ANTIBODIES AGAINST DISEASE CAUSING AGENTS OF CANINES AND FELINES AND USES THEREOF

20220064224 · 2022-03-03

    Inventors

    Cpc classification

    International classification

    Abstract

    Described herein are methods and antibodies useful for reducing, eliminating, or preventing infection with a viral population in an animal. Also described herein are antigens useful for targeting by heavy chain antibodies and VHH fragments for reducing a viral population in an animal.

    Claims

    1. A polypeptide comprising at least one variable region fragment of a heavy chain antibody (V.sub.HH), wherein the at least one V.sub.HH specifically binds a parvovirus, wherein the polypeptide: a) prevents red blood cell hemagglutination by canine parvovirus type 2C capsid at a concentration lower than 100 nM; b) prevents red blood cell hemagglutination by canine parvovirus type 2C capsid at a concentration lower than 1 μM; or c) reduces invasion of MDCK cells by canine parvovirus by >50% at 5 μM.

    2.-4. (canceled)

    5. The polypeptide of claim 1, wherein the polypeptide comprises a plurality of V.sub.HHs.

    6.-8. (canceled)

    9. The polypeptide of claim 1, wherein the variable region fragment of the heavy chain antibody comprises an amino acid sequence at least 80% identical to any one of SEQ ID NOs: 1 to 18 or 77 to 79.

    10. The polypeptide of claim 1, wherein the variable region fragment of the heavy chain antibody comprises a complementarity determining region 1 (CDR1) as set forth in any one of SEQ ID NOs: 19 to 36 or 80 to 82, a complementarity determining region 2 (CDR2) as set forth in any one of SEQ ID NOs: 37 to 54 or 83 to 85, and a complementarity determining region 3 (CDR3) as set forth in any one of SEQ ID NOs: 55 to 72 or 86 to 88.

    11.-18. (canceled)

    19. The polypeptide of claim 1, wherein the V.sub.HH specifically binds a canine parvovirus virulence factor.

    20. The polypeptide of claim 1, wherein the V.sub.HH specifically binds an antigen or polypeptide at least 80%, identical to SEQ IDs NO: 73 or 74 or 75 or 76 or 89.

    21.-31. (canceled)

    32. The polypeptide of claim 1, wherein the parvovirus comprises a swine parvovirus.

    33.-46. (canceled)

    47. A method of producing the polypeptide of claim 1, comprising (a) incubating a cell in a medium suitable for secretion of the polypeptide from the cell; and (b) purifying the polypeptide from the medium.

    48. A method for reducing or preventing a canine-associated viral infection in a canine or another animal species comprising administering the polypeptide of claim 1.

    49. A method for reducing transmission or preventing transmission of a canine-associated virus from a canine species to another canine or another animal species comprising administering the polypeptide of claim 1.

    50. The method of claim 48 or claim 49, wherein the canine species comprises a domestic dog, wolf, coyote, fox, jackal, or dingo; and wherein the another animal species comprises a feline, mink, skunk or raccoon.

    51. (canceled)

    52. A method for reducing or preventing a feline-associated viral infection in a feline or another animal species comprising administering the polypeptide of claim 1.

    53. A method for reducing transmission or preventing transmission of a feline-associated virus from a feline species to another feline or another animal species comprising administering the polypeptide of claim 1.

    54. The method of claim 52 or claim 53, wherein the feline species comprises a domestic cat, wild cat, leopard, tiger, jaguar, lion, serval, caracal, ocelot, margay, kodkod, oncilla, bobcat, lynx, cheetah, cougar, or jaguarundi; and wherein the another animal species comprises a canine, mink, skunk or raccoon.

    55. (canceled)

    56. A method for reducing or preventing a mink-associated viral infection in a mink or another animal species comprising administering the polypeptide of claim 1.

    57. A method for reducing transmission or preventing transmission of a mink-associated virus from a mink species to another mink or another animal species comprising administering the polypeptide of claim 1.

    58. The polypeptide of claim 1, wherein the polypeptide is formulated for introduction to the alimentary canal orally or rectally.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0024] FIG. 1 illustrates the scientific classification of the Parvoviruses with representative genera and species that cause infections.

    [0025] FIGS. 2A-B show a schematic of camelid heavy chain only antibodies and their relationship to V.sub.HH domains and complementarity determining regions (CDRs).

    [0026] FIG. 3 shows phage ELISA binding data for V.sub.HH antibodies of this disclosure.

    DEFINITIONS

    [0027] In describing the present invention, the following terminology is used in accordance with the definitions below.

    [0028] In the following description, certain specific details are set forth in order to provide a thorough understanding of various embodiments. However, one skilled in the art will understand that the embodiments provided may be practiced without these details. Unless the context requires otherwise, throughout the specification and claims which follow, the word “comprise” and variations thereof, such as, “comprises” and “comprising” are to be construed in an open, inclusive sense, that is, as “including, but not limited to.” As used in this specification and the appended claims, the singular forms “a,” “an,” and “the” include plural referents unless the content clearly dictates otherwise. It should also be noted that the term “or” is generally employed in its sense including “and/or” unless the content clearly dictates otherwise. Further, headings provided herein are for convenience only and do not interpret the scope or meaning of the claimed embodiments.

    [0029] Host

    [0030] As referred to herein, “host”, “host organism”, “recipient animal”, “host animal” and variations thereof refer to the intended recipient of the product when the product constitutes a feed or a therapeutic. In certain embodiments, the host is a vertebrate. In certain embodiments, the host is from the order Carnivora. In certain embodiments, the host is from the family Canidae. In certain embodiments, the host is a domestic dog, wolf, coyote, fox, jackal, or dingo. In certain embodiments, the host is a domestic dog. In certain embodiments, the host is from the family Felidae. In certain embodiments, the host is a domestic cat, a wild cat, leopard, tiger, jaguar, lion, serval, caracal, ocelot, margay, kodkod, oncilla, bobcat, lynx, cheetah, cougar, or jaguarundi. In certain embodiments, the host is a domestic cat. In certain embodiments, the vertebrate host is a non-canine and non-feline species. In certain embodiments, the non-canine and non-feline species is a mink, skunk or raccoon. In certain embodiments, the vertebrate host is a human, swine species, poultry species, ovine species, bovine species, horse, or mouse. In certain embodiments, the host is an invertebrate. In certain embodiments, the invertebrate is a shrimp species.

    [0031] Pathogens

    [0032] As referred to herein, “pathogen”, “pathogenic”, and variations thereof refer to virulent microorganisms, that can be associated with host organisms, that give rise to a symptom or set of symptoms in that organism that are not present in uninfected host organisms, including the reduction in ability to survive, thrive, or reproduce. Without limitation, pathogens encompass parasites, bacteria, viruses, prions, protists, fungi and algae. In certain embodiments, the pathogen is a virus belonging to the family Parvoviridae (FIG. 1). In certain embodiments, the pathogen is a virus belonging to the subfamily Parvovirinae. In certain embodiments, the pathogen is a virus belonging to the Protoparvovirus genera. In certain embodiments, the pathogen is canine parvovirus type 2. In certain embodiments, the pathogen is feline panleukopenia virus. In certain embodiments the pathogen is mink enteritis virus. In certain embodiments, the pathogen is ungulate protoparvovirus 1. In certain embodiments, the pathogen is mouse protoparvovirus 1. In certain embodiments, the pathogen is a virus belonging to the Bocaparvovirus genera. In certain embodiments, the pathogen is ungulate bocaparvovirus 1. In certain embodiments, the pathogen is a virus belonging to the Erythroparvovirus genera. In certain embodiments, the pathogen is primate erythroparvovirus 1. In certain embodiments, the pathogen is a virus belonging to the Aveparvovirus genera. In certain embodiments, the pathogen is Gallus gallus enteric parvovirus. In certain embodiments, the pathogen is a virus belonging to the subfamily Densovirinae. In certain embodiments, the pathogen is a virus belonging to the Ambidensovirus genera. In certain embodiments, the pathogen is hepatopancreatic parvovirus of penaeid shrimp.

    [0033] “Virulence”, “virulent” and variations thereof refer to a pathogen's ability to cause symptoms in a host organism. “Virulence factor” refers to nucleic acids, plasmids, genomic islands, genes, peptides, proteins, toxins, lipids, macromolecular machineries or complexes thereof that have a demonstrated or putative role in infection.

    [0034] “Disease-causing agent” refers to a microorganism, pathogen or virulence factor with a demonstrated or putative role in infection.

    [0035] Antibodies

    [0036] A schematic of camelid heavy chain only antibodies and their relationship to V.sub.HH domains and complementarity determining regions (CDRs) is shown in FIG. 2A A camelid heavy chain only antibody consists of two heavy chains linked by a disulphide bridge. Each heavy chain contains two constant immunoglobulin domains (CH2 and CH3) linked through a hinge region to a variable immunoglobulin domain (V.sub.HH). (FIG. 2B) Each V.sub.HH domain contains an amino acid sequence of approximately 110-130 amino acids. The V.sub.HH domain consists of the following regions starting at the N-terminus (N): framework region 1 (FR1), complementarity-determining region 1 (CDR1), framework region 2 (FR2), complementarity-determining region 2 (CDR2), framework region 3 (FR3), complementarity-determining region 3 (CDR3), and framework region 4 (FR4). The domain ends at the C-terminus (C). The complementarity-determining regions are highly variable, determine antigen binding by the antibody, and are held together in a scaffold by the framework regions of the V.sub.HH domain. The framework regions consist of more conserved amino acid sequences; however, some variability exists in these regions.

    [0037] As referred to herein “V.sub.HH” refers to an antibody or antibody fragment comprising a single heavy chain variable region which may be derived from natural or synthetic sources. NBXs referred to herein are an example of a V.sub.HH. In a certain aspect a V.sub.HH may lack a portion of a heavy chain constant region (CH2 or CH3), or an entire heavy chain constant region.

    [0038] As referred to herein “heavy chain antibody” refers to an antibody that comprises two heavy chains and lacks the two light chains normally found in a conventional antibody. The heavy chain antibody may originate from a species of the Camelidae family or Chondrichthyes class. Heavy chain antibodies retain specific binding to an antigen in the absence of any light chain.

    [0039] As referred to herein “specific binding”, “specifically binds” or variations thereof refer to binding that occurs between an antibody and its target molecule that is mediated by at least one complementarity determining region (CDR) of the antibody's variable region. Binding that is between the constant region and another molecule, such as Protein A or G, for example, does not constitute specific binding.

    [0040] As referred to herein “antibody fragment” refers to any portion of a conventional or heavy chain antibody that retains a capacity to specifically bind a target antigen and may include a single chain antibody, a variable region fragment of a heavy chain antibody, a nanobody, a polypeptide or an immunoglobulin new antigen receptor (IgNAR).

    [0041] As referred to herein an “antibody originates from a species” when any of the CDR regions of the antibody were raised in an animal of said species. Antibodies that are raised in a certain species and then optimized by an in vitro method (e.g., phage display) are considered to have originated from that species.

    [0042] As referred to herein “conventional antibody” refers to any full-sized immunoglobulin that comprises two heavy chain molecules and two light chain molecules joined together by a disulfide bond. In certain embodiments, the antibodies, compositions, feeds, products, and methods described herein do not utilize conventional antibodies.

    [0043] Production System

    [0044] As referred to herein, “production system” and variations thereof refer to any system that can be used to produce any physical embodiment of the invention or modified forms of the invention. Without limitation, this includes but is not limited to biological production by any of the following: bacteria, yeast, algae, arthropods, arthropod cells, plants, mammalian cells. Without limitation, biological production can give rise to antibodies that can be intracellular, periplasmic, membrane-associated, secreted, or phage-associated. Without limitation, “production system” and variations thereof also include, without limitation, any synthetic production system. This includes, without limitation, de novo protein synthesis, protein synthesis in the presence of cell extracts, protein synthesis in the presence of purified enzymes, and any other alternative protein synthesis system.

    [0045] Product

    [0046] As referred to herein, “product” refers to any physical embodiment of the invention or modified forms of the invention, wherein the binding of the VHH to any molecule, including itself, defines its use. Without limitation, this includes a feed, a feed additive, a nutritional supplement, a premix, a medicine, a therapeutic, a drug, a diagnostic tool, a component or entirety of an in vitro assay, a component or the entirety of a diagnostic assay (including companion diagnostic assays).

    [0047] Feed Product

    [0048] As referred to herein, “feed product” refers to any physical embodiment of the invention or modified forms of the invention, wherein the binding of the V.sub.HH to any molecule, including itself, defines its intended use as a product that is taken up by a host organism. Without limitation, this includes a feed, a pellet, a feed additive, a nutritional supplement, a premix, a medicine, a therapeutic or a drug.

    DETAILED DESCRIPTION OF THE INVENTION

    [0049] Descriptions of the invention provided are to be interpreted in conjunction with the definitions and caveats provided herein.

    [0050] Domestic dogs and cats are two of the most popular household animals in the world. Despite the availability of veterinary care and canine vaccines, infectious diseases are still a common problem in dogs and cats. This is particularly true for dogs that spend significant time in kennels, shelter, and dog parks; as well as in puppies from breeding facilities. Significant pathogens affecting dogs include viruses, such as canine parvovirus, rabies, canine distemper virus, canine adenovirus, canine coronavirus, and canine parainfluenza virus, bacteria, such as members of the Bordetella, Borrelia, Brucella, Clostridium, and Leptospira genera, as well as numerous of fungi, protozoa, and parasites. Significant pathogens affecting cats include viruses, such as feline panleukopenia virus, feline immunodeficiency virus, feline leukemia virus, feline herpesvirus 1 (FHV-1), feline calcivirus, and rabies, as well as many bacteria, fungi, and parasites.

    [0051] Canine parvovirus infections of dogs occur worldwide (Decaro & Buonavoglia, 2012). These infections are acquired by the fecal-oral route and cause diarrhea, vomiting, dehydration, and fever and are often fatal if untreated (Miranda & Thompson, 2016). Supportive therapy consisting of IV treatments, blood transfusions, and around the clock care (Venn et al, 2017) can be a significant financial and emotional burden to dog owners. Similarly, feline parvovirus infections of cats occur around the world. Virus particles can last in the environment for several months, are acquired by cats via the fecal-oral route, cause such symptoms as diarrhea, vomiting, fever, and immunosuppression, have high mortality rates in untreated cats, and are best treated through supportive therapy (Truyen et al, 2009)

    [0052] To initiate an infection the viral capsid protein interacts with transferrin receptors on the surface of host cell prior to viral invasion (Hafenstein et al, 2007). As such peptides capable of binding the capsid protein at epitopes that are important for host cell binding should be sufficient to neutralize parvovirus infections (Yuan & Parrish, 2000).

    [0053] Earlier efforts in the field of this invention rely on the host organism to generate protection against disease-causing agents. Although live attenuated canine parvovirus vaccines are available, they have some limitations. Early in life, maternally derived antibodies protect puppies from canine parvovirus; however, between weaning and successful vaccination there is a period of a few months where puppies are poorly protected (Hernández-Blanco & Catala-López, 2015). Additionally, the immunization schedule is complex, and non-compliance can lead to poor protection in adult dogs (Mylonakis et al, 2016). Similar problems exist in kittens. Jakel et al (2012) have shown that maternally derived antibodies can interfere with vaccinations and that existing vaccines, administered as recommended by the manufacturers, failed more than a third of kittens. The effectiveness of prior arts is limited by these challenges. These problems are circumvented by introducing exogenous peptides that neutralise the virulence and spread of the disease-causing agent into the host via feed without eliciting the host immune response. Moreover, the methods described herein provide scope for the adaptation and refinement of neutralising peptides, which provides synthetic functionality beyond what the host is naturally able to produce.

    [0054] Antibody heavy chain variable region fragments (V.sub.HHs) are small (12-15 kDa) proteins that comprise specific binding regions to antigens. When introduced into an animal, V.sub.HHs bind and neutralise the effect of disease-causing agents in situ. Owing to their smaller mass, they are less susceptible than conventional antibodies, such as previously documented IgYs, to cleavage by enzymes found in host organisms, more resilient to temperature and pH changes, more soluble, have low systemic absorption and are easier to recombinantly produce on a large scale, making them more suitable for use in animal therapeutics than conventional antibodies.

    [0055] Antibodies for Preventing or Reducing Virulence (Summary)

    [0056] In one aspect, the present invention provides a polypeptide or pluralities thereof comprising a V.sub.HH or V.sub.HHs that bind disease-causing agents to reduce the severity and transmission of disease between and across species. In certain embodiments, the V.sub.HH is supplied to host animals. In certain embodiments, the V.sub.HH is an ingredient of a product.

    [0057] Binding to Reduce Virulence

    [0058] In another aspect, the present invention provides a polypeptide or pluralities thereof comprising a V.sub.HH or V.sub.HHs that bind disease-causing agents, and in doing so, reduce the ability of the disease-causing agent to exert a pathological function or contribute to a disease phenotype. In certain embodiments, binding of the V.sub.HH(s) to the disease-causing agent reduces the rate of replication of the disease-causing agent. In certain embodiments, binding of the V.sub.HH(s) to the disease-causing agent reduces the ability of the disease-causing agent to bind to its cognate receptor. In certain embodiments, binding of the V.sub.HH(s) to the disease-causing agent reduces the ability of the disease-causing agent to interact with another molecule or molecules. In certain embodiments, binding of the V.sub.HH(s) to the disease-causing agent reduces the ability of the disease-causing agent to reach the site of infection. In certain embodiments, binding of the V.sub.HH(s) to the disease-causing agent reduces the ability of the disease-causing agent to cause cell death.

    [0059] Antibodies Derived from Llamas

    [0060] In a further aspect, the present invention provides a method for the inoculation of Camelid or other species with recombinant virulence factors, the retrieval of mRNA encoding V.sub.HH domains from lymphocytes of the inoculated organism, the reverse transcription of mRNA encoding V.sub.HH domains to produce cDNA, the cloning of cDNA into a suitable vector and the recombinant expression of the V.sub.HH from the vector. In certain embodiments, the camelid can be a dromedary, camel, llama, alpaca, vicuna or guacano, without limitation. In certain embodiments, the inoculated species can be, without limitation, any organism that can produce single domain antibodies, including cartilaginous fish, such as a member of the Chondrichthyes class of organisms, which includes for example sharks, rays, skates and sawfish. In certain embodiments, the heavy chain antibody comprises a sequence set forth in Table 1. In certain embodiments, the heavy chain antibody comprises an amino acid sequence with at least 80%, 90%, 95%, 97%, or 99% identity to any sequence disclosed in Table 1. In certain embodiments, the heavy chain antibody possess a CDR1 set forth in Table 2. In certain embodiments, the heavy chain antibody possess a CDR2 set forth in Table 2. In certain embodiments, the heavy chain antibody possess a CDR3 set forth in Table 2.

    TABLE-US-00001 TABLE 1 Unique SEQ ID NOs for V.sub.HH antibodies of this disclosure SEQ ID Exemplary NO: NBX Amino acid sequence Antigen Antigen 1 NBX0411 QVQLQESGGGLVQPGGSLRLSCAVSGLAFGRV Parvovirus Canine AMAWYRQAPGKERELVARISSGGYTNYADSAK Capsid Parvovirus GRFTISRDNVKNLVYLQMNSLKFDDTAVYYCNS Type 2C Capsid GWSGDYWGKGTLVTVSS 2 NBX0412 QVQLQESGGGLVQAGGSLRLSCAVSGRTFSSYA Parvovirus Canine MGWFRQAPGKEREYVAAINRFSGTYYADFVKG Capsid Parvovirus RFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAS Type 2C Capsid RILGLSTAREDYNYWGQGTQVTVSS 3 NBX0413 QVQLQESGGGLVQAGGSLRLSCAASGHTFSSN Parvovirus Canine TMAWFRQAPGKERELVAVIGWIGGSTYYADSV Capsid Parvovirus KGRFTISRDNTKNTVYLQMSSLKPEDTAVYYCA Type 2C Capsid ADASRRRFSLQYVDYTYWGQGTQVTVSS 4 NBX0414 QVQLQESGGGLVQAGGSLRLSCRASGRTFSSSS Parvovirus Canine MGWFRQAPGKERDFVAAISWDGASTRYADSV Capsid Parvovirus KGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCA Type 2C Capsid ASTMDFIVLLTKWYPYWGQGTQVTVSS 5 NBX0415 QVQLQESGGGLVQAGGSLRLSCAASGRTFSSYA Parvovirus Canine MGWFRQAPGKEREYVAAINRFGGTYYADFVKG Capsid Parvovirus RFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAS Type 2C Capsid RILGLTTAREDYNYWGQGTQVTVSS 6 NBX0416 QVQLQESGGGLVQAGGSLRLSCAASGRTFSSSS Parvovirus Canine MGWFRQAPGKERDFVAAINWSGDSTRYADSV Capsid Parvovirus KGRFTISRDNAKSTVYLQMNSLKPEDTAVYYCA Type 2C Capsid ASTMDFIVLLTKWYPYWGQGTQVTVSS 7 NBX0417 QVQLQESGGGLVQPGGSLRLSCAASGSIFSINV Parvovirus Canine MAWYRQAPGKEREYVASITRGGGDYYANSVK Capsid Parvovirus GRFTISRDNAKNAVYLQMNSLKPEDTAVYECNA Type 2C Capsid QISQTISGDYRNYWGQGTQVTVSS 8 NBX0418 QVQLQESGGGLVQAGGSLRLSCAASGRTFSSYA Parvovirus Canine MGWFRQAPGKEREYVAAINRFGGTYYADFVKG Capsid Parvovirus RFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAS Type 2C Capsid TILGLTTVREDYNYWGQGTQVTVSS 9 NBX0420 QVQLQESGGGLVQAGGSLRLSCAASGRTFSSYG Parvovirus Canine MGWFRQAPGKEREYVAVINRFGGTYYADFVKG Capsid Parvovirus RFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAS Type 2C Capsid RILGLSTAREDYNYWGQGTQVTVSS 10 NBX0421 QVQLQQSGGGLVQPGGSLRLSCAVSGLAFGRY Parvovirus Canine AMAWYRQAPGKERELVARISNGGYTNYADSAK Capsid Parvovirus GRFTISRDNVKNTVYLEMNSLKFDDTAVYYCNS Type 2C Capsid GWSGNYWGKGTLVTVSS 11 NBX0422 QVQLQESGGGLVQAGGSLRLSCAASGFTSSIYV Parvovirus Canine MGWYRQAPGKPRDLVASINGGTTNYANSVKG Capsid Parvovirus RFTISRDNAKNTVSLQMNTLKPEDTAVYYCNAR Type 2C Capsid HSSSWRDYWGQGTQVTVSS 12 NBX0423 QVQLQESGGGLVQAGGSLRLSCAIPGRTFRNYV Parvovirus Canine MGWFRQAPGKEREFVAAISRSGGSTYYSDSVK Capsid Parvovirus GRFTISRDNAKNTVYLQMNMLKPEDTAVYYCA Type 2C Capsid ASYSIMQPTTASAMDYWGKGTLVTVSS 13 NBX0424 QVQLQQSGGGSVQAGGSLSVSCAPSGRTFSW Parvovirus Canine NAIGWFRQAPGKEREFVAAIRLSTGWTSYADSV Capsid Parvovirus KGRFSISRDAAKTTAYLQMNSLKPEDTAVYYCA Type 2C Capsid ADREGSIATMTRDYEYDYWGQGTQVTVSS 14 NBX0425 QVQLQESGGGLVQAGGSLRLSCAASGRTFSSYA Parvovirus Canine MGWFRQAPGKEREYVAGINRFGGTYYADFVQ Capsid Parvovirus GRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAA Type 2C Capsid SRILGLTTVREDYNYWGQGTQVTVSS 15 NBX0426 QVQLQESGGGLVQPGGSLRLSCAASGIGDRPYV Parvovirus Canine MAWHRQAPGKQRELVATITRDGYTNYADTVK Capsid Parvovirus GRFVVSRDNAQNTVYLQMNYLKPADTAVYYCR Type 2C Capsid AYNAYLNLGYWGQGTQVTVST 16 NBX0427 QVQLQESGGGLVQAGGSLRLSCAASGITFSTFA Parvovirus Canine MGWYRQAPGKQRELVAQISNDGYINYADSVK Capsid Parvovirus GRFTISRDNAKNTVSLQMNSLKPDDTAVYSCRA Type 2C Capsid GTFYWGQGTQVTVSS 17 NBX0428 QVQLQESGGGLVQAGGSLRLSCAASGSTSSINH Parvovirus Canine IAWYRQAPGKCIREWVATITSGGGSTYYTNSVK Capsid Parvovirus GRFTISRDNAKNTVYLQMNNLKPEDTAVYYCKA Type 2C Capsid NQAAGNKDYWGQGTQVTVSS 18 NBX0429 QVQLQQSGGGLVQAGGSLRLSCAASGRTFSSY Parvovirus Canine AMGWFRQAPGKEREYVAAINRFGGTYYADFVK Capsid Parvovirus GRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAA Type 2C Capsid SGILGLSTAREDYNYWGQGTQVTVSS 77 NBX0430 QVQLQQSGGGLVQAGGSLRLSCAASGLTFGSP Parvovirus Canine AMAWYRQAPGKEREWVATISRGGSTYYADSV Capsid Parvovirus KGRFTISRDNAKNTSYLQMNSLKPEETAVYYCA Type 2C Capsid AGLSSMRYDYWGQGTQVTVSS 78 NBX0431 QVQLQQSGGGLVQAGGSLRLSCAASGRTFSSY Parvovirus Canine AMGWFRQAPGKEREYVAGINRFGGTYYADFVK Capsid Parvovirus GRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAA Type 2C Capsid SRILGLSTAREDYNYWGQGTQVTVSS 79 NBX0432 QVQLQESGGGLVQTGASLRLSCAVSGRRITDYII Parvovirus Canine GWFRQAPGKEREFVGQISRSANSIIANSVKGRF Capsid Parvovirus TISRDNANNTVSLQMNSLKPDDTAVYLCGASSSI Type 2C Capsid GVWTTSQYYDYWGQGTRVTVSS

    TABLE-US-00002 TABLE 2 Unique SEQ ID NOs for V.sub.HH CDRs of this disclosure CDR1 CDR1 CDR2 CDR2 CDR3 Amino SEQ Amino SEQ CDR3 SEQ Acid ID Acid ID Amino Acid ID Exemplary NBX Sequence NO: Sequence NO: Sequence NO: Antigen Antigen NBX0411 GLAFGRVA 19 ISSGGYT 37 NSGWSGD 55 Parvovirus Canine M Y Capsid Parvovirus Type 2C Capsid NBX0412 GRTFSSYAM 20 INRFSGT 38 AASRILGLS 56 Parvovirus Canine TAREDYNY Capsid Parvovirus Type 2C Capsid NBX0413 GHTFSSNT 21 IGWIGGS 39 AADASRR 57 Parvovirus Canine M T RFSLQYVD Capsid Parvovirus YTY Type 2C Capsid NBX0414 GRTFSSSSM 22 ISWDGA 40 AADASRR 58 Parvovirus Canine ST RFSLQYVD Capsid Parvovirus YTY Type 2C Capsid NBX0415 GRTFSSYAM 23 IN RFGGT 41 AASRILGLT 59 Parvovirus Canine TARED Capsid Parvovirus YNY Type 2C Capsid NBX0416 GRTFSSSSM 24 INWSGD 42 AASTMDFI 60 Parvovirus Canine ST VLLTKWYP Capsid Parvovirus Y Type 2C Capsid NBX0417 GSIFSINVM 25 ITRGGGD 43 NAQISQTI 61 Parvovirus Canine SGDYRNY Capsid Parvovirus Type 2C Capsid NBX0418 GRTFSSYAM 26 INRFGGT 44 AASTILGLT 62 Parvovirus Canine TVREDYNY Capsid Parvovirus Type 2C Capsid NBX0420 GRTFSSYG 27 INRFGGT 45 AASRILGLS 63 Parvovirus Canine M TAREDYNY Capsid Parvovirus Type 2C Capsid NBX0421 GLAFGRYA 28 ISNGGYT 46 NSGWSGN 64 Parvovirus Canine M Y Capsid Parvovirus Type 2C Capsid NBX0422 GFTSSIYVM 29 INGGTT 47 NARHSSS 65 Parvovirus Canine WRDY Capsid Parvovirus Type 2C Capsid NBX0423 GRTFRNYV 30 ISRSGGS 48 AASYSIMQ 66 Parvovirus Canine M T PTTASAM Capsid Parvovirus DY Type 2C Capsid NBX0424 GRTFSWNAI 31 IRLSTGW 49 AADREGSI 67 Parvovirus Canine T ATMTRDY Capsid Parvovirus EYDY Type 2C Capsid NBX0425 GRTFSSYAM 32 INRFGGT 50 AASRILGLT 68 Parvovirus Canine TVREDYNY Capsid Parvovirus Type 2C Capsid NBX0426 GIGDRPYV 33 ITRDGYT 51 RAYNAYLN 69 Parvovirus Canine M LGY Capsid Parvovirus Type 2C Capsid NBX0427 GITFSTFAM 34 ISNDGYI 52 RAGTFY 70 Parvovirus Canine Capsid Parvovirus Type 2C Capsid NBX0428 GSTSSINHI 35 ITSGGGS 53 KANQAAG 71 Parvovirus Canine T NKDY Capsid Parvovirus Type 2C Capsid NBX0429 GRTFSSYAM 36 INRFGGT 54 AASGILGL 72 Parvovirus Canine STAREDYN Capsid Parvovirus Y Type 2C Capsid NBX0430 GLTFGSPA 80 ISRGGST 83 AAGLSSM 86 Parvovirus Canine M RYDY Capsid Parvovirus Type 2C Capsid NBX0431 GRTFSSYAM 81 INRFGGT 84 AASRILGLS 87 Parvovirus Canine TAREDYNY Capsid Parvovirus Type 2C Capsid NBX0432 GRRITDYII 82 ISRSANS 85 GASSSIGV 88 Parvovirus Canine WTTSQYY Capsid Parvovirus DY Type 2C Capsid

    [0061] Antibodies Recombinantly Expressed

    [0062] In another aspect, the present invention provides a method for producing V.sub.HH in a suitable producing organism. Suitable producing organisms include, without limitation, bacteria, yeast and algae. In certain embodiments, the producing bacterium is Escherichia coli. In certain embodiments, the producing bacterium is a member of the Bacillus genus. In certain embodiments, the producing bacterium is a probiotic. In certain embodiments, the yeast is Pichia pastoris. In certain embodiments, the yeast is Saccharomyces cerevisiae. In certain embodiments, the alga is a member of the Chlamydomonas or Phaeodactylum genera.

    [0063] Antibodies Added to Feed

    [0064] In yet another aspect, the present invention provides a polypeptide or pluralities thereof comprising a V.sub.HH or V.sub.HHs that bind disease-causing agents and are administered to host animals via any suitable route as part of a feed product. In certain embodiments, the animal is selected from the list of host animals described, with that list being representative but not limiting. In certain embodiments, the route of administration to a recipient animal can be, but is not limited to: introduction to the alimentary canal orally or rectally, provided to the exterior surface (for example, as a spray or submersion), provided to the medium in which the animal dwells (including air based media), provided by injection, provided intravenously, provided via the respiratory system, provided via diffusion, provided via absorption by the endothelium or epithelium, or provided via a secondary organism such as a yeast, bacterium, algae, bacteriophages, plants and insects. In certain embodiments, the host is from the order Carnivora. In certain embodiments, the host is from the order Canidae. In certain embodiments, the host is a domestic dog, wolf, coyote, fox, jackal, or dingo. In certain embodiments, the host is a domestic dog. In certain embodiments, the host is from the family Felidae. In certain embodiments, the host is a domestic cat, a wild cat, leopard, tiger, jaguar, lion, serval, caracal, ocelot, margay, kodkod, oncilla, bobcat, lynx, cheetah, cougar, or jaguarundi. In certain embodiments, the host is a domestic cat. In certain embodiments the host is a non-canine and non-feline species. In certain embodiments the non-canine and non-feline species is a mink, skunk or raccoon.

    [0065] Feed Product

    [0066] In a further aspect, the present invention provides a polypeptide or pluralities thereof comprising a V.sub.HH or V.sub.HH that bind disease-causing agents and are administered to host animals in the form of a product. The form of the product is not limited. In certain embodiments, the product is feed, pellet, nutritional supplement, premix, therapeutic, medicine, or feed additive, but is not limited to these forms.

    [0067] Feeding Dosage

    [0068] In a further aspect, the present invention provides a polypeptide or pluralities thereof comprising a V.sub.HH or V.sub.HHs that bind disease-causing agents and are administered to host animals as part of a product at any suitable dosage regime. In practice, the suitable dosage is the dosage at which the product offers any degree of protection against a disease-causing agent, and depends on the delivery method, delivery schedule, the environment of the recipient animal, the size of the recipient animal, the age of the recipient animal and the health condition of the recipient animal among other factors. In certain embodiments, V.sub.HHs are administered to recipient animals at a concentration in excess of 1 mg/kg of body weight. In certain embodiments, V.sub.HHs are administered to recipient animals at a concentration in excess of 5 mg/kg of body weight. In certain embodiments, V.sub.HHs are administered to recipient animals at a concentration in excess of 10 mg/kg of body weight. In certain embodiments, V.sub.HHs are administered to recipient animals at a concentration in excess of 50 mg/kg of body weight. In certain embodiments, V.sub.HHs are administered to recipient animals at a concentration in excess of 100 mg/kg of body weight. In certain embodiments, V.sub.HHs are administered to recipient animals at a concentration less than 1 mg/kg of body weight. In certain embodiments, V.sub.HHs are administered to recipient animals at a concentration less than 500 mg/kg of body weight. In certain embodiments, V.sub.HHs are administered to recipient animals at a concentration less than 100 mg/kg of body weight. In certain embodiments, V.sub.HHs are administered to recipient animal at a concentration less than 50 mg/kg of body weight. In certain embodiments, V.sub.HHs are administered to recipient animals at a concentration less than 10 mg/kg of body weight.

    [0069] Feeding Frequency

    [0070] In a further aspect, the present invention provides a polypeptide or pluralities thereof comprising a V.sub.HH or V.sub.HHs that bind disease-causing agents and are administered to host animals as part of a product at any suitable dosage frequency. In practice, the suitable dosage frequency is that at which the product offers any protection against a disease-causing agent, and depends on the delivery method, delivery schedule, the environment of the recipient animal, the size of the recipient animal, the age of the recipient animal and the health condition of the recipient animal, among other factors. In certain embodiments, the dosage frequency can be but is not limited to: constantly, at consistent specified frequencies under an hour, hourly, at specified frequencies throughout a 24-hour cycle, daily, at specified frequencies throughout a week, weekly, at specified frequencies throughout a month, monthly, at specified frequencies throughout a year, annually, and at any other specified frequency greater than 1 year.

    [0071] Feed Additives

    [0072] In a further aspect, the present invention provides a polypeptide or pluralities thereof comprising a V.sub.HH or V.sub.HHs that bind disease-causing agents and are administered to host animals as part of a product that also comprises other additives or coatings. In practice, the most suitable coating or additive depends on the method of delivery, the recipient animal, the environment of the recipient, the dietary requirements of the recipient animal, the frequency of delivery, the age of the recipient animal, the size of the recipient animal, the health condition of the recipient animal In certain embodiments, these additives and coatings can include but are not limited to the following list and mixtures thereof: meat, a meat by-product, bone meal, fish, fish meal, egg, egg by-product, a vitamin, vegetables, plant matter, plant extracts, an amino acid, a dye, an antibiotic, an antiviral, a hormone, an antimicrobial peptide, a steroid, a prebiotic, a probiotic, a bacteriophage, chitin, chitosan, B-1,3-glucan, vegetable extracts, peptone, krill, algae, B-cyclodextran, alginate, gum, tragacanth, pectin, gelatin, an additive spray, a toxin binder, a short chain fatty acid, a medium chain fatty acid, an omega-3 fatty acid, yeast, a yeast extract, a plant extract, sugar, a digestive enzyme, a digestive compound, an essential mineral, carnitine, glucosamine, an essential salt, fibre, a preservative, a stabilizer, a natural flavour, an artificial flavour, or water.

    [0073] Non-Feed Uses

    [0074] In a further aspect, the present invention provides a polypeptide or pluralities thereof comprising a V.sub.HH or V.sub.HHs that bind disease-causing agents, and can be used in a non-feed use, such as but not limited to: a diagnostic kit, an enzyme-linked immunoabsorbent assay (ELISA), a western blot assay, an immunofluorescence assay, or a fluorescence resonance energy transfer (FRET) assay, in its current form and/or as a polypeptide conjugated to another molecule. In certain embodiments, the conjugated molecule is can be but is not limited to: a fluorophore, a chemiluminescent substrate, an antimicrobial peptide, a nucleic acid or a lipid.

    [0075] Antigens

    [0076] In a further aspect, the present invention provides a polypeptide or pluralities thereof comprising a V.sub.HH or V.sub.HHs that bind disease-causing agents, produced by a virus of the family Parvoviridae. In certain embodiments, the Parvoviridae virus refers to both current and reclassified viruses. In certain embodiments, the Parvoviridae virus is canine parvovirus type 2. In certain embodiments, the Parvoviridae virus is feline panleukopenia virus.

    [0077] In certain embodiments, the V.sub.HH or plurality thereof is capable of binding to one or more disease-causing agents, originating from the same or different viruses. In certain embodiments, the disease-causing agent is a polypeptide with 80% or greater amino acid sequence identity to canine parvovirus type 2C capsid protein (SEQ ID NO: 73). In certain embodiments, the disease-causing agent is a polypeptide with 80% or greater amino acid sequence identity to canine parvovirus type 2A capsid protein (SEQ ID NO: 75). In certain embodiments, the disease-causing agent is a polypeptide with 80% or greater amino acid sequence identity to canine parvovirus type 2B capsid protein (SEQ ID NO: 76). In certain embodiments, the disease-causing agent is the canine parvovirus type 2 virus. In certain embodiments, the disease-causing agent is a polypeptide with 80% or greater amino acid sequence identity to feline panleukopenia virus capsid protein (SEQ ID NO: 74). In certain embodiments, the disease-causing agent is the feline panleukopenia virus. In certain embodiments, the disease-causing agent is a polypeptide with 80% or greater amino acid sequence identity to mink enteritis virus capsid protein (SEQ ID NO: 89). In certain embodiments, the disease-causing agent is the mink enteritis virus. In certain embodiments, the disease-causing agent is a polypeptide with 80% or greater amino acid sequence identity to ungulate protoparvovirus 1 capsid protein (SEQ ID NO: 90). In certain embodiments, the disease-causing agent is the ungulate protoparvovirus 1. In certain embodiments, the disease-causing agent is a polypeptide with 80% or greater amino acid sequence identity to mouse protoparvovirus 1 capsid protein (SEQ ID NO: 91). In certain embodiments, the disease-causing agent is the mouse protoparvovirus 1.

    TABLE-US-00003 Antigen Sequences Canine Parvovirus Type 2C Capsid Protein >AIW67511.1 VP1 [Canine parvovirus 2c] (SEQ ID NO: 73) MAPPAKRARRGLVPPGYKYLGPGNSLDQGEPTNPSDAAAKEHDEAYAAYLRSGKNPY LYFSPADQRFIDQTKDAKDWGGKIGHYFFRAKKAIAPVLTDTPDHPSTSRPTKPTKRSKP PPHIFINLAKKKKAGAGQVKRDNLAPMSDGAVQPDGGQPAVRNERATGSGNGSGGGG GGGSGGVGISTGTFNNQTEFKFLENGWVEITANSSRLVHLNMPESENYRRVVVNNLDK TAVNGNMALDDTHAQIVTPWSLVDANAWGVWFNPGDWQLIVNTMSELHLVSFEQEIF NVVLKTVSESATQPPTKVYNNDLTASLMVALDSNNTMPFTPAAMRSETLGFYPWKPTI PTPWRYYFQWDRTLIPSHTGTSGTPTNIYHGTDPDDVQFYTIENSVPVHLLRTGDEFATG TFFFDCKPCRLTHTWQTNRALGLPPFLNSLPQAEGGTNFGYIGVQQDKRRGVTQMGNT NYITEATIMRPAEVGYSAPYYSFEASTQGPFKTPIAAGRGGAQTDENQAADGDPRYAFG RQHGQKTTTTGETPERFTYIAHQDTGRYPEGDWIQNINFNLPVTEDNVLLPTDPIGGKTG INYTNIFNTYGPLTALNNVPPVYPNGQIWDKEFDTDLKPRLHVNAPFVCQNNCPGQLFV KVAPNLTNEYDPDASANMSRIVTYSDFWWKGKLVFKAKLRASHTWNPIQQMSINVDN QFNYVPSNIGGMKIVYEKSQLAPRKLY Feline Panleukopenia Virus Capsid Protein >AAC37928.1 capsid protein VP1 [Feline panleukopenia virus] (SEQ ID NO: 74) MAPPAKRARRGLVPPGYKYLGPGNSLDQGEPTNPSDAAAKEHDEAYAAYLRSG KNPYLYFSPADQRFIDQTKDAKDWGGKIGHYFFRAKKAIAPVLTDTPDHPSTSRPTKPT KRSKPPPHIFINLAKKKKAGAGQVKRDNLAPMSDGAVQPDGGQPAVRNERATGSGNGS GGGGGGGSGGVGISTGTFNNQTEFKFLENGWVEITANSSRLVHLNMPESENYKRVVVN NMDKTAVKGNMALDDIHVQIVTPWSLVDANAWGVWFNPGDWQLIVNTMSELHLVSF EQEIFNVVLKTVSESATQPPTKVYNNDLTASLMVALDSNNTMPFTPAAMRSETLGFYP WKPTIPTPWRYYFQWDRTLIPSHTGTSGTPTNVYHGTDPDDVQFYTIENSVPVHLLRTG DEFATGTFFFDCKPCRLTHTWQTNRALGLPPFLNSLPQSEGATNFGDIGVQQDKRRGVT QMGNTDYITEATIMRPAEVGYSAPYYSFEASTQGPFKTPIAAGRGGAQTDENQAADGD PRYAFGRQHGQKTTTTGETPERFTYIAHQDTGRYPEGDWIQNINFNLPVTNDNVLLPTD PIGGKTGINYTNIFNTYGPLTALNNVPPVYPNGQIWDKEFDTDLKPRLHVNAPFVCQNN CPGQLFVKVAPNLTNEYDPDASANMSRIVTYSDFWWKGKLVFKAKLRASHTWNPIQQ MSINVDNQFNYVPNNIGAMKIVYEKSQLAPRKLY Canine Parvovirus Type 2A Capsid Protein >ALC79696.1 VP1 [Canine parvovirus 2a] (SEQ ID NO: 75) MAPPAKRARRGLVPPGYKYLGPGNSLDQGEPTNPSDAAAKEHDEAYAAYLRSG KNPYLYFSPADQRFIDQTKDAKDWGGKIGHYFFRAKKAIAPVLTDTPDHPSTSRPTKPT KRSRPPPHIFINLAKKKKAGAGQVKRDNLAPMSDGAVQPDGGQPAVRNERATGSGNGS GGGGGGGSGGVGISTGTFNNQTEFKFLENGWVEITANSSRLVHLNMPESENYRRVVVN NLDKTAVNGNMALDDTHAQIVTPWSLVDANAWGVWFNPGDWQLIVNTMSELHLVSF EQEIFNVVLKTVSESATQPPTKVYNNDLTASLMVALDSNNTMPFTPAAMRSETLGFYP WKPTIPTPWRYYFQWDRTLIPSHTGTSGTPTNIYHGTDPDDVQFYTIENSVPVHLLRTGD EFATGTFYFDCKPCRLTHTWQTNRALGLPPFLNSLPQAEGGTNFGYIGVQQDKRRGVT QMGNTNIITEATIMRPAEVGYSAPYYSFEASTQGPFKTPIAAGRGGAQTDENQAADGDP RYAFGRQHGQKTTTTGETPERFTYIAHQDTGRYPEGDWIQNINFNLPVTNDNVLLPTDPI GGKAGINYTNIFNTYGPLTALNNVPPVYPNGQIWDKEFDTDLKPRLHVNAPFVCQNNC PGQLFVKVAPNLTNEYDPDASANMSRIVTYSDFWWKGKLVFKAKLRASHTWNPIQQM SINVDNQFNYVPSNIGGMKIVYEKSQLAPRKLY Canine Parvovirus Type 2B Capsid Protein >ALC79660.1 VP1 [Canine parvovirus 2b] (SEQ ID NO: 76) MAPPAKRARRGLVPPGYKYLGPGNSLDQGEPTNPSDAAAKEHDEAYAAYLRSG KNPYLYFSPADQRFIDQTKDAKDWGGKIGHYFFRAKKAIAPVLTDTPDHPSTSRPTKPT KRSRPPPHIFINLAKKKKAGAGQVKRDNLAPMSDGAVQPDGGQPAVRNERATGSGNGS GGGGGGGSGGVGISTGTFNNQTEFKFLENGWVEITANSSRLVHLNMPESENYRRVVVN NLDKTAVNGNMALDDTHAQIVTPWSLVDANAWGVWFNPGDWQLIVNTMSELHLVSF EQEIFNVVLKTVSESATQPPTKVYNNDLTASLMVALDSNNTMPFTPAAMRSETLGFYP WKPTIPTPWRYYFQWDRTLIPSHTGTSGTPTNIYHGTDPDDVQFYTIENSVPVHLLRTGD EFATGTFYFDCKPCRLTHTWQTNRALGLPPFLNSLPQAEGGTNFGYIGVQQDKRRGVT QMGNTNIITEATIMRPAEVGYSAPYYSFEASTQGPFKTPIAAGRGGAQTDENQAADGDP RYAFGRQHGQKTTTTGETPERFTYIAHQDTGRYPEGDWIQNINFNLPVTDDNVLLPTDPI GGKAGINYTNIFNTYGPLTALNNVPPVYPNGQIWDKEFDTDLKPRLHVNAPFVCQNNC PGQLFVKVAPNLTNEYDPDASANMSRIVTYSDFWWKGKLVFKAKLRASHTWNPIQQM SINVDNQFNYVP SNIGGMKIVYEK SQLAPRKLY Mink enteritis virus >AAA87193.1 VP1 [Mink enteritis virus] (SEQ ID NO: 89) MAPPAKRARRGLVPPGYKYLGPGNSLDQGEPTNPSDAAAKEHDEAYAAYLRSG KNPYLYFSPADQRFIDQTKDAKDWGGKIGHYFFRDKKAIAPVLSDTPDHPSTSRPAKPS KRCKPPPHIFINLAKKKNAGAAQVKRDNLAPMSDGAVQPDGGQPAVRNERATGSGNG SGGGGGGGSGGVGISTGTFNNQTEFKFLENGWVEITANSSRLVHLNMPESENYKRVVV NNMDKTAVKGNMALDDTHVQIVTPWSLVDANAWGVWFNPGDWQLIVNTMSELHLV SFEQEIFNVVLKTVSESATQPPTKVYNNDLTASLMVALDSNNTMPFTPAAMRSETLGFY PWKPTIPTPWRYYFQWDRTLIPSHTGTSGTPTNIYHGTDPDDVQFYTIENSVPVHLLRTG DEFATGTFFFDCKPCRLTHTWQTNRALGLPPFLNSLPQSEGATNFGDIGVQQDKRRGVT QMGNTDYITEATIMRPAEVGYSAPYYSFEASTQGPFKTPIAAGRGGAQTDENQAADGD PRYAFGRQHGQKTTTTGETPERFTYIAHQDTGRYPEGDWIQNINFNLPVTNDNVLLPTD PIGGKTGINYTNIFNTYGPLTALNNVPPVYPNGQIWDKEFDTDLKPRLHVNAPFVCHNN CPGQLFVKVAPNLTNEYDPDASANMSRIVTYSDFWWKGKLVFKAKLRASHTWNPIQQ MSINVDNQFNYLPNNIGAMKIVYEKSQLAPRKLY

    Examples

    [0078] The following illustrative examples are representative of the embodiments of the applications, systems and methods described herein and are not meant to be limiting in any way.

    [0079] While preferred embodiments of the present invention are shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein may be employed in practicing the invention.

    [0080] Production of Antigens

    [0081] Recombinant parvovirus capsid can be purified from an insect expression system. For example, capsid protein can be expressed at 26° C. in Spodoptera frugiperda 9 (Sf9) cells cultured in suspension in shaker flasks. Cells are pelleted, frozen, thawed, and then lysed by osmotic shock in a 25 mM sodium bicarbonate solution. The lysate is cleared by centrifugation at 10,000×g for 30 minutes at 4° C. Virus-like particles are precipitated from the supernatant using 20% ammonium sulfate and removed by centrifugation. The pelleted virus-like particles are resuspended in phosphate-buffered saline, pH 7.4 (PBS). Confirmation of virus-like particle production is obtained via electron microscopy and hemagglutination of porcine erythrocytes. The purified virus-like particles are stored at −80° C.

    [0082] Production of NBXs and Panning

    [0083] Llama Immunization

    [0084] A llama is immunized with purified disease-causing agents, these can include recombinantly expressed parvovirus capsid or parvovirus viral particles, which may be accompanied by adjuvants. The llama immunization is performed using 100 μg of antigen at days 0, 21, 42, and 63. At the time of injection, the antigen is thawed, and the volume increased to 1 ml with PBS. The 1 ml antigen-PBS mixture is then mixed with 1 ml of Complete Freund's adjuvant (CFA) or Incomplete Freund's adjuvant (IFA) for a total of 2 ml. A total of 2 ml is immunized per injection. Whole llama blood and sera are then collected from the immunized animal on days 0, 28, 49, 70. Sera from days 28, 49 and 70 are then fractionated to separate V.sub.HH from conventional antibodies. ELISA can be used to measure reactivity against target antigens in polyclonal and V.sub.HH-enriched fractions. Lymphocytes are collected from sera taken at days 28, 49, and 70.

    [0085] Panning

    [0086] RNA isolated from purified llama lymphocytes is used to generate cDNA for cloning into phagemids. The resulting phagemids are used to transform E. coli TG-1 cells to generate a library of expressed V.sub.HH genes. The phagemid library size can be ˜2.5×10.sup.7 total transformants and the estimated number of phagemid containing V.sub.HH inserts can be estimated to be >90%. High affinity antibodies are then selected by panning against the antigens used for llama immunization. Two rounds of panning are performed and antigen-binding clones arising from round 2 are identified using phage ELISA. Antigen-binding clones are sequenced, grouped according to their CDR regions, and prioritized for soluble expression in E. coli and antibody purification.

    [0087] FIG. 3 shows the phage ELISA results for antibodies of this disclosure. Black bars show binding to wells coated with the antigen specified in Tables 1 and 2 dissolved in phosphate-buffered saline (PBS). Grey bars are negative controls that show binding to wells coated with PBS only. In all cases binding to the antigen target is at least 50% above binding to the PBS-coated wells.

    [0088] Purification of V.sub.HHs from E. coli

    [0089] TEV protease-cleavable, 6×His-thioredoxin-NBX fusion proteins are expressed in the cytoplasm of E. coli grown in autoinducing media (Formedium) for 24 hours at 30° C. Bacteria are collected by centrifugation, resuspended in buffer A (10 mM HEPES, pH 7.5, 250 mM NaCl, 20 mM Imidazole) and lysed using sonication. Insoluble material is removed by centrifugation and the remaining soluble fraction is applied to a HisTrap column (GE Biosciences) pre-equilibrated with buffer A. The protein is eluted from the column using an FPLC with a linear gradient between buffer A and buffer B (10 mM HEPES, pH 7.5, 500 mM NaCl, 500 mM Imidazole). The eluted protein is dialyzed overnight in the presence of TEV protease to buffer C (10 mM HEPES, pH 7.5, 500 mM NaCl). The dialyzed protein is applied to a HisTrap column (GE Biosciences) pre-equilibrated with buffer C. 6×His-tagged TEV and 6×His-tagged thioredoxin are bound to the column and highly purified NBX is collected in the flow through. NBX proteins are dialyzed overnight to PBS and concentrated to −10 mg/ml.

    [0090] Purification of V.sub.HHs from P. pastoris

    [0091] Pichia pastoris strain GS115 with constructs for the expression and secretion of 6×His-tagged V.sub.HH are grown for 5 days at 30° C. with daily induction of 0.5% (vol/vol) methanol. Yeast cells are removed by centrifugation and the NBX-containing supernatant is spiked with 10 mM imidazole. The supernatant is applied to a HisTrap column (GE Biosciences) pre-equilibrated with buffer A (10 mM HEPES, pH 7.5, 500 mM NaCl). The protein is eluted from the column using an FPLC with a linear gradient between buffer A and buffer B (10 mM HEPES, pH 7.5, 500 mM NaCl, 500 mM Imidazole). NBX proteins are dialyzed overnight to PBS and concentrated to −10 mg/ml.

    [0092] NBX Inhibition of Red Blood Cell Hemagglutination by Parvovirus Capsid

    [0093] Recombinantly expressed canine parvovirus capsid protein is diluted to approximately 1 nM in PBS and 80 μl, of capsid solution or PBS buffer is added to triplicate wells of a 96-well microtitre plate. 10 μl, of various NBX solutions are added to the capsid solution, yielding final NBX concentrations of 0, 1, 3, 9, 27, 81, 243, 729, or 2187 nM. Capsid/NBX mixtures are incubated at 4° C. for 30 minutes. 10 μl, of a 10% solution of porcine red blood cells (RBC) are added to the wells and mixed. Capsid/NBX/RBC mixtures are incubated at 4° C. for 60 minutes and the plate is photographed. In the absence of capsid protein, the RBCs sink to the bottom of the well. In the presence of capsid protein, the RBCs are agglutinated and remain suspended in the solution of the well. In the presence of neutralizing NBXs, the capsid fails to agglutinate the RBCs and the RBCs sink to the bottom of the well. The minimum hemagglutination inhibition concentration (MHIC) is the lowest concentration of NBX that completely inhibits capsid hemagglutination or RBCs in all three triplicate wells tested.

    [0094] Table 3 indicates, for all NBXs tested, whether the NBX can neutralize the hemagglutination ability of parvovirus capsid with MHIC values lower than 1 μM or 100 nM

    TABLE-US-00004 TABLE 3 Summary table for NBXs that neutralize hemagglutination of porcine RBCs by canine parvovirus capsid NBX NBX Number MHIC <1 μM MHIC <100 nM Number MHIC <1 μM MHIC <100 nM NBX0411 Yes Yes NBX0422 No No NBX0412 No No NBX0423 No No NBX0413 No No NBX0424 Yes Yes NBX0414 Yes Yes NBX0425 No No NBX0415 No No NBX0426 No No NBX0416 Yes Yes NBX0427 No No NBX0417 Yes No NBX0428 Yes Yes NBX0418 Yes Yes NBX0429 No No NBX0420 No No NBX0430 Yes No NBX0421 Yes Yes NBX0431 No No

    [0095] NBX Inhibition of Canine Parvovirus Invasion of MDCK Cells

    [0096] Madin-Darby Canine Kidney (MDCK) cells are seeded at 4×10.sup.4 cells per well in a 96-well plate the day before infection. The next day, NBXs are diluted to 50 uM in Eagle's Minimum Essential Medium (EMEM). Canine Parvovirus Type 2 (CPV2) stock is diluted 100-fold in EMEM. NBXs and CPV2 are mixed and the final concentration of NBX is 5 μM. The NBX/CPV2 mixtures are incubated at 37° C. for 60 minutes. Remove media from the cells, add 30 μl of NBX/CPV2 mixtures to the cells, and incubate at 37° C. for 90 minutes. Rock the plate every 15 minutes during the 90-minute infection. Add 70 μl of Dulbecco's Modified Eagle Medium with 2% FBS to the cells and incubate at 37° C. for 24 hours. Fix cells with 4% paraformaldehyde (in PBS) for 60 minutes at room temperature, stop fixation with 0.1 M glycine for 15 minutes. Permeabilize cells with 0.1% Triton-X100 (in PBS) for 30 minutes, and block with 5% milk in PBS-T (0.05% Tween-20) for 60 minutes at room temperature. For detection, incubate with mouse anti-CPV2 antibodies for 60 minutes and HRP-conjugated anti-mouse antibodies for 60 minutes. Incubate with TMB substrate for 30 minutes and stop the reaction with 1 N HCl. Read the absorbance at 450 nm.

    [0097] Table 4 indicates for all NBXs tested, whether the NBX can neutralize the invasion of MDCK cells by >50% at a concentration of 5 mM.

    TABLE-US-00005 TABLE 4 Summary table for NBXs that prevent invasion by canine parvovirus Invasion reduced by NBX Number >50% at 5 μM NBX NBX0411 Yes NBX0412 No NBX0414 Yes NBX0415 No NBX0416 No NBX0417 No NBX0421 Yes NBX0426 Yes NBX0428 Yes NBX0429 No NBX0430 No NBX0431 No

    [0098] As used herein, the term “comprise” or variations thereof such as “comprises” or “comprising” are to be read to indicate the inclusion of any recited feature but not the exclusion of any other features. Thus, as used herein, the term “comprising” is inclusive and does not exclude additional, unrecited features. In some embodiments of any of the compositions and methods provided herein, “comprising” may be replaced with “consisting essentially of” or “consisting of.” The phrase “consisting essentially of” is used herein to require the specified feature(s) as well as those which do not materially affect the character or function of the claimed disclosure. As used herein, the term “consisting” is used to indicate the presence of the recited feature alone.

    [0099] Throughout this disclosure, various embodiments are presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of any embodiments. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well of any dividual numerical values within that range to the tenth of the unit of the lower limit unless the context clearly dictates otherwise. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well of any dividual values within that range, for example, 1.1, 2, 2.3, 5, and 5.9. This applies regardless of the breadth of the range. The upper and lower limits of these intervening ranges may independently be included in the smaller ranges, and are also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the invention, unless the context clearly dictates otherwise.

    [0100] The terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting of any embodiment. As used herein, the singular forms “a,” “an” and “the” are intended to include the plural forms as well, unless the context clearly indicates otherwise. It will be further understood that the terms “comprises” and/or “comprising,” when used in this specification, specify the presence of stated features, integers, steps, operations, elements, and/or components, but do not preclude the presence or addition of one or more other features, integers, steps, operations, elements, components, and/or groups thereof. As used herein, the term “and/or” includes any and all combinations of one or more of the associated listed items.

    [0101] All publications, patent applications, issued patents, and other documents referred to in this specification are herein incorporated by reference as if each individual publication, patent application, issued patent, or other document is specifically and individually indicated to be incorporated by reference in its entirety. Definitions that are contained in text incorporated by reference are excluded to the extent that they contradict definitions in this disclosure.

    [0102] The following references are incorporated by reference in their entirety. [0103] Decaro, N. & Buonavoglia, C. (2012). Canine parvovirus—A review of epidemiological and diagnostic aspects, with emphasis on type 2c. Veterinary Microbiology. Volume 155, pp. 1-12. Hafenstein, S. et al. (2007). Asymmetric binding of transferrin receptor to parvovirus capsids. Proceedings of the National Academy of Sciences of the United States of America. Volume 104, pp. 6585-6589. [0104] Hernández-Blanco, B. & Catala-López, F. (2015). Are licensed canine parvovirus (CPV2 and CPV2b) vaccines able to elicit protection against CPV2c subtype in puppies?: A systematic review of controlled clinical trials. Veterinary Microbiology. Volume 180, pp. 1-9. Jakel, V. et al. (2012). Vaccination against Feline Panleukopenia: implications from a field study in kittens. BMC Veterinary Research. Volume 8, Article 62. [0105] Miranda, C. & Thompson, G. (2016). Canine parvovirus: the worldwide occurrence of antigenic variants. Journal of General Virology. Volume 97, pp. 2043-2057. [0106] Mylonakis, M. E. et al. (2016). Canine parvoviral enteritis: an update on the clinical diagnosis, treatment, and prevention. Veterinary Medicine. Volume 7, pp. 91-100. [0107] Nandi, S. & Kumar, M. (2010). Canine Parvovirus: Current Perspective. Indian Journal of Virology. Volume 21, pp. 31-44. [0108] Stuetzer, B. & Hartmann, K. (2014). Feline parvovirus infection and associated diseases. The Veterinary Journal. Volume 201, pp. 150-155. [0109] Truyen, U. et al. (2009). Feline panleukopenia: ABCD guidelines on prevention and management. Journal of Feline Medicine and Surgery. Volume 11, pp. 538-546. [0110] Venn, E. et al. (2017). Evaluation of an outpatient protocol in the treatment of canine parvoviral enteritis. Journal of Veterinary Emergency and Critical Care. Volume 27, pp. 52-65. [0111] Yuan, W. & Parrish, C. R. (2000). Comparison of two single-chain antibodies that neutralize canine parvovirus: Analysis of an antibody-combining site and mechanisms of neutralization. Virology. Volume 269, pp. 471-480.