapeutics, pro-drugs, drugs, antibodies, or other various pharmaceutically-active agents. There is virtually no limit to other components that may also be included in the compositions, provided that the additional agents do not adversely affect the composition.

    [0333] The phrase “pharmaceutically acceptable” is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.

    [0334] The term “pharmaceutically acceptable carrier” refers to a diluent, adjuvant, excipient, or vehicle with which the therapeutic cells are administered. Illustrative examples of pharmaceutical carriers can be sterile liquids, such as cell culture media, water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Suitable pharmaceutical excipients in particular embodiments, include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. Except insofar as any conventional media or agent is incompatible with the active ingredient, its use in the therapeutic compositions is contemplated. Supplementary active ingredients can also be incorporated into the compositions.

    [0335] In one embodiment, a composition comprising a pharmaceutically acceptable carrier is suitable for administration to a subject. In particular embodiments, a composition comprising a carrier is suitable for parenteral administration, e.g., intravascular (intravenous or intraarterial), intraperitoneal or intramuscular administration. In particular embodiments, a composition comprising a pharmaceutically acceptable carrier is suitable for intraventricular, intraspinal, or intrathecal administration. Pharmaceutically acceptable carriers include sterile aqueous solutions, cell culture media, or dispersions. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the transduced cells, use thereof in the pharmaceutical compositions is contemplated.

    [0336] In particular embodiments, compositions contemplated herein comprise genetically modified hematopoietic stem and/or progenitor cells comprising an exogenous polynucleotide encoding a functional BTK polypeptide and a pharmaceutically acceptable carrier.

    [0337] In particular embodiments, compositions contemplated herein comprise genetically modified hematopoietic stem and/or progenitor cells comprising a BTK gene comprising one or more mutations and/or deletions and an exogenous polynucleotide encoding a functional BTK polypeptide and a pharmaceutically acceptable carrier. A composition comprising a cell-based composition contemplated herein can be administered by parenteral administration methods.

    [0338] The pharmaceutically acceptable carrier must be of sufficiently high purity and of sufficiently low toxicity to render it suitable for administration to the human subject being treated. It further should maintain or increase the stability of the composition. The pharmaceutically acceptable carrier can be liquid or solid and is selected, with the planned manner of administration in mind, to provide for the desired bulk, consistency, etc., when combined with other components of the composition. For example, the pharmaceutically acceptable carrier can be, without limitation, a binding agent (e.g., pregelatinized maize starch, polyvinylpyrrolidone or hydroxypropyl methylcellulose, etc.), a filler (e.g., lactose and other sugars, microcrystalline cellulose, pectin, gelatin, calcium sulfate, ethyl cellulose, polyacrylates, calcium hydrogen phosphate, etc.), a lubricant (e.g., magnesium stearate, talc, silica, colloidal silicon dioxide, stearic acid, metallic stearates, hydrogenated vegetable oils, corn starch, polyethylene glycols, sodium benzoate, sodium acetate, etc.), a disintegrant (e.g., starch, sodium starch glycolate, etc.), or a wetting agent (e.g., sodium lauryl sulfate, etc.). Other suitable pharmaceutically acceptable carriers for the compositions contemplated herein include, but are not limited to, water, salt solutions, alcohols, polyethylene glycols, gelatins, amyloses, magnesium stearates, talcs, silicic acids, viscous paraffins, hydroxymethylcelluloses, polyvinylpyrrolidones and the like.

    [0339] Such carrier solutions also can contain buffers, diluents and other suitable additives. The term “buffer” as used herein refers to a solution or liquid whose chemical makeup neutralizes acids or bases without a significant change in pH. Examples of buffers contemplated herein include, but are not limited to, Dulbecco's phosphate buffered saline (PBS), Ringer's solution, 5% dextrose in water (D5W), normal/physiologic saline (0.9% NaCl).

    [0340] The pharmaceutically acceptable carriers may be present in amounts sufficient to maintain a pH of the composition of about 7. Alternatively, the composition has a pH in a range from about 6.8 to about 7.4, e.g., 6.8, 6.9, 7.0, 7.1, 7.2, 7.3, and 7.4. In still another embodiment, the composition has a pH of about 7.4.

    [0341] Compositions contemplated herein may comprise a nontoxic pharmaceutically acceptable medium. The compositions may be a suspension. The term “suspension” as used herein refers to non-adherent conditions in which cells are not attached to a solid support. For example, cells maintained as a suspension may be stirred or agitated and are not adhered to a support, such as a culture dish.

    [0342] In particular embodiments, compositions contemplated herein are formulated in a suspension, where the genome edited hematopoietic stem and/or progenitor cells are dispersed within an acceptable liquid medium or solution, e.g., saline or serum-free medium, in an intravenous (IV) bag or the like. Acceptable diluents include, but are not limited to water, PlasmaLyte, Ringer's solution, isotonic sodium chloride (saline) solution, serum-free cell culture medium, and medium suitable for cryogenic storage, e.g., Cryostor® medium.

    [0343] In certain embodiments, a pharmaceutically acceptable carrier is substantially free of natural proteins of human or animal origin, and suitable for storing a composition comprising a population of genome edited cells, e.g., hematopoietic stem and progenitor cells. The therapeutic composition is intended to be administered into a human patient, and thus is substantially free of cell culture components such as bovine serum albumin, horse serum, and fetal bovine serum.

    [0344] In some embodiments, compositions are formulated in a pharmaceutically acceptable cell culture medium. Such compositions are suitable for administration to human subjects. In particular embodiments, the pharmaceutically acceptable cell culture medium is a serum free medium.

    [0345] Serum-free medium has several advantages over serum containing medium, including a simplified and better defined composition, a reduced degree of contaminants, elimination of a potential source of infectious agents, and lower cost. In various embodiments, the serum-free medium is animal-free, and may optionally be protein-free. Optionally, the medium may contain bio pharmaceutically acceptable recombinant proteins. “Animal-free” medium refers to medium wherein the components are derived from non-animal sources. Recombinant proteins replace native animal proteins in animal-free medium and the nutrients are obtained from synthetic, plant or microbial sources. “Protein-free” medium, in contrast, is defined as substantially free of protein.

    [0346] Illustrative examples of serum-free media used in particular compositions include, but are not limited to QBSF-60 (Quality Biological, Inc.), StemPro-34 (Life Technologies), and X-VIVO 10.

    [0347] In a preferred embodiment, the compositions comprising genome edited hematopoietic stem and/or progenitor cells are formulated in PlasmaLyte.

    [0348] In various embodiments, compositions comprising hematopoietic stem and/or progenitor cells are formulated in a cryopreservation medium. For example, cryopreservation media with cryopreservation agents may be used to maintain a high cell viability outcome post-thaw. Illustrative examples of cryopreservation media used in particular compositions include, but are not limited to, CryoStor CS10, CryoStor CS5, and CryoStor CS2.

    [0349] In one embodiment, the compositions are formulated in a solution comprising 50:50 PlasmaLyte A to CryoStor CS10.

    [0350] In particular embodiments, the composition is substantially free of mycoplasma, endotoxin, and microbial contamination. By “substantially free” with respect to endotoxin is meant that there is less endotoxin per dose of cells than is allowed by the FDA for a biologic, which is a total endotoxin of 5 EU/kg body weight per day, which for an average 70 kg person is 350 EU per total dose of cells. In particular embodiments, compositions comprising hematopoietic stem or progenitor cells transduced with a retroviral vector contemplated herein contains about 0.5 EU/mL to about 5.0 EU/mL, or about 0.5 EU/mL, 1.0 EU/mL, 1.5 EU/mL, 2.0 EU/mL, 2.5 EU/mL, 3.0 EU/mL, 3.5 EU/mL, 4.0 EU/mL, 4.5 EU/mL, or 5.0 EU/mL.

    [0351] In certain embodiments, compositions and formulations suitable for the delivery of polynucleotides are contemplated including, but not limited to, one or more mRNAs encoding one or more TALEN variants or CRISPR/Cas systems, and optionally end-processing enzymes.

    [0352] Exemplary formulations for ex vivo delivery may also include the use of various transfection agents known in the art, such as calcium phosphate, electroporation, heat shock and various liposome formulations (i.e., lipid-mediated transfection). Liposomes, as described in greater detail below, are lipid bilayers entrapping a fraction of aqueous fluid. DNA spontaneously associates to the external surface of cationic liposomes (by virtue of its charge) and these liposomes will interact with the cell membrane.

    [0353] In particular embodiments, formulation of pharmaceutically-acceptable carrier solutions is well-known to those of skill in the art, as is the development of suitable dosing and treatment regimens for using the particular compositions described herein in a variety of treatment regimens, including e.g., enteral and parenteral, e.g., intravascular, intravenous, intraarterial, intraosseously, intraventricular, intracerebral, intracranial, intraspinal, intrathecal, and intramedullary administration and formulation. It would be understood by the skilled artisan that particular embodiments contemplated herein may comprise other formulations, such as those that are well known in the pharmaceutical art, and are described, for example, in Remington: The Science and Practice of Pharmacy, volume I and volume II. 22.sup.nd Edition. Edited by Loyd V. Allen Jr. Philadelphia, Pa.: Pharmaceutical Press; 2012, which is incorporated by reference herein, in its entirety.

    K. Genome Edited Cell Therapies

    [0354] The genome edited cells manufactured by the methods contemplated in particular embodiments provide improved drug products for use in the prevention, treatment, and amelioration of X-linked agammaglobulinemia (XLA) or for preventing, treating, or ameliorating at least one symptom associated with XLA or a subject having an XLA causing mutation in a BTK gene. As used herein, the term “drug product” refers to genetically modified cells produced using the compositions and methods contemplated herein. In particular embodiments, the drug product comprises genetically modified hematopoietic stem or progenitor cells, e.g., CD34.sup.+ cells. The genetically modified hematopoietic stem or progenitor cells give rise to the entire B cell lineage, whereas non-modified cells comprising one or more mutations and/or deletions in a BTK gene that lead to XLA are defective in B cell development.

    [0355] In particular embodiments, hematopoietic stem or progenitor cells that will be edited comprise a non-functional or disrupted, ablated, or partially deleted BTK gene, thereby reducing or eliminating BTK expression and abrogating normal B cell development.

    [0356] In particular embodiments, genome edited hematopoietic stem or progenitor cells comprise a non-functional or disrupted, ablated, or partially deleted BTK gene, thereby reducing or eliminating endogenous BTK expression and further comprise a polynucleotide, inserted into the BTK gene, encoding a functional BTK polypeptide that restores normal B cell development.

    [0357] In particular embodiments, genome edited hematopoietic stem or progenitor cells provide a curative, preventative, or ameliorative therapy to a subject diagnosed with or that is suspected of having XLA.

    [0358] In various embodiments, the genome editing compositions are administered by direct injection to a cell, tissue, or organ of a subject in need of gene therapy, in vivo, e.g., bone marrow. In various other embodiments, cells are edited in vitro or ex vivo with TALEN variants or CRISPR/Cas systems contemplated herein, and optionally expanded ex vivo. The genome edited cells are then administered to a subject in need of therapy.

    [0359] Preferred cells for use in the genome editing methods contemplated herein include autologous/autogeneic (“self”) cells, preferably hematopoietic cells, more preferably hematopoietic stem or progenitor cell, and even more preferably CD34.sup.+ cells.

    [0360] As used herein, the terms “individual” and “subject” are often used interchangeably and refer to any animal that exhibits a symptom of XLA that can be treated with the TALEN or CRISPR/Cas, genome editing compositions, gene therapy vectors, genome editing vectors, genome edited cells, and methods contemplated elsewhere herein. Suitable subjects (e.g., patients) include laboratory animals (such as mouse, rat, rabbit, or guinea pig), farm animals, and domestic animals or pets (such as a cat or dog). Non-human primates and, preferably, human subjects, are included. Typical subjects include human patients that have, have been diagnosed with, or are at risk of having XLA.

    [0361] As used herein, the term “patient” refers to a subject that has been diagnosed with XLA that can be treated with the TALEN or CRISPR/Cas, genome editing compositions, gene therapy vectors, genome editing vectors, genome edited cells, and methods contemplated elsewhere herein.

    [0362] As used herein “treatment” or “treating,” includes any beneficial or desirable effect on the symptoms or pathology of XLA, and may include even minimal reductions in one or more measurable markers of XLA. Treatment can optionally involve delaying of the progression of XLA. “Treatment” does not necessarily indicate complete eradication or cure of XLA, or associated symptoms thereof.

    [0363] As used herein, “prevent,” and similar words such as “prevention,” “prevented,” “preventing” etc., indicate an approach for preventing, inhibiting, or reducing the likelihood of the occurrence or recurrence of, XLA. It also refers to delaying the onset or recurrence of XLA or delaying the occurrence or recurrence of XLA. As used herein, “prevention” and similar words also includes reducing the intensity, effect, symptoms and/or burden of XLA prior to its onset or recurrence.

    [0364] As used herein, the phrase “ameliorating at least one symptom of” refers to decreasing one or more symptoms of XLA. In particular embodiments, one or more symptoms of XLA that are ameliorated include, but are not limited to, common infections including but not limited to bronchitis (airway infection), chronic diarrhea, conjunctivitis (eye infection), otitis media (middle ear infection), pneumonia (lung infection), sinusitis (sinus infection), skin infections, upper respiratory tract infections; infections due to bacteria, viruses, and other microbes; and bacterial infections including, but not limited to, Haemophilus influenzae, pneumococci (Streptococcus pneumoniae), and staphylococci infections.

    [0365] As used herein, the term “amount” refers to “an amount effective” or “an effective amount” of a TALEN variant or CRISPR/Cas system, genome editing composition, or genome edited cell sufficient to achieve a beneficial or desired prophylactic or therapeutic result, including clinical results.

    [0366] A “prophylactically effective amount” refers to an amount of a TALEN variant or CRISPR/Cas system, genome editing composition, or genome edited cell sufficient to achieve the desired prophylactic result. Typically but not necessarily, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount is less than the therapeutically effective amount.

    [0367] A “therapeutically effective amount” of a TALEN variant or CRISPR/Cas system, genome editing composition, or genome edited cell may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability to elicit a desired response in the individual. A therapeutically effective amount is also one in which any toxic or detrimental effects are outweighed by the therapeutically beneficial effects. The term “therapeutically effective amount” includes an amount that is effective to “treat” a subject (e.g., a patient). When a therapeutic amount is indicated, the precise amount of the compositions contemplated in particular embodiments, to be administered, can be determined by a physician in view of the specification and with consideration of individual differences in age, weight, tumor size, extent of infection or metastasis, and condition of the patient (subject).

    [0368] The genome edited cells may be administered as part of a bone marrow or cord blood transplant in an individual that has or has not undergone bone marrow ablative therapy. In one embodiment, genome edited cells contemplated herein are administered in a bone marrow transplant to an individual that has undergone chemoablative or radioablative bone marrow therapy.

    [0369] In one embodiment, a dose of genome edited cells is delivered to a subject intravenously. In preferred embodiments, genome edited hematopoietic stem cells are intravenously administered to a subject.

    [0370] In one illustrative embodiment, the effective amount of genome edited cells provided to a subject is at least 2×10.sup.6 cells/kg, at least 3×10.sup.6 cells/kg, at least 4×10.sup.6 cells/kg, at least 5×10.sup.6 cells/kg, at least 6×10.sup.6 cells/kg, at least 7×10.sup.6 cells/kg, at least 8×10.sup.6 cells/kg, at least 9×10.sup.6 cells/kg, or at least 10×10.sup.6 cells/kg, or more cells/kg, including all intervening doses of cells.

    [0371] In another illustrative embodiment, the effective amount of genome edited cells provided to a subject is about 2×10.sup.6 cells/kg, about 3×10.sup.6 cells/kg, about 4×10.sup.6 cells/kg, about 5×10.sup.6 cells/kg, about 6×10.sup.6 cells/kg, about 7×10.sup.6 cells/kg, about 8×10.sup.6 cells/kg, about 9×10.sup.6 cells/kg, or about 10×10.sup.6 cells/kg, or more cells/kg, including all intervening doses of cells.

    [0372] In another illustrative embodiment, the effective amount of genome edited cells provided to a subject is from about 2×10.sup.6 cells/kg to about 10×10.sup.6 cells/kg, about 3×10.sup.6 cells/kg to about 10×10.sup.6 cells/kg, about 4×10.sup.6 cells/kg to about 10×10.sup.6 cells/kg, about 5×10.sup.6 cells/kg to about 10×10.sup.6 cells/kg, 2×10.sup.6 cells/kg to about 6×10.sup.6 cells/kg, 2×10.sup.6 cells/kg to about 7×10.sup.6 cells/kg, 2×10.sup.6 cells/kg to about 8×10.sup.6 cells/kg, 3×10.sup.6 cells/kg to about 6×10.sup.6 cells/kg, 3×10.sup.6 cells/kg to about 7×10.sup.6 cells/kg, 3×10.sup.6 cells/kg to about 8×10.sup.6 cells/kg, 4×10.sup.6 cells/kg to about 6×10.sup.6 cells/kg, 4×10.sup.6 cells/kg to about 7×10.sup.6 cells/kg, 4×10.sup.6 cells/kg to about 8×10.sup.6 cells/kg, 5×10.sup.6 cells/kg to about 6×10.sup.6 cells/kg, 5×10.sup.6 cells/kg to about 7×10.sup.6 cells/kg, 5×10.sup.6 cells/kg to about 8×10.sup.6 cells/kg, or 6×10.sup.6 cells/kg to about 8×10.sup.6 cells/kg, including all intervening doses of cells.

    [0373] Some variation in dosage will necessarily occur depending on the condition of the subject being treated. The person responsible for administration will, in any event, determine the appropriate dose for the individual subject.

    [0374] In particular embodiments, a genome edited cell therapy is used to treat, prevent, or ameliorate XLA, or a condition associated therewith, comprising administering to subject having one or more mutations and/or deletions in a BTK gene that results in little or no endogenous BTK expression, a therapeutically effective amount of the genome edited cells contemplated herein. In one embodiment, the genome edited cell therapy lacks functional endogenous BTK expression, but comprises an exogenous polynucleotide encoding a functional BTK polypeptide.

    [0375] In various embodiments, a subject is administered an amount of genome edited cells comprising an exogenous polynucleotide encoding a functional BTK polypeptide, effective to increase BTK expression in the subject. In particular embodiments, the amount of BTK expression from the exogenous polynucleotide in genome edited cells comprising one or more deleterious mutations or deletions in a BTK gene is increased at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 2-fold, at least about 5-fold, at least about 10-fold, at least about 50-fold, at least about 100-fold, at least about 200-fold, at least about 300-fold, at least about 400-fold, at least about 500-fold, or at least about 1000-fold, or more compared endogenous BTK expression.

    [0376] One of ordinary skill in the art would be able to use routine methods in order to determine the appropriate route of administration and the correct dosage of an effective amount of a composition comprising genome edited cells contemplated herein. It would also be known to those having ordinary skill in the art to recognize that in certain therapies, multiple administrations of pharmaceutical compositions contemplated herein may be required to effect therapy.

    [0377] One of the prime methods used to treat subjects amenable to treatment with genome edited hematopoietic stem and progenitor cell therapies is blood transfusion. Thus, one of the chief goals of the compositions and methods contemplated herein is to reduce the number of, or eliminate the need for, transfusions.

    [0378] In particular embodiments, the drug product is administered once.

    [0379] In certain embodiments, the drug product is administered 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more times over a span of 1 year, 2 years, 5, years, 10 years, or more.

    [0380] All publications, patent applications, and issued patents cited in this specification are herein incorporated by reference as if each individual publication, patent application, or issued patent were specifically and individually indicated to be incorporated by reference.

    [0381] Although the foregoing embodiments have been described in some detail by way of illustration and example for purposes of clarity of understanding, it will be readily apparent to one of ordinary skill in the art in light of the teachings contemplated herein that certain changes and modifications may be made thereto without departing from the spirit or scope of the appended claims. The following examples are provided by way of illustration only and not by way of limitation. Those of skill in the art will readily recognize a variety of noncritical parameters that could be changed or modified to yield essentially similar results.

    EXAMPLES

    Example 1

    TALEN-Based Gene Editing at Target Site in Intron 2 of the Human BTK Gene

    [0382] TALENs were generated to target sites T1-T4 within the human BTK gene. (FIG. 1A). The sequences of the TALENs were as follows:

    TABLE-US-00007 TABLE 2 TAL effector domain RVDs T1 (#1181) T1-F RVDs HD NG HD NN NI HD NG NI NG NN NI NI NI NI HD NG T1-R RVDs HD NG NI NI NN NN HD HD NI NI NN NG HD HD NG T2 (#1182) T2-F RVDs NI NG HD NI NI NN NN NI HD NG NG NN NN HD HD NG T2-R RVDs NI HD HD NI NI HD NN NI NI NI NI NG NG NG NI HD HD NG T3 (#1183) T3-F RVDs NI NG NG NG HD HD NG NI NN HD HD NG NI NG NI NI HD NG T3-R RVDs NN NN HD NG NG HD NG NG NI NN NN NI HD HD NG NG NG T4 T4-F RVDs HD HD NI NG NG NG NN NI NI NI HD NG NI NN NN NG T4-R RVDs HD HD NG HD NI NG HD HD HD NG HD NG NG NN NN NG NG

    [0383] FIG. 1B shows the percent disruption achieved with each TALEN in primary T cells. Primary human T cells were cultured in T cell growth medium supplemented with IL-2 (50 ng/ml), IL-7 (5 ng/ml), and IL-15 (5 ng/ml) and stimulated using CD3/CD28 beads (Dynabeads, Life Technologies) for 48 hours. Beads were removed and cells rested overnight followed by electroporation using Neon Transfection system with either TALEN mRNA (1 μg of each RNA monomer) Cells were cultured for 5 more days and genomic DNA was extracted. The region surrounding the cut site was amplified and purified using PCR purification kit. 200 ng of purified PCR product was incubated with T7 endonuclease (NEB), analyzed on a gel and percent disruption quantified using Licor Image Studio Lite software. TALEN T3 was used in experiments in subsequent figures.

    [0384] FIG. 1C shows a schematic of AAV donor templates for editing BTK gene using TALENs. DT AAV vector has 1 kb of homology arms flanking an MND promoter driven green fluorescent protein (GFP) cassette. DT-Del AAV donor has deletion of the genomic region spanning the end of the 5′ homology arm to the TAL spacer domain resulting in a partial deletion of the second exon and intron to abolish cleavage by the TALEN.

    [0385] FIG. 1D shows editing in primary T cells using TALENs and AAV donor templates. Bar graphs depicts the time course of GFP expression. Percent homologous recombination (HR) is reported as percent (%) GFP at day 15.

    [0386] FIG. 1E shows representative FACS plots showing GFP expression at days 2 and 15 post-editing of primary T cells using co-delivery of TALENs and AAV donors.

    Example 2

    CRISPR/Cas Gene Editing at Target Site in Intron 2 of the Human BTK Gene

    [0387] TALENs were generated to target sites within the human BTK gene corresponding to guide RNA locations G1-G9. (FIG. 2A). The gRNA sequences were as follows:

    TABLE-US-00008 Guide Sequence G1 AGCTATGGCCGCAGTGATTC G2 AGGCGCTTCTTGAAGTTTAG G3 ATGAGTATGACTTTGAACGT G4 AGGGATGAGGATTAATGTCC G5 ACACTGAATTGGGGGGGGAT G6 AACTAGGTAGCTAGGCTGAG G7 GCTTTAGCTAGTTATAGGCT G8 AGAGGTAAATTTTCGTTGGT G9 GATGCACACTGAATTGGGGG

    [0388] FIG. 2B shows percent (%) disruption at the BTK locus with guides G1 through G9 as determined by T7 endonuclease (New England Biolabs). Percent disruption was quantified using Licor Image Studio Lite software. Guide G3 was used in experiments in subsequent figures.

    [0389] FIG. 2C shows chematic of three exemplary AAV donor templates for editing BTK gene using CRISPR-Cas. DT AAV vector has 1 kb of homology arms flanking an MND promoter driven green fluorescent protein (GFP). DT-PAM AAV donor has mutations in PAM sequence to abolish cleavage by guide G3. The DT-Del vector has a deletion to abolish cleavage by guide G3.

    Example 3

    CRISPR/Cas Gene Editing in Primary T Cells by Co-Delivery of Ribonucleoprotein Complex (RNP) of Cas9 Protein and Single Guide RNA and AAV Donors

    [0390] FIG. 2D Shows editing in primary T cells using co-delivery of Cas9 plus guides and AAV donor templates. Primary human CD3+ T cells were cultured and bead stimulated. Cells were then transfected with Ribonucleoprotein complex (RNP) of Cas9 protein and single guide RNA and AAV donors added two hours later at 20% of culture volume. Cells were analyzed for GFP expression on Days 2, 8 and 15. GFP expression at day 15 is indicative of homology directed repair (HDR).

    [0391] FIG. 2E shows representative FACS plots showing GFP expression at days 2 and 15 post editing of primary T cells using RNPs plus AAV donors.

    Example 4

    Gene Editing in CD34+ T Cells with CRISPR/Cas or Talen-Based Systems

    [0392] FIG. 3A shows a schematic of human CD34.sup.+ cell editing protocol. Adult human Mobilized CD34.sup.+ cells were cultured in SCGM media supplemented with TPO, SCF, FLT3L (100 ng/ml) and IL3 (60 ng/ml) for 48 hours, followed by electroporation using Neon electroporation system with either TALENs or Ribonucleoprotein complex (RNP) of Cas9 protein and single guide RNA mixed in 1:1.2 ratio. The sgRNA was purchased from Trilink Biotechnologies and has chemically modified nucleotides at the three terminal positions at 5′ and 3′ ends. The cells were analyzed by flow cytometry on days 2 and 5.

    [0393] FIG. 3B shows editing of the BTK locus in CD34.sup.+ HSCs using co-delivery of TALEN mRNA and AAV donor template. Adult mobilized human CD34.sup.+ cells were cultured in SCGM media as described before followed by electroporation using Neon electroporation system with TALEN mRNA. AAV vector carrying the donor template was added immediately after electroporation. Controls included un-manipulated cells and cells transduced with AAV only without transfection of a nuclease (AAV). Bar graphs depict % GFP at day 5, indicative of HDR.

    [0394] FIG. 3C shows FACS plots depicting GFP expression from Mock, AAV or AAV plus TALEN treated CD34.sup.+ cells, 2 and 5 days post editing.

    [0395] FIG. 3D shows CD34.sup.+ cell viability post editing with TALENs and AAV donors. Bar graphs represent viability of mock and AAV only and AAV plus TALEN treated cells 2 and 5 days post editing.

    [0396] FIG. 3E shows CFU assay for TALEN edited CD34.sup.+ cells. TALEN edited, TALEN only, AAV only and mock cells were plated one day post editing onto Methocult media for colony formation unit (CFU) assay. Briefly, 500 cells were plated in duplicate in Methocult H4034 media (Stemcell Technologies), incubated at 37° C. for 12-14 days and colonies enumerated based on their morphology and GFP expression. CFU-E: Colony forming unit erythroid, M: Macrophage, GM: Granulocyte, macrophage, G: Granulocyte, GEMM: Granulocyte, erythroid, macrophage, megakaryocyte, BFU-E: Burst forming unit erythroid. n=3 independent donors. Data are presented as mean±SEM.

    [0397] FIG. 4A shows editing of the BTK locus in CD34.sup.+ HSCs using co-delivery of RNPs and AAV donor template. Adult mobilized human CD34.sup.+ cells were cultured in SCGM media as described before followed by electroporation using Neon electroporation system with RNP complex. AAV vector carrying the donor template was added immediately after electroporation. Controls included un-manipulated cells and cells transduced with AAV only without transfection of a nuclease (AAV). Bar graphs depict % GFP at day 5, indicative of HDR.

    [0398] FIG. 4B shows the same experiment as FIG. 4A and depicts representative FACs plots showing GFP expression at days 2 and 5.

    [0399] FIG. 4C shows CD34.sup.+ cell viability post editing with RNPs and AAV donors. Bar graphs represent viability of mock and AAV only and AAV plus RNP treated cells (at various RNP and AAV doses) 2 and 5 days post editing.

    [0400] FIG. 4D shows CFU assay for RNP edited CD34.sup.+ cells. RNP edited, AAV only and mock cells were plated one day post editing onto Methocult media for colony formation unit (CFU) assay. Briefly, 500 cells were plated in duplicate in Methocult H4034 media (Stemcell Technologies), incubated at 37° C. for 12-14 days and colonies enumerated based on their morphology and GFP expression. CFU-E: Colony forming unit erythroid, M: Macrophage, GM: Granulocyte, macrophage, G: Granulocyte, GEMM: Granulocyte, erythroid, macrophage, megakaryocyte, BFU-E: Burst forming unit erythroid. n=3 independent donors. Data are presented as mean±SEM.

    [0401] FIG. 5A shows schematic of promoter-less AAV donor template expressing GFP. This vector contains a GFP, a truncated woodchuck hepatitis virus posttranscriptional regulatory element (WPRE3) and an SV40 polyadenylation signal. This insert is flanked on either side by 0.5 kb homology arms to the BTK locus.

    [0402] FIG. 5B shows editing of the BTK locus using promoterless GFP vector in CD34.sup.+ HSCs using co-delivery of RNPs and AAV donor template. Bar graphs depict % GFP at days 1, 2 and 5, % GFP at day 5 is indicative of HDR.

    [0403] FIG. 5C shows the same experiment as FIG. 4A and depicts representative FACs plots showing GFP expression at days 2 and 5.

    [0404] FIG. 5D shows CD34.sup.+ cell viability post editing with RNPs and promoter-less AAV donor. Bar graphs represent viability of mock and AAV only and AAV plus RNP treated cells (at various RNP and AAV doses) 1, 2 and 5 days post editing. % GFP at day 5 is indicative of % HDR.

    [0405] FIG. 5E shows digital droplet PCR assay for determining HDR. Genomic DNA was isolated from hematopoietic stem and progenitor cells (HSPCs) using a DNeasy Blood and Tissue kit (Qiagen). To assess editing rates, “in-out” droplet digital PCR was performed with the forward primer binding within the AAV insert and the reverse primer binding the BTK locus outside the region of homology. A control amplicon of similar size was generated for the ActB gene to serve as a control. All reactions were performed in duplicate. The PCR reactions were partitioned into droplets using a QX200 Droplet Generator (Bio-Rad). Amplification was performed using ddPCR Supermix for Probes without UTP (Bio-Rad), 900 nM of primers, 250 nM of Probe, 50 ng of genomic DNA, and 1% DMSO. Droplets were analyzed on the QX200 Droplet Digital PCR System (Bio-Rad) using QuantaSoft software (Bio-Rad).

    [0406] FIG. 6 shows a schematic of AAV donor template expressing codon optimized BTK.

    Example 5

    AAV Targeting Vectors Sequences

    [0407] #DT (#1177) (SEQ ID NO: 19)

    [0408] AAV targeting vector for BTK locus. This vector contains an MND promoter, eGFP (enhanced green fluorescent protein) and an SV40 polyadenylation signal and is flanked by ˜1 kb homology arms.

    [0409] DT-Del (#1233) (SEQ ID NO: 20)

    [0410] This vector contains an MND promoter, eGFP and an SV40 polyadenylation signal. This insert is flanked on either side by roughly 1 kb homology arms to the BTK locus. This vector is specifically designed for use with BTK TALEN T3. The TALEN binding site is deleted to abolish cleavage by the TALEN.

    [0411] DT-PAM 1254 (SEQ ID NO: 21)

    [0412] This vector contains an MND promoter, eGFP and an SV40 polyadenylation signal. This insert is flanked on either side by roughly 1 kb homology arms to the BTK locus. This vector is designed to work with BTK guide G3 as the PAM site is deleted to abolish cleavage of repair template by the guide.

    [0413] DT-PAM mut (#1251) (SEQ ID NO: 22)

    [0414] This vector contains an MND promoter, eGFP and an SV40 polyadenylation signal. This insert is flanked on either side by roughly 1 kb homology arms to the BTK locus. The PAM site is mutated to abolish cleavage by guide G3.

    [0415] ATG-DT-Del (#1375) (SEQ ID NO: 23)

    [0416] This vector contains eGFP, a truncated woodchuck hepatitis virus posttranscriptional regulatory element (WPRE3) and an SV40 polyadenylation signal and is flanked by 0.5 kb homology rams to the BTK locus. It is designed to work with BTK guide G3.

    [0417] ATG-BTK DT-DEL (#1379) (SEQ ID NO: 24)

    [0418] This vector contains a codon-optimized BTK cDNA, a truncated woodchuck hepatitis virus posttranscriptional regulatory element (WPRE3) and an SV40 polyadenylation signal. This insert is flanked on either side by 0.5 kb homology arms to the BTK locus and is specifically designed to work with BTK guide G3.

    Example 6

    HDR:NHEJ Ratios in CD34+ T Cells with CRISPR/Cas or TALEN-Based Systems

    [0419] Summary

    [0420] FIG. 7 depicts comparison of the ratio of homology directed repair:non-homologous end joining with RNP to the TALENs platform (when co-delivered with rAAV6 targeting vectors). A higher HDR:NHEJ ratio is favorable as it means that the cells are primed to repair the cut using HDR instead of mutagenic NHEJ.

    [0421] While high-levels of HDR are achieved with both nuclease platforms, the HDR:NHEJ ratio is higher for TALEN plus AAV compared to RNP plus AAV delivery.

    [0422] FIGS. 8A-8B illustrate HDR editing in CD34.sup.+ cells treated with RNPs and a rAAV6 BTK cDNA targeting vector designed to express codon optimized BTK cDNA into the endogenous BTK locus at levels predicted to readily provide clinical benefit in X-linked agammaglobulinemia (XLA).

    [0423] Results

    [0424] FIG. 7 shows a comparison of ratio of HDR (homology directed repair) versus NHEJ (non-homologous end joining) in cells edited with TALEN plus AAV or RNP plus AAV. Adult human mobilized CD34+ cells were cultured in SCGM media supplemented with TPO, SCF, FLT3L and IL6 (100 ng/ml) for 48 hours, followed by electroporation using Neon. The cells were transfected with either 0.5 μg of each TALEN monomer or 2 μg of RNP (Cas9:guide ratio of 1:1.2) followed by AAV transduction at a culture volume of 3%. Genomic DNA was extracted from the cultured cells at day 5 and ddPCR performed to determine HDR rates.

    [0425] To assess editing rates, “in-out” droplet digital PCR was performed with the forward primer binding within the AAV insert and the reverse primer, binding the BTK locus outside the region of homology. A control amplicon of similar size was generated for the CCR5 gene to serve as a control. All reactions were performed in duplicate. The PCR reactions were partitioned into droplets using a QX200 Droplet Generator (Bio-Rad). Amplification was performed using ddPCR Supermix for Probes without UTP (Bio-Rad), 900 nM of primers, 250 nM of Probe and 50 ng of genomic DNA. Droplets were analyzed on the QX200 Droplet Digital PCR System (Bio-Rad) using QuantaSoft software (Bio-Rad). Additionally, the region around the cut site was amplified, gel extracted and subjected to ICE (Inference of CRISPR Edits) analysis to determine the NHEJ rates. The ratio of HDR vs NHEJ was plotted on the graph. Colors represent independent CD34.sup.+ donors. Data are presented as mean±SEM.

    [0426] A higher HDR:NHEJ ratio is favorable as it means that the cells are primed to repair the cut using HDR instead of mutagenic NHEJ. While higher levels of HDR are achieved with the RNP platform, the HDR:NHEJ ratio is relatively higher for TALEN plus AAV compared to RNP plus AAV delivery.

    [0427] FIGS. 8A-8B show HDR editing in CD34.sup.+ cells treated with RNPs and a rAAV6 BTK cDNA targeting vector designed to express codon optimized BTK cDNA in successfully edited HSC. FIG. 8A is a schematic of the rAAV6 donor vector expressing codon optimized BTK cDNA from the endogenous promoter. Adult human mobilized CD34.sup.+ cells were cultured as previously described, followed by electroporation using the Neon instrument. HSC cells were transfected with 5 μg of RNP (Cas9:guide ratio of 1:1.2) followed by AAV transduction at the MOIs of 600 and 1200. Genomic DNA was extracted from the cultured cells at day 5 and a droplet-digital PCR (ddPCR) assay was performed to determine HDR rates.

    [0428] To assess editing rates, “in-out” droplet digital PCR was performed with the forward primer binding within the AAV insert and the reverse primer, binding the BTK locus outside the region of homology. A control amplicon of similar size was generated for the CCR5 gene to serve as a control. All reactions were performed in duplicate. The PCR reactions were partitioned into droplets using a QX200 Droplet Generator (Bio-Rad). Amplification was performed using ddPCR Supermix for Probes without UTP (Bio-Rad), 900 nM of primers, 250 nM of Probe and 50 ng of genomic DNA. Droplets were analyzed on the QX200 Droplet Digital PCR System (Bio-Rad) using QuantaSoft software (Bio-Rad).

    [0429] In FIG. 8B, data from a single CD34.sup.+ donor is shown clearly demonstrating that ability to introduce the BTK cDNA into the endogenous BTK locus at levels predicted to readily provide clinical benefit in XLA.

    [0430] Table 5 provides a list of oligos and probes for determining HDR in CD34+ cells targeted using RNP or TALEN plus AAV.MND.GFP vectors.

    TABLE-US-00009 TABLE 5 BTK RNP/TALEN_HR GAGCAAAGACC SEQ ID forward oligo CCAACGAGA NO: 25 BTK RNP_HR_ AGGTTTTATGT SEQ ID reverse oligo CTCTCGCTCCG NO: 26 BTK_RNP(GFP) GCATGGACGAG SEQ ID HR probe CTGTACAAG NO: 27 TALEN_HR ATGGTCAGACC SEQ ID reverse oligo CAGTGGGTG NO: 28 TALEN_HR Probe TGACAGGTCCT SEQ ID GGTGCCACCT NO: 29 CCR5_control AAAGATTTGCA SEQ ID forward oligo GAGAGATGAGT NO: 30 CCR5_control GCCAAGCAATG SEQ ID reverse oligo AAGTTTTGT NO: 31 CCR5_probe CCTGGGCAACA SEQ ID TAGTGTGATC NO: 32

    [0431] Table 6 provides a list of oligos and probes for determining HDR in CD34+ cells targeted using RNPs and ATG.coBTK expressing AAV vectors. Control CCR5 oligos/probe are the same as for GFP vectors.

    TABLE-US-00010 TABLE 6 BTK (coBTK)_ TCCTGGTTAGT SEQ ID WPRE3 probe TCTTGCCAC NO: 33 BTKco_HR AGAAACTGCCT SEQ ID forward oligo GGTGAACGAC NO: 34 BTKco_HR CCCCATCTCAG SEQ ID reverse oligo ACATTGGTC NO: 35

    [0432] In general, in the following claims, the terms used should not be construed to limit the claims to the specific embodiments disclosed in the specification and the claims, but should be construed to include all possible embodiments along with the full scope of equivalents to which such claims are entitled. Accordingly, the claims are not limited by the disclosure.