MODIFIED ADENO-ASSOCIATED VIRAL VECTORS FOR USE IN GENETIC ENGINEERING
20220064668 · 2022-03-03
Inventors
- Modassir Choudhry (New York, NY)
- Mavis AGBANDJE-MCKENNA (New York, NY, US)
- Tilmann BUERCKSTUEMMER (New York, NY, US)
- Thomas HENLEY (New York, NY, US)
- Lydia VINEY (New York, NY, US)
Cpc classification
C12N7/00
CHEMISTRY; METALLURGY
C12N2750/14152
CHEMISTRY; METALLURGY
C12N2750/14143
CHEMISTRY; METALLURGY
C12N2750/14122
CHEMISTRY; METALLURGY
C12N2750/14134
CHEMISTRY; METALLURGY
C12N2750/14133
CHEMISTRY; METALLURGY
International classification
Abstract
Adeno-associated virus has numerous advantages for its use in gene therapy. The present disclosures provide genetically modified adeno-associated viral vectors, and the methods of making the genetically modified adeno-associated viral vectors and compositions in treating cancer, other conditions, diseases, and disorders.
Claims
1. A polynucleic acid sequence that encodes: a. in a first reading frame, an adeno-associated virus (AAV) VP1 polypeptide, an AAV VP2 polypeptide, and an AAV VP3 polypeptide, and b. in a second reading frame, a modified AAV assembly-activating protein (AAP) polypeptide that is at least partially in a region of said first reading frame that encodes at least a portion of said VP2 polypeptide and at least a portion of said VP3 polypeptide, and wherein said AAP polypeptide comprises i) at least one amino acid substitution in said region of said first reading frame that encodes at least a portion of said VP2 polypeptide as compared to a wild-type AAV AAP polypeptide of the same AAV serotype of said VP2 polypeptide; or ii) at least one amino acid substitution in said region of said first reading frame that encodes at least a portion of said VP3 polypeptide as compared to a wild-type AAV AAP polypeptide of the same AAV serotype of said VP3 polypeptide, and wherein one of said VP1, VP2, and VP3 polypeptides is a first AAV serotype, and one of said VP1, VP2, and VP3 polypeptides is a second AAV serotype, wherein said first and second AAV serotypes are different.
2. (canceled)
3. The polynucleic acid sequence of claim 1, wherein introduction of a said polynucleic acid into a population of cells under conditions suitable for AAV particle production from said cells, results in a higher titer of AAV particles produced by said population of cells compared to introduction of a comparable polynucleic acid lacking said modified AAP polypeptide.
4.-6. (canceled)
7. The polynucleic acid sequence of claim 1, wherein said VP2 polypeptide is an AAV6 serotype, and said at least one amino acid substitution in said region of said first reading frame that encodes at least a portion of said VP2 polypeptide is in a helical region of said modified AAP polypeptide is within amino acids 13 to 27 of said AAP polypeptide.
8. The polynucleic acid sequence of claim 7, wherein said at least one amino acid substitution in said region of said first reading frame that encodes at least a portion of said VP2 polypeptide is in a helical region of said modified AAP polypeptide is within amino acids 21 to 27 of said AAP polypeptide.
9. The polynucleic acid of claim 1, wherein said at least one amino acid substitution comprises a substitution at amino acid K53, C54, L55, M56, M57, or R59 of SEQ ID NO: 39, or any combination thereof, in said AAP polypeptide.
10.-16. (canceled)
17. The polynucleic acid sequence of claim 1, wherein said first AAV serotype and said second AAV serotype are selected from AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, and AAV12.
18. The polynucleic acid sequence of claim 1, wherein said first AAV serotype is AAV12 and said second AAV serotype is AAV6.
19. The polynucleic acid sequence of claim 1, wherein said VP1 and VP2 polypeptides are AAV12 serotype and said VP3 polypeptide is an AAV6 serotype.
20. A polynucleic acid sequence that encodes i) in a first reading frame, a VP2 polypeptide of an AAV serotype, and ii) in a second reading frame, a modified assembly-activating protein (AAP) polypeptide comprising at least one amino acid substitution within amino acids 5-40 in said modified AAP polypeptide with respect to a wild type AAP polypeptide of the AAV serotype.
21. The polynucleic acid sequence of claim 20, wherein said polynucleic acid sequence comprises a nucleic acid sequence encoding an AAV12 VP1 polypeptide, a nucleic acid sequence encoding an AAV12 VP2 polypeptide, and a nucleic acid sequence encoding an AAV6 VP3 polypeptide, in a single reading frame.
22. The polynucleic acid sequence of claim 20, wherein said at least one amino acid substitution comprises a substitution at amino acid K53, C54, L55, M56, M57, and R59 of SEQ ID NO: 39, or any combination thereof, in said AAP polypeptide.
23.-29. (canceled)
30. The polynucleic acid sequence of claim 20, wherein said AAV serotype is AAV6.
31.-67. (canceled)
68. A system comprising a first polynucleic acid sequence that encodes at least three adeno-associated virus (AAV) polypeptides, wherein said first polynucleic acid sequence encodes a VP1 polypeptide, a VP2 polypeptide, and a VP3 polypeptide, wherein two of said VP1, VP2, and VP3 polypeptides are from a first AAV serotype, and one of said VP1, VP2, and VP3 polypeptides is from a second AAV serotype, wherein said first AAV serotype and said second AAV serotype are not the same; and a second polynucleic acid sequence heterologous to said first polynucleic acid sequence that encodes an AAV assembly-activating protein (AAP) polypeptide, wherein said first polynucleic acid sequence and second polynucleic acid sequence are not covalently linked.
69.-70. (canceled)
71. The system of claim 68, wherein said AAV AAP polypeptide is an AAV6 AAP polypeptide.
72. The system of claim 68, wherein said first AAV serotype and said second AAV serotype are selected from AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, or any combination thereof.
73. The system of claim 68, wherein said first AAV serotype is AAV12.
74. The system of claim 68, wherein said first AAV serotype is AAV12 and said second AAV serotype is AAV6.
75. The system of claim 74, wherein said first polynucleic acid sequence encodes an AAV12 VP1, an AAV12, VP2, and an AAV6 VP3.
76.-111. (canceled)
112. The system of claim 68, further comprising a third polynucleic acid sequence that encodes a Rep polypeptide.
113. The system of claim 112, wherein the Rep polypeptide comprises a modified Rep polypeptide, and wherein the modified Rep polypeptide provides at least one of improved packaging efficiency, yield, infectivity, transduction efficiency, and transfection efficiency as compared to a system lacking said modified Rep polypeptide.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0088] The novel features of the invention are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention are utilized, and the accompanying drawings of which:
[0089]
[0090]
[0091]
[0092]
[0093]
[0094]
DETAILED DESCRIPTION OF THE DISCLOSURE
[0095] The following description and examples illustrate embodiments of the invention in detail. It is to be understood that this invention is not limited to the particular embodiments described herein and as such can vary. Those of skill in the art will recognize that there are numerous variations and modifications of this invention, which are encompassed within its scope.
[0096] All publications, patents, and patent applications mentioned in this specification are herein incorporated by reference in their entirety for all purposes, to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference. For example, all publications and patents mentioned herein are incorporated herein by reference in their entirety for the purpose of describing and disclosing the kits, compositions, and methodologies that are described in the publications, which might be used in connection with the methods, kits, and compositions described herein. The documents discussed herein are provided solely for their disclosure prior to the filing date of the present application. Nothing herein is to be construed as an admission that the inventors described herein are not entitled to antedate such disclosure by virtue of prior invention or for any other reason.
Definitions
[0097] To facilitate an understanding of the present disclosure, a number of terms and phrases are defined below.
[0098] The terminology used herein is for the purpose of describing particular cases only and is not intended to be limiting. As used herein, the singular forms “a,” “an,” and “the” are intended to include the plural forms as well, unless the context clearly indicates otherwise. Furthermore, to the extent that the terms “including,” “includes,” “having,” “has,” “with,” or variants thereof are used in either the detailed description and/or the claims, such terms are intended to be inclusive in a manner similar to the term “comprising.”
[0099] It is understood that terms such as “comprises,” “comprised,” “comprising,” and the like have the meaning attributed to it in U.S. Patent law; i.e., they mean “includes,” “included,” “including,” and the like and are intended to be inclusive or open ended and does not exclude additional, unrecited elements or method steps; and that terms such as “consisting essentially of” and “consists essentially of” have the meaning ascribed to them in U.S. Patent law; i.e., they allow for elements not explicitly recited, but exclude elements that are found in the prior art or that affect a basic or novel characteristic of the invention.
[0100] The term “and/or” as used in a phrase such as “A and/or B” herein includes both A and B; A or B; A (alone); and B (alone). Likewise, the term “and/or” as used in a phrase such as “A, B, and/or C” encompass each of the following embodiments: A, B, and C; A, B, or C; A or B; A or C; B or C; A and B; A and C; B and C; A (alone); B (alone); and C (alone).
[0101] The term “about” or “approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, “about” and its grammatical equivalents in relation to a reference numerical value and its grammatical equivalents as used herein can include a range of values plus or minus 10% from that value. Or for example, the amount “about 10” can include amounts from 9 to 11. The term “about” in relation to a reference numerical value can also include a range of values plus or minus 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or 1% from that value.
[0102] The term “adeno-associated virus” or “AAV,” refers to an adeno-associated virus of any of the known serotypes, including e.g., AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, or AAV12, scAAV (self-complementary AAV), rh10, chimeric, or hybrid AAV, or any combination, derivative, or variant thereof. AAV is a small non-enveloped single-stranded DNA virus. They are non-pathogenic parvoviruses and can require helper viruses, such as adenovirus, herpes simplex virus, vaccinia virus, and CMV, for replication. Wild-type (WT) AAV is common in the general population, and is not associated with any known pathologies. AAV, as used herein, includes avian AAV, bovine AAV, canine AAV, equine AAV, primate AAV, non-primate AAV, and ovine AAV, wherein primate AAV refers to AAV that infects primates, and wherein non-primate AAV refers to AAV that infects non-primate animals, such as avian AAV that infects avian animals. In some cases, the WT AAV contains rep and cap genes, wherein the rep gene is required for viral replication and the cap gene is required for the synthesis of capsid proteins. The abbreviation “rAAV” refers to recombinant adeno-associated virus, also referred to as a recombinant AAV.
[0103] The term “hybrid AAV” as used herein refers to an AAV comprising a capsid protein of one AAV serotype and genomic material from another AAV serotype.
[0104] The term “chimeric AAV” as used herein refers to an AAV that comprises genetic and/or protein sequences derived from two or more AAV serotypes, and can include mutations made to the genetic sequences of those two or more AAV serotypes. An exemplary chimeric AAV can comprise a chimeric AAV capsid, for example, a capsid protein with one or more regions of amino acids derived from two or more AAV serotypes.
[0105] The term “AAV variant” as used herein refers to an AAV comprising one or more amino acid mutations in its genome or proteins as compared to its parental AAV, e.g., one or more amino acid mutations in its capsid protein as compared to its parental AAV.
[0106] The term “viral vector” refers to a gene transfer vector or a gene delivery system derived from a virus. Such vector can be constructed using recombinant techniques known in the art. In some aspects, the virus for deriving such vector is selected from adeno-associated virus (AAV), helper-dependent adenovirus, hybrid adenovirus, Epstein-Bar virus, retrovirus, lentivirus, herpes simplex virus, hemmaglutinating virus of Japan (HVJ), Moloney murine leukemia virus, poxvirus, and HIV-based virus.
[0107] The term “AAV virion” or “AAV particle,” as used herein refers to a virus particle comprising a capsid comprising at least one AAV capsid protein that encapsidates an AAV vector as described herein, wherein the vector can further comprise a heterologous polynucleotide sequence or a transgene in some embodiments.
[0108] The term “viral vector” refers to a gene transfer vector or a gene delivery system derived from a virus. Such vector can be constructed using recombinant techniques known in the art. In some aspects, the virus for deriving such vector is selected from adeno-associated virus (AAV), helper-dependent adenovirus, hybrid adenovirus, Epstein-Bar virus, retrovirus, lentivirus, herpes simplex virus, hemmaglutinating virus of Japan (HVJ), Moloney murine leukemia virus, poxvirus, and HIV-based virus.
[0109] The term “engineered cell” and its grammatical equivalents as used herein refers to a cell comprising at least one alterations of a nucleic acid within the cell's genome or comprising at least one exogenous nucleic acid or protein. Alterations include additions, deletions, and/or substitutions within a nucleic acid sequence. As such, engineered cells, include cells that contain an added, deleted, and/or altered gene.
[0110] The term “mutation” and its grammatical equivalents as used herein includes a substitution, deletion, and/or insertion of a nucleotide of a nucleic acid sequence or a substitution, deletion, and/or insertion of an amino acid in a polypeptide sequence. A mutation can be a conservative mutation or replacement. For example, 20 naturally occurring amino acids can share similar characteristics. Aliphatic amino acids can be: glycine, alanine, valine, leucine, or isoleucine. Hydroxyl or sulfur/selenium-containing amino acids can be: serine, cysteine, selenocysteine, threonine, or methionine. A cyclic amino acid can be proline. An aromatic amino acid can be phenylalanine, tyrosine, or tryptophan. A basic amino acid can be histidine, lysine, or arginine. An acidic amino acid can be aspartate, glutamate, asparagine, or glutamine. A conservative mutation can be: serine to glycine, serine to alanine, serine to serine, serine to threonine, or serine to proline; arginine to asparagine, arginine to lysine, arginine to glutamine, arginine to arginine, or arginine to histidine; leucine to phenylalanine, leucine to isoleucine, leucine to valine, leucine to leucine, or leucine to methionine; proline to glycine, proline to alanine, proline to serine, proline to threonine, or proline to proline; threonine to glycine, threonine to alanine, threonine to serine, threonine to threonine, or threonine to proline; alanine to glycine, alanine to threonine, alanine to proline, alanine to alanine, or alanine to serine; valine to methionine, valine to phenylalanine, valine to isoleucine, valine to leucine, or valine to valine; glycine to alanine, glycine to threonine, glycine to proline, glycine to serine, or glycine to glycine; isoleucine to phenylalanine, isoleucine to isoleucine, isoleucine to valine, isoleucine to leucine, or isoleucine to methionine; phenylalanine to tryptophan, phenylalanine to phenylalanine, or phenylalanine to tyrosine; tyrosine to tryptophan, tyrosine to phenylalanine, or tyrosine to tyrosine; cysteine to serine, cysteine to threonine, or cysteine to cysteine; histidine to asparagine, histidine to lysine, histidine to glutamine, histidine to arginine, or histidine to histidine; glutamine to glutamic acid, glutamine to asparagine, glutamine to aspartic acid, or glutamine to glutamine; asparagine to glutamic acid, asparagine to asparagine, asparagine to aspartic acid, or asparagine to glutamine; lysine to asparagine, lysine to lysine, lysine to glutamine, lysine to arginine, or lysine to histidine; aspartic acid to glutamic acid, aspartic acid to asparagine, aspartic acid to aspartic acid, or aspartic acid to glutamine; glutamine to glutamine, glutamine to asparagine, glutamine to aspartic acid, glutamine to glutamine; methionine to phenylalanine, methionine to isoleucine, methionine to valine, methionine to leucine, or methionine to methionine; tryptophan to tryptophan, tryptophan to phenylalanine, or tryptophan to tyrosine.
[0111] The term “heterologous” and its grammatical equivalents as used herein refers to being different, changed, or altered from the original nucleotide or peptide sequence. For example, a chimeric AAV of two different AAV serotypes can have a nucleotide sequence that is different from or heterologous to both serotypes.
[0112] The term “transgene” and its grammatical equivalents as used herein refers to a gene or genetic material that is transferred into a cell ex vivo, in vivo, or in vitro. For example, a transgene can be a stretch or segment of DNA containing a gene that is introduced into a cell ex vivo, in vivo, or in vitro. When a transgene is transferred into a cell in an organism in vivo, the organism is then referred to as a transgenic organism. In some embodiments, the transgene retains its ability to produce an RNA and/or functional proteins An exemplary transgene described herein encodes for an engineered T-cell receptor. A transgene can be a receptor. A transgene can comprise recombination arms. A transgene can comprise engineered sites.
[0113] The term “antigen” and its grammatical equivalents as used herein refers to a molecule that contains one or more epitopes capable of being bound by one or more receptors, antibodies (including functional fragments or variants thereof) or other antigen binding moieties. For example, an antigen can stimulate a host's immune system to make a cellular antigen-specific immune response when the antigen is presented, or a humoral antibody response. An antigen can also have the ability to elicit a cellular and/or humoral response by itself or when present in combination with another molecule. For example, a tumor cell antigen can be recognized by a TCR.
[0114] The term “epitope” and its grammatical equivalents as used herein refers to a part of an antigen that can be recognized by antibodies (including functional fragments or variants thereof), B-cells (through the B cell receptor), T-cells (through the T cell receptor (TCR)), cell surface receptors, or other epitope binding moieties or receptors (e.g., a chimeric antigen receptor (CAR)). For example, an epitope can be a cancer epitope that is recognized by a TCR. Multiple epitopes within an antigen can also be recognized. The epitope can also be mutated.
[0115] The term “recombination” and its grammatical equivalents as used herein refers to a process of exchange of genetic information between two polynucleic acids. For the purposes of this disclosure, “homologous recombination” or “HR” refers to a specialized form of such genetic exchange that can take place, for example, during repair of double-strand breaks. This process requires nucleotide sequence homology, for example, using a donor molecule to template repair of a target molecule (e.g., a molecule that experienced the double-strand break), and is sometimes known as non-crossover gene conversion or short tract gene conversion. Such transfer can also involve mismatch correction of heteroduplex DNA that forms between the broken target and the donor, and/or synthesis-dependent strand annealing, in which the donor can be used to resynthesize genetic information that can become part of the target, and/or related processes. Such specialized HR can often result in an alteration of the sequence of the target molecule such that part or all of the sequence of the donor polynucleotide can be incorporated into the target polynucleotide. The terms “recombination arms” and “homology arms” are used interchangeably herein.
[0116] The term “non-human animal” and its grammatical equivalents as used herein includes all animal species other than humans, including non-human mammals, which can be a native animal or a genetically modified non-human animal.
[0117] The terms “nucleic acid,” “polynucleotide,” “polynucleic acid,” and “oligonucleotide” and their grammatical equivalents are used interchangeably herein and refer to a deoxyribonucleotide or ribonucleotide polymer, in linear or circular conformation, and in either single- or double-stranded form. For the purposes of the present disclosure, these terms should not to be construed as limiting with respect to length. The terms also encompass nucleic acids comprising analogues of natural nucleotides, as well as nucleotides that are modified in the base, sugar and/or phosphate moieties (e.g., phosphorothioate backbones). Modifications of the terms can also encompass demethylation, addition of CpG methylation, removal of bacterial methylation, and/or addition of mammalian methylation. In general, an analogue of a particular nucleotide can have the same base-pairing specificity, i.e., an analogue of A can base-pair with T.
[0118] The term “autologous” and its grammatical equivalents as used herein refers to cells or tissues are obtained from and administered to the same subject. For example, a sample (e.g., cells) can be removed, processed, and given back to the same subject at a later time. An autologous process is distinguished from an allogenic process where the donor and the recipient are different subjects.
[0119] The term “allogenic” and its grammatical equivalents as used herein refers to cells or tissues are obtained from one subject and administered to a different subject of the same species. For example, a sample (e.g., cells) can be removed, processed, and given back to a different subject of the same species at a later time.
[0120] The terms “cancer” and “tumor” are used interchangeably herein and refer to a hyperproliferation of cells whose unique trait—loss of normal controls—results in unregulated growth, lack of differentiation, local tissue invasion, and metastasis. With respect to the methods described herein, the cancer can be any cancer, including, but not limited to, acute lymphocytic cancer, acute myeloid leukemia, alveolar rhabdomyosarcoma, bladder cancer, bone cancer, brain cancer, breast cancer, cancer of the anus, anal canal, rectum, cancer of the eye, cancer of the intrahepatic bile duct, cancer of the joints, cancer of the neck, gallbladder, or pleura, cancer of the nose, nasal cavity, or middle ear, cancer of the oral cavity, cancer of the vulva, chronic lymphocytic leukemia, chronic myeloid cancer, colon cancer, esophageal cancer, cervical cancer, fibrosarcoma, gastrointestinal carcinoid tumor, Hodgkin lymphoma, hypopharynx cancer, kidney cancer, larynx cancer, leukemia, liquid tumors, liver cancer, lung cancer, lymphoma, malignant mesothelioma, mastocytoma, melanoma, multiple myeloma, nasopharynx cancer, non-Hodgkin lymphoma, ovarian cancer, pancreatic cancer, peritoneum, omentum, and mesentery cancer, pharynx cancer, prostate cancer, rectal cancer, renal cancer, skin cancer, small intestine cancer, soft tissue cancer, solid tumors, stomach cancer, testicular cancer, thyroid cancer, ureter cancer, and/or urinary bladder cancer.
Overview
[0121] Disclosed herein are modified adeno-associated viruses (AAV) with optionally one or more of superior viral titer and infectivity compared to unmodified AAV, compositions comprising said viruses, methods for producing or using the same, and methods of using the same in the treatment of conditions, for instance cancer. In some embodiments, the viruses described herein comprise a modified AAP sequence that can confer an increased viral titer as compared to a corresponding virus without the modified AAP sequence. In some embodiments, chimeric AAV vectors or mutated chimeric AAV vectors are used for delivering an exogenous cellular receptor in a way that improves physiologic and immunologic potency of an engineered cell (e.g., an immune cell). In some embodiments, modified AAV vectors are useful to treat various indications, including, for example, cancer (e.g., metastatic cancer). In some embodiments, AAV vector-modified cells comprise a genomic disruption of at least one gene.
Modified Adeno-Associated Viral (AAV) Vectors
Overview
[0122] Adeno-associated viral (AAV) vectors can be utilized to introduce a transgene into a cell. In some embodiments, said AAV vector is a chimeric AAV vector. In some embodiments, said chimeric AAV vector has superior viral infectivity as compared to a wild-type or non-chimeric AAV vector, and lower viral titer as compared to the wild-type or non-chimeric AAV. The present disclosure provides, inter alia, nucleic acids encoding modified AAP sequences that increase viral titer as compared to AAV without said modified AAP sequences, or compared to a comparable chimeric AAV without said modified AAP sequences. In some embodiments, the modified AAP sequence is provided as part of a nucleic acid molecule encoding the capsid proteins VP1, VP2, and VP3. In some embodiments, the modified AAP sequence is provided in trans as a separate nucleic acid molecule than the nucleic acid molecule encoding the capsid proteins VP1, VP2, and VP3 (e.g., VP1, VP2, and VP3 polypeptides are encoded by a polynucleic acid molecule that is not covalently linked to a polynucleic acid molecule encoding a modified AAP polypeptide).
[0123] The AAV genome carries two viral genes: rep and cap. The virus utilizes two promoters and alternative splicing to generate four proteins necessary for replication (Rep78, Rep68, Rep52, and Rep40), while a third promoter generates the transcript for three structural viral capsid proteins 1, 2, and 3 (VP1, VP2, and VP3), through a combination of alternate splicing and alternate translation start codons. As used herein, “VP1u” refers to the unique sequence of VP1 (i.e. the sequence that does not overlap with VP2 and/or VP3). The three capsid proteins share the same C-terminal 533 amino acids, while VP1 and VP2 contain additional N-terminal sequences of 202 and 65 amino acids, respectively. The AAV virion can contain a total of 60 copies of VP1, VP2, and VP3 at a 1:1:20 ratio, arranged in a T=1 icosahedral symmetry. In some cases, a Rep protein (e.g., Rep78, Rep68, Rep52, or Rep40) or a capsid protein can be modified and utilized in the disclosed compositions and methods. In some cases, the capsid is comprised of three VPs: VP1, VP2, and VP3. The VP1 protein contains the entire VP2 sequence in addition to a unique 137-amino-acid N-terminal region (VP1u), while the VP2 protein contains the entire VP3 sequence in addition to an 65-amino-acid N-terminal region (VP1/2 common region). In some embodiments, an AAV provided herein comprises an assembly-activating protein (AAP). In certain embodiments, the AAP promotes capsid assembly. In some cases, an AAV comprises an AAP polypeptide modified to enhance AAV capsid structure and function, for example by improving capsid assembly. In some embodiments, for example, a modified Rep protein or capsid protein provides improved packaging efficiency, yield, infectivity, transduction efficiency, or transfection efficiency. In some embodiments, said AAV has a capsid diameter of about 26 nm. In some embodiments, said capsid diameter is from about 20 nm to about 50 nm in some cases.
[0124] At the cellular level, AAV can undergo 5 steps prior to achieving gene expression: 1) binding or attachment to cellular surface receptors, 2) endocytosis, 3) trafficking to the nucleus, 4) uncoating of the virus to release the genome, and 5) conversion of the genome from single-stranded to double-stranded DNA as a template for transcription in the nucleus. The cumulative efficiency with which AAV can successfully execute each individual step can determine the overall transduction efficiency. Rate limiting steps in AAV transduction can include the absence or low abundance of required cellular surface receptors for viral attachment and internalization, inefficient endosomal escape leading to lysosomal degradation, and slow conversion of single-stranded to double-stranded DNA template. Therefore, vectors with modifications to the genome and/or the capsids can be designed to facilitate more efficient or more specific transduction of cells or tissues for gene therapy.
[0125] In some cases, a host cell can contain sequences which drive expression of a novel AAV capsid protein (or a capsid protein comprising a fragment thereof) in the host cell and rep sequences of the same source as the source of the AAV ITRs, or a cross-complementing source. The AAV cap and rep sequences can be independently obtained from an AAV source as described above and can be introduced into the host cell in any manner known to one of ordinary skill in the art as described above. Additionally, when pseudotyping an AAV vector, the sequences encoding each of the Rep proteins can be supplied by different AAV sources (e.g., AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12). In some cases, a host cell stably contains the capsid protein under the control of a suitable promoter. In some cases, a capsid protein can be expressed under the control of an inducible promoter. In another embodiment, a nucleic acid encoding a capsid protein can be supplied to the host cell in trans from a nucleic acid encoding a rep sequence. Likewise, an AAP nucleic acid sequence can be supplied to the host cell in trans from the nucleic acid encoding a capsid protein and/or from the nucleic acid encoding a rep sequence. When delivered to the host cell in trans, a protein can be delivered via a plasmid which contains the sequences necessary to direct expression of the selected protein in the host cell. In some cases, when delivered to a host cell in trans, a plasmid carrying a protein also carries other sequences required for packaging the AAV, e.g., the rep sequences. In some cases, rep, cap, and AAP sequences can be transfected into a host cell on a single nucleic acid molecule and exist stably in the cell as an episome. In another embodiment, the rep, cap, and AAP sequences are stably integrated into the chromosome of the cell. Another embodiment has the rep, cap, and AAP sequences are transiently expressed in the host cell. For example, a useful nucleic acid molecule for such transfection comprises, from 5′ to 3′, a promoter, an optional spacer interposed between the promoter and the start site of the rep gene sequence, an AAV rep gene sequence, and an AAV cap gene sequence including the AAP sequence.
[0126] In some cases, novel AAV amino acid sequences, peptides and proteins can be expressed from AAV nucleic acid sequences described herein. Additionally, these amino acid sequences, peptides and proteins can be generated by other methods known in the art, including, e.g., by chemical synthesis, by other synthetic techniques, or by other methods. The sequences of any of the AAV capsids provided herein can be readily generated using a variety of techniques. Suitable production techniques are well known to those of skill in the art. See, e.g., Sambrook et al, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press (Cold Spring Harbor, N.Y.). Alternatively, peptides can also be synthesized by the well-known solid phase peptide synthesis methods (Merrifield, J. Am. Chem. Soc., 85:2149 (1962); Stewart and Young, Solid Phase Peptide Synthesis (Freeman, San Francisco, 1969) pp. 27-62). The sequences and proteins described herein can be produced by any suitable means, including recombinant production, chemical synthesis, or other synthetic means. Such production methods are within the knowledge of those of skill in the art.
[0127] In some cases, sequences can encode an AAV capsid or engineered AAV vector described herein. In another embodiment, vectors can contain, at a minimum, sequences encoding an AAV Rep protein or a fragment thereof. Optionally, vectors can contain AAV Cap, Rep, and AAP proteins. In vectors in which AAV rep and cap (including AAP) sequences are provided, the AAV rep and AAV cap sequences can originate from an AAV of the same clade. Alternatively, provided herein can be vectors in which a rep sequences are from an AAV source which differs from that which is providing the cap sequences. In one embodiment, the rep and cap sequences are expressed from separate sources (e.g., separate vectors, or a host cell and a vector). In another embodiment, these rep sequences are fused in frame to cap sequences of a different AAV source to form a chimeric AAV vector. Optionally, vectors can be vectors packaged in an AAV capsid. These vectors and other vectors described herein can further contain a transgene comprising a selected transgene which is flanked by AAV 5′ ITR and AAV 3′ ITR.
[0128] In some embodiments, the AAV viral vector is isogenic. In some embodiments, the AAV viral vector is integrated into a portion of a genome with known SNPs. In some embodiments, the AAV vector cannot be integrated into a portion of a genome with known SNPs. For example, an AAV can be designed to be isogenic or homologous to a subject's own genomic DNA. In some embodiments, an isogenic vector improves the efficiency of homologous recombination (HR). In some embodiments, a guide RNA (gRNA) is designed so that it does not target a region of the genome with known SNPs in order to improve the expression of an integrated transgene. The frequency of SNPs at immune checkpoint genes, such as PD-1, CISH, and CTLA-4, are determined. In some embodiments, the frequency of SNPs at an endogenous TCR gene are be determined.
Capsid Modifications and Chimeras
[0129] In some embodiments, an AAV viral capsid is modified. In some embodiments, the modification comprises a modification to at least 1, 2, or 3 capsid genes (e.g., VP1, VP2, or VP3). In some embodiments, VP1 is modified, VP2 is modified, VP3 is modified, VP1 and VP2 are modified, VP1 and VP3 are modified, VP2 and VP3 are modified, or VP1, VP2, and VP3 are modified, or any combination thereof.
[0130] In some embodiments, said modification comprises at least one amino acid modification (e.g., substitution, deletion, or addition), compared to the WT AAV capsid protein of the relevant serotype. A modification can be of any AAV serotype. In some embodiments, a modification is of a wild-type (WT) AAV6. A modification can include modifying a combination of capsid components. For example, a mosaic capsid AAV is a virion that can be composed of a mixture of viral capsid proteins from different serotypes. The capsid proteins can be provided by complementation with separate plasmids that are mixed at various ratios. During viral assembly, the different serotype capsid proteins can be mixed in each virion, at subunit ratios stoichiometrically reflecting the ratios of the complementing plasmids. A mosaic capsid can confer increased binding efficacy to certain cell types or improved performance as compared to an unmodified capsid.
[0131] In some embodiments, an AAV comprises a mutation in at least one capsid protein (e.g., at least one of VP1, VP2, and VP3). Thus, at least one of VP1, VP2, and VP3 has at least one amino acid substitution compared to WT AAV capsid protein. In some cases, a mutation can occur in VP1 and VP2, in VP1 and VP3, in VP2 and VP3, or in VP1, VP2, and VP3. In some cases, a VP can be removed. For example, in some embodiments a mutant AAV does not comprise at least one of VP1, VP2, or VP3.
[0132] In some embodiments, at least one of VP1, VP2, and VP3 has from one to about 15 amino acid substitutions compared to WT AAV VP1, VP2, and VP3, e.g., from about one to about 3, from about 3 to about 6, from about 6 to about 9, from about 9 to about 12, or from about 12 to about 15 amino acid substitutions compared to WT AAV VP1, VP2, and VP3. In some cases, a mutant AAV virion can have from about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or up to about 100 mutations in at least a portion of an AAV sequence, such as a capsid or AAP sequence. A mutation in a capsid sequence can be within anyone of VP1, VP2, VP3, or combinations thereof. In some cases, a mutant AAV variant can have one mutation in a capsid sequence. In some cases, a mutant AAV variant can have two mutations in a capsid sequence. In some cases, a mutant AAV variant can have three mutations in a capsid sequence. Alternatively, a subject mutant AAV virion comprises one or more amino acid deletions and/or insertions in at least one capsid protein relative to WT capsid or AAP protein. In some embodiments, a subject mutant AAV virion comprises one or more amino acid substitutions and/or deletions and/or insertions in a capsid protein relative to a WT capsid protein. In some cases, a mutation can be a point mutation. In some cases, at least a portion of an AAV can be mutated. For example, a capsid of an AAV can have a mutation such as a point mutation, missense mutation, nonsense mutation, insertion, deletion, duplication, frameshift, or repeat expansion.
[0133] In some embodiments, the AAV is chimeric. In some embodiments, said chimeric AAV comprises a chimeric capsid. Chimeric capsid modifications include, but are not limited to, the use of naturally existing AAV serotypes as templates, which can involve AAV capsid sequences lacking a certain function being co-transfected with DNA sequences from another capsid. In some embodiments, said chimera includes at least one Cap polypeptide from an AAV serotype chosen from: AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, and AAV12. In some embodiments, said chimeric AAVs comprise a polypeptide encoding a VP1 from an AAV serotype chosen from the group consisting of: AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, and AAV12; a polypeptide comprising a VP2 from an AAV serotype chosen from: AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, and AAV12; and a VP1 from an AAV serotype chosen from the group consisting of: AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, and AAV12; wherein at least two of said VP1, VP2 and VP3 are from different AAV serotypes. In some embodiments, said chimeric capsid has an insertion of a foreign protein sequence, either from another WT AAV sequence or an unrelated protein, into the open reading frame of the capsid gene.
[0134] In some embodiments, said chimera comprises capsid proteins from: AAV4 and AAV6, AAV5 and AAV6, AAV11 and AAV6, AAV12 and AAV6, or any combination thereof. In some embodiments said chimera comprises a capsid protein from a first AAV serotype and a capsid protein from a second AAV serotype. In some embodiments, said first AAV serotype is AAV4 and said second serotype is AAV6. In some embodiments, said first AAV serotype is AAV5 and said second AAV serotype is AAV6. In some embodiments, said first AAV serotype is AAV11 and said second AAV serotype is AAV6. In some embodiments, said first AAV serotype is AAV12 and said second AAV serotype is AAV6.
[0135] Table 1 provides exemplary chimeric AAV capsid nucleic acid and amino acid sequences. Exemplary WT AAV capsid nucleic acid and amino acid sequences are provided in Table 2.
[0136] In some embodiments, the chimera comprises a capsid encoded by a nucleic acid sequence in Table 1. In some embodiments, the chimera comprises a capsid comprising an amino acid sequence in Table 1. In some embodiments, the chimera comprises a capsid protein encoded by a nucleic acid sequence that shares at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identity with SEQ ID NOs: 51-65. In some embodiments, the chimera comprises a capsid protein that comprises an amino acid sequence that shares at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identity with SEQ ID NOs: 44-50. In some embodiments, the chimera comprises a capsid protein encoded by a nucleic acid sequence that shares at least 99% or 100% identity with SEQ ID NOs: 51-65. In some embodiments, the chimera comprises a capsid protein that comprises an amino acid sequence that shares at least 99% or 100% identity with SEQ ID NOs: 44-50.
TABLE-US-00001 TABLE 1 Exemplary chimeric AAV capsid nucleic acid and amino acid sequences SEQ SEQ Name ID NO. Amino Acid Sequence ID NO. Nucleic Acid Sequence Chimera 2 44 MSFVDHPPDWLEEVGEGL 51 atgtcttttgttgatcaccctccagattggtt AAV5VP1u- REFLGLEAGPPKPKPNQQ ggaagaagttggtgaaggtcttcgcgag AAV6VP2/3 HQDQARGLVLPGYNYLG tttttgggccttgaagcgggcccaccgaa PGNGLDRGEPVNRADEVA accaaaacccaatcagcagcatcaagatc REHDISYNEQLEAGDNPY aagcccgtggtcttgtgctgcctggttata LKYNHADAEFQEKLADD actatctcggacccggaaacggtctcgat TSFGGNLGKAVFQAKKRV cgaggagagcctgtcaacagggcagac LEPFGLVEEGAKTAPGKK gaggtcgcgcgagagcacgacatctcgt RPVEQSPQEPDSSSGIGKT acaacgagcagcttgaggcgggagaca GQQPAKKRLNFGQTGDSE acccctacctcaagtacaaccacgcggac SVPDPQPLGEPPATPAAV gccgagtttcaggagaagctcgccgacg GPTTMASGGGAPMADNN acacatccttcgggggaaacctcggaaa EGADGVGNASGNWHCDS ggcagtctttcaggccaagaaaagggttc TWLGDRVITTSTRTWALP tcgaaccttttggcctggttgaagagggtg TYNNHLYKQISSASTGAS ctaagacggctcctggaaagaaacgtcc NDNHYFGYSTPWGYFDF ggtagagcagtcgccacaagagccaga NRFHCHFSPRDWQRLINN ctcctcctcgggcattggcaagacaggcc NWGFRPKRLNFKLFNIQV agcagcccgctaaaaagagactcaatttt KEVTTNDGVTTIANNLTS ggtcagactggcgactcagagtcagtccc TVQVFSDSEYQLPYVLGS cgacccacaacctctcggagaacctcca AHQGCLPPFPADVFMIPQ gcaacccccgctgctgtgggacctactac YGYLTLNNGSQAVGRSSF aatggcttcaggcggtggcgcaccaatg YCLEYFPSQMLRTGNNFT gcagacaataacgaaggcgccgacgga FSYTFEDVPFHSSYAHSQS gtgggtaatgcctcaggaaattggcattgc LDRLMNPLIDQYLYYLNR gattccacatggctgggcgacagagtcat TQNQSGSAQNKDLLFSRG caccaccagcacccgaacatgggccttg SPAGMSVQPKNWLPGPC cccacctataacaaccacctctacaagca YRQQRVSKTKTDNNNSNF aatctccagtgcttcaacgggggccagca TWTGASKYNLNGRESIINP acgacaaccactacttcggctacagcacc GTAMASHKDDKDKFFPM ccctgggggtattttgatttcaacagattcc SGVMIFGKESAGASNTAL actgccatttctcaccacgtgactggcagc DNVMITDEEEIKATNPVA gactcatcaacaacaattggggattccgg TERFGTVAVNLQSSSTDP cccaagagactcaacttcaagctcttcaac ATGDVHVMGALPGMVW atccaagtcaaggaggtcacgacgaatg QDRDVYLQGPIWAKIPHT atggcgtcacgaccatcgctaataacctta DGHFHPSPLMGGFGLKHP ccagcacggttcaagtcttctcggactcg PPQILIKNTPVPANPPAEFS gagtaccagttgccgtacgtcctcggctct ATKFASFITQYSTGQVSVE gcgcaccagggctgcctccctccgttccc IEWELQKENSKRWNPEVQ ggcggacgtgttcatgattccgcagtacg YTSNYAKSANVDFTVDN gctacctaacgctcaacaatggcagccag NGLYTEPRPIGTRYLTRPL gcagtgggacggtcatccttttactgcctg gaatatttcccatcgcagatgctgagaacg ggcaataactttaccttcagctacaccttcg aggacgtgcctttccacagcagctacgcg cacagccagagcctggaccggctgatga atcctctcatcgaccagtacctgtattacct gaacagaactcagaatcagtccggaagt gcccaaaacaaggacttgctgtttagccg ggggtctccagctggcatgtctgttcagcc caaaaactggctacctggaccctgttacc ggcagcagcgcgtttctaaaacaaaaaca gacaacaacaacagcaactttacctggac tggtgcttcaaaatataaccttaatgggcgt gaatctataatcaaccctggcactgctatg gcctcacacaaagacgacaaagacaagt tctttcccatgagcggtgtcatgatttttgga aaggagagcgccggagcttcaaacactg cattggacaatgtcatgatcacagacgaa gaggaaatcaaagccactaaccccgtgg ccaccgaaagatttgggactgtggcagtc aatctccagagcagcagcacagaccctg cgaccggagatgtgcatgttatgggagcc ttacctggaatggtgtggcaagacagaga cgtatacctgcagggtcctatttgggccaa aattcctcacacggatggacactttcaccc gtctcctctcatgggcggctttggacttaa gcacccgcctcctcagatcctcatcaaaa acacgcctgttcctgcgaatcctccggca gagttttcggctacaaagtttgcttcattcat cacccagtattccacaggacaagtgagc gtggagattgaatgggagctgcagaaag aaaacagcaaacgctggaatcccgaagt gcagtatacatctaactatgcaaaatctgc caacgttgatttcactgtggacaacaatgg actttatactgagcctcgccccattggcac ccgttacctcacccgtcccctgtaa Chimera 3 45 MTDGYLPDWLEDNLSEG 52 atgactgacggttaccttccagattggcta rAAV4P1/2- VREWWALQPGAPKPKAN gaggacaacctctctgaaggcgttcgaga AAV6VP3 QQHQDNARGLVLPGYKY gtggtgggcgctgcaacctggagcccct LGPGNGLDKGEPVNAAD aaacccaaggcaaatcaacaacatcagg AAALEHDKAYDQQLKAG acaacgctcggggtcttgtgcttccgggtt DNPYLKYNHADAEFQQR acaaatacctcggacccggcaacggact LQGDTSFGGNLGRAVFQA cgacaagggggaacccgtcaacgcagc KKRVLEPLGLVEQAGETA ggacgcggcagccctcgagcacgacaa PGKKRPLIESPQQPDSSTGI ggcctacgaccagcagctcaaggccggt GKKGKQPAKKKLVFEDET gacaacccctacctcaagtacaaccacgc GAGDGPPEGSTSGAMSDD cgacgcggagttccagcagcggcttcag SEMASGGGAPMADNNEG ggcgacacatcgtttgggggcaacctcg ADGVGNASGNVVHCDSTW gcagagcagtcttccaggccaaaaagag LGDRVITTSTRTWALPTY ggttcttgaacctcttggtctggttgagcaa NNHLYKQISSASTGASND gcgggtgagacggctcctggaaagaag NHYFGYSTPWGYFDFNRF agaccgttgattgaatccccccagcagcc HCHFSPRDWQRLINNNVV cgactcctccacgggtatcggcaaaaaa GFRPKRLNFKLFNIQVKEV ggcaagcagccggctaaaaagaagctc TTNDGVTTIANNLTSTVQ gttttcgaagacgaaactggagcaggcg VFSDSEYQLPYVLGSAHQ acggaccccctgagggatcaacttccgg GCLPPFPADVFMIPQYGY agccatgtctgatgacagtgagatggcttc LTLNNGSQAVGRSSFYCL aggcggtggcgcaccaatggcagacaat EYFPSQMLRTGNNFTFSY aacgaaggcgccgacggagtgggtaat TFEDVPFHSSYAHSQSLDR gcctcaggaaattggcattgcgattccaca LMNPLIDQYLYYLNRTQN tggctgggcgacagagtcatcaccacca QSGSAQNKDLLFSRGSPA gcacccgaacatgggccttgcccacctat GMSVQPKNWLPGPCYRQ aacaaccacctctacaagcaaatctccagt QRVSKTKTDNNNSNFTWT gcttcaacgggggccagcaacgacaacc GASKYNLNGRESIINPGTA actacttcggctacagcaccccctggggg MASHKDDKDKFFPMSGV tattttgatttcaacagattccactgccatttc MIFGKESAGASNTALDNV tcaccacgtgactggcagcgactcatcaa MITDEEEIKATNPVATERF caacaattggggattccggcccaagaga GTVAVNLQSSSTDPATGD ctcaacttcaagctcttcaacatccaagtca VHVMGALPGMVWQDRD aggaggtcacgacgaatgatggcgtcac VYLQGPIWAKIPHTDGHF gaccatcgctaataaccttaccagcacgg HPSPLMGGFGLKHPPPQIL ttcaagtcttctcggactcggagtaccagtt IKNTPVPANPPAEFSATKF gccgtacgtcctcggctctgcgcaccagg ASFITQYSTGQVSVEIEWE gctgcctccctccgttcccggcggacgtg LQKENSKRWNPEVQYTSN ttcatgattccgcagtacggctacctaacg YAKSANVDFTVDNNGLY ctcaacaatggcagccaggcagtgggac TEPRPIGTRYLTRPL ggtcatccttttactgcctggaatatttccca tcgcagatgctgagaacgggcaataactt taccttcagctacaccttcgaggacgtgc ctttccacagcagctacgcgcacagccag agcctggaccggctgatgaatcctctcatc gaccagtacctgtattacctgaacagaact cagaatcagtccggaagtgcccaaaaca aggacttgctgtttagccgggggtctcca gctggcatgtctgttcagcccaaaaactg gctacctggaccctgttaccggcagcagc gcgtttctaaaacaaaaacagacaacaac aacagcaactttacctggactggtgcttca aaatataaccttaatgggcgtgaatctataa tcaaccctggcactgctatggcctcacac aaagacgacaaagacaagttctttcccat gagcggtgtcatgatttttggaaaggaga gcgccggagcttcaaacactgcattggac aatgtcatgatcacagacgaagaggaaat caaagccactaaccccgtggccaccgaa agatttgggactgtggcagtcaatctccag agcagcagcacagaccctgcgaccgga gatgtgcatgttatgggagccttacctgga atggtgtggcaagacagagacgtatacct gcagggtcctatagggccaaaattcctca cacggatggacactttcacccgtctcctct catgggcggctaggacttaagcacccgc ctcctcagatcctcatcaaaaacacgcctg ttcctgcgaatcctccggcagagtatcgg ctacaaagtagcttcattcatcacccagtat tccacaggacagtgagcgtggagattga atgggagctgcagaaagaaaacagcaaa cgctggaatcccgaagtgcagtatacatct aactatgcaaaatctgccaacgttgatttca ctgtggacaacaatggactttatactgagc ctcgccccattggcacccgttacctcaccc gtcccctgtaa Chimera 4 46 MSFVDHPPDWLEEVGEGL 53 atgtcttttgttgatcaccctccagattggtt rAAV5VP1/2- REFLGLEAGPPKPKPNQQ ggaagaagttggtgaaggtcttcgcgag AAV6VP3 HQDQARGLVLPGYNYLG tttagggccttgaagcgggcccaccgaa PGNGLDRGEPVNRADEVA accaaaacccaatcagcagcatcaagatc REHDISYNEQLEAGDNPY aagcccgtggtcttgtgctgcctggttata LKYNHADAEFQEKLADD actatctcggacccggaaacggtctcgat TSFGGNLGKAVFQAKKRV cgaggagagcctgtcaacagggcagac LEPFGLVEEGAKTAPTGK gaggtcgcgcgagagcacgacatctcgt RIDDHFPKRKKARTEEDS acaacgagcagcttgaggcgggagaca KPSTSSDAEAGPSGSQQL acccctacctcaagtacaaccacgcggac QIPAQPASSLGADTMASG gccgagtttcaggagaagctcgccgacg GGAPMADNNEGADGVGN acacatccttcgggggaaacctcggaaa ASGNWHCDSTWLGDRVI ggcagtctttcaggccaagaaaagggttc TTSTRTWALPTYNNHLYK tcgaaccttaggcctggttgaagagggtg QISSASTGASNDNHYFGYS ctaagacggcccctaccggaaagcggat TPWGYFDFNRFHCHFSPR agacgaccactaccaaaaagaaagaag DWQRLINNNVVGFRPKRL gctcggaccgaagaggactccaagcctt NFKLFNIQVKEVTTNDGV ccacctcgtcagacgccgaagctggacc TTIANNLTSTVQVFSDSEY cagcggatcccagcagctgcaaatccca QLPYVLGSAHQGCLPPFP gcccaaccagcctcaagtagggagctga ADVFMIPQYGYLTLNNGS tacaatggcttcaggcggtggcgcaccaa QAVGRSSFYCLEYFPSQM tggcagacaataacgaaggcgccgacg LRTGNNFTFSYTFEDVPFH gagtgggtaatgcctcaggaaattggcatt SSYAHSQSLDRLMNPLID gcgattccacatggctgggcgacagagt QYLYYLNRTQNQSGSAQ catcaccaccagcacccgaacatgggcc NKDLLFSRGSPAGMSVQP ttgcccacctataacaaccacctctacaag KNWLPGPCYRQQRVSKT caaatctccagtgcttcaacgggggccag KTDNNNSNFTWTGASKY caacgacaaccactacttcggctacagca NLNGRESIINPGTAMASHK ccccctgggggtattttgatacaacagatt DDKDKFFPMSGVMIFGKE ccactgccatttctcaccacgtgactggca SAGASNTALDNVMITDEE gcgactcatcaacaacaattggggattcc EIKATNPVATERFGTVAV ggcccaagagactcaacttcaagctcttc NLQSSSTDPATGDVHVMG aacatccaagtcaaggaggtcacgacga ALPGMVWQDRDVYLQGP atgatggcgtcacgaccatcgctaataac IWAKIPHTDGHFHPSPLM cttaccagcacggttcaagtcttctcggac GGFGLKHPPPQILIKNTPV tcggagtaccagttgccgtacgtcctcgg PANPPAEFSATKFASFITQ ctctgcgcaccagggctgcctccctccgtt YSTGQVSVEIEWELQKEN cccggcggacgtgttcatgattccgcagt SKRWNPEVQYTSNYAKS acggctacctaacgctcaacaatggcagc ANVDFTVDNNGLYTEPRP caggcagtgggacggtcatccttttactgc IGTRYLTRPL ctggaatatttcccatcgcagatgctgaga acgggcaataactttaccttcagctacacc ttcgaggacgtgcctttccacagcagctac gcgcacagccagagcctggaccggctg atgaatcctctcatcgaccagtacctgtatt acctgaacagaactcagaatcagtccgga agtgcccaaaacaaggacttgctgtttagc cgggggtctccagctggcatgtctgttca gcccaaaaactggctacctggaccctgtt accggcagcagcgcgtttctaaaacaaaa acagacaacaacaacagcaactttacctg gactggtgcttcaaaatataaccttaatgg gcgtgaatctataatcaaccctggcactgc tatggcctcacacaaagacgacaaagac aagttctttcccatgagcggtgtcatgatttt tggaaaggagagcgccggagcttcaaac actgcattggacaatgtcatgatcacagac gaagaggaaatcaaagccactaaccccg tggccaccgaaagatttgggactgtggca gtcaatctccagagcagcagcacagacc ctgcgaccggagatgtgcatgttatggga gccttacctggaatggtgtggcaagacag agacgtatacctgcagggtcctatttgggc caaaattcctcacacggatggacactttca cccgtctcctctcatgggcggctttggactt aagcacccgcctcctcagatcctcatcaa aaacacgcctgttcctgcgaatcctccgg cagagttttcggctacaaagtttgcttcattc atcacccagtattccacaggacaagtgag cgtggagattgaatgggagctgcagaaa gaaaacagcaaacgctggaatcccgaag tgcagtatacatctaactatgcaaaatctgc caacgttgatttcactgtggacaacaatgg actttatactgagcctcgccccattggcac ccgttacctcacccgtcccctgtaa Chimera 5 47 MAADGYLPDWLEDNLSE 54 atggctgctgacggttatcttccagattgg rAAV11VP1/2- GIREWWDLKPGAPKPKA ctcgaggacaacctctctgagggcattcg AAV6VP 3 NQQKQDDGRGLVLPGYK cgagtggtgggacctgaaacctggagcc YLGPFNGLDKGEPVNAAD ccgaagcccaaggccaaccagcagaag AAALEHDKAYDQQLKAG caggacgacggccggggtctggtgcttc DNPYLRYNHADAEFQERL ctggctacaagtacctcggacccttcaac QEDTSFGGNLGRAVFQAK ggactcgacaagggggagcccgtcaac KRVLEPLGLVEEGAKTAP gcggcggacgcagcggccctcgagcac GKKRPLESPQEPDSSSGIG gacaaggcctacgaccagcagctcaaag KKGKQPARKRLNFEEDTG cgggtgacaatccgtacctgcggtataac AGDGPPEGSDTSAMSSDIE cacgccgacgccgagtttcaggagcgtct MASGGGAPMADNNEGAD gcaagaagatacgtcttttgggggcaacc GVGNASGNVVHCDSTWLG tcgggcgagcagtcttccaggccaagaa DRVITTSTRTWALPTYNN gagggtactcgaacctctgggcctggttg HLYKQISSASTGASNDNH aagaaggtgctaaaacggctcctggaaa YFGYSTPWGYFDFNRFHC gaagagaccgttagagtcaccacaagag HFSPRDWQRLINNNWGFR cccgactcctcctcgggcatcggcaaaaa PKRLNFKLFNIQVKEVTTN aggcaaacaaccagccagaaagaggct DGVTTIANNLTSTVQVFS caactttgaagaggacactggagccgga DSEYQLPYVLGSAHQGCL gacggaccccctgaaggatcagatacca PPFPADVFMIPQYGYLTLN gcgccatgtcttcagacattgaaatggctt NGSQAVGRSSFYCLEYFP caggcggtggcgcaccaatggcagaca SQMLRTGNNFTFSYTFED ataacgaaggcgccgacggagtgggtaa VPFHSSYAHSQSLDRLMN tgcctcaggaaattggcattgcgattccac PLIDQYLYYLNRTQNQSG atggctgggcgacagagtcatcaccacc SAQNKDLLFSRGSPAGMS agcacccgaacatgggccttgcccaccta VQPKNVVLPGPCYRQQRV taacaaccacctctacaagcaaatctccag SKTKTDNNNSNFTWTGAS tgcttcaacgggggccagcaacgacaac KYNLNGRESIINPGTAMAS cactacttcggctacagcaccccctgggg HKDDKDKFFPMSGVMIFG gtattttgatacaacagattccactgccattt KESAGASNTALDNVMITD ctcaccacgtgactggcagcgactcatca EEEIKATNPVATERFGTVA acaacaattggggattccggcccaagag VNLQSSSTDPATGDVHVM actcaacttcaagctcttcaacatccaagtc GALPGMVWQDRDVYLQG aaggaggtcacgacgaatgatggcgtca PIWAKIPHTDGHFHPSPLM cgaccatcgctaataaccttaccagcacg GGFGLKHPPPQILIKNTPV gttcaagtcttctcggactcggagtaccag PANPPAEFSATKFASFITQ ttgccgtacgtcctcggctctgcgcacca YSTGQVSVEIEWELQKEN gggctgcctccctccgttcccggcggac SKRWNPEVQYTSNYAKS gtgttcatgattccgcagtacggctaccta ANVDFTVDNNGLYTEPRP acgctcaacaatggcagccaggcagtgg IGTRYLTRPL gacggtcatccttttactgcctggaatatac ccatcgcagatgctgagaacgggcaata actttaccttcagctacaccttcgaggacgt gcctaccacagcagctacgcgcacagcc agagcctggaccggctgatgaatcctctc atcgaccagtacctgtattacctgaacaga actcagaatcagtccggaagtgcccaaaa caaggacttgctgatagccgggggtctcc agctggcatgtctgttcagcccaaaaactg gctacctggaccctgttaccggcagcagc gcgtactaaaacaaaaacagacaacaac aacagcaactttacctggactggtgcttca aaatataaccttaatgggcgtgaatctataa tcaaccctggcactgctatggcctcacac aaagacgacaaagacaagttctacccat gagcggtgtcatgatttttggaaaggaga gcgccggagcttcaaacactgcattggac aatgtcatgatcacagacgaagaggaaat caaagccactaaccccgtggccaccgaa agatttgggactgtggcagtcaatctccag agcagcagcacagaccctgcgaccgga gatgtgcatgttatgggagccttacctgga atggtgtggcaagacagagacgtatacct gcagggtcctatagggccaaaattcctca cacggatggacactttcacccgtctcctct catgggcggctaggacttaagcacccgc ctcctcagatcctcatcaaaaacacgcctg ttcctgcgaatcctccggcagagtatcgg ctacaaagtagcttcattcatcacccagtat tccacaggacaagtgagcgtggagattg aatgggagctgcagaaagaaaacagcaa acgctggaatcccgaagtgcagtatacat ctaactatgcaaaatctgccaacgagata cactgtggacaacaatggactttatactga gcctcgccccattggcacccgttacctca cccgtcccctgtaa Chimera 6 48 MAADGYLPDWLEDNLSE 55 atggctgctgacggttatcttccagattgg AAV12VP1/2- GIREWWALKPGAPQPKA ctcgaggacaacctctctgaaggcattcg AAV6VP3 NQQHQDNGRGLVLPGYK cgagtggtgggcgctgaaacctggagct YLGPFNGLDKGEPVNEAD ccacaacccaaggccaaccaacagcatc AAALEHDKAYDKQLEQG aggacaacggcaggggtcttgtgcttcct DNPYLKYNHADAEFQQR gggtacaagtacctcggacccttcaacgg LATDTSFGGNLGRAVFQA actcgacaagggagagccggtcaagag KKRILEPLGLVEEGVKTAP gcagacgccgcggccctcgagcacgac GKKRPLEKTPNRPTNPDS aaggcctacgacaagcagctcgagcag GKAPAKKKQKDGEPADS ggggacaacccgtatctcaagtacaacca ARRTLDFEDSGAGDGPPE cgccgacgccgagttccagcagcgcttg GSSSGEMSHDAEMASGG gcgaccgacacctcttagggggcaacct GAPMADNNEGADGVGNA cgggcgagcagtcttccaggccaaaaag SGNWHCDSTWLGDRVITT aggattctcgagcctctgggtctggttgaa STRTWALPTYNNHLYKQI gagggcgttaaaacggctcctggaaaga SSASTGASNDNHYFGYST aacgcccattagaaaagactccaaatcgg PWGYFDFNRFHCHFSPRD ccgaccaacccggactctgggaaggccc WQRLINNNVVGFRPKRLNF cggccaagaaaaagcaaaaagacggcg KLFNIQVKEVTTNDGVTTI aaccagccgactctgctagaaggacactc ANNLTSTVQVFSDSEYQL gactttgaagactctggagcaggagacg PYVLGSAHQGCLPPFPAD gaccccctgagggatcatcttccggagaa VFMIPQYGYLTLNNGSQA atgtctcatgatgctgagatggcttcaggc VGRSSFYCLEYFPSQMLR ggtggcgcaccaatggcagacaataacg TGNNFTFSYTFEDVPFHSS aaggcgccgacggagtgggtaatgcctc YAHSQSLDRLMNPLIDQY aggaaattggcattgcgattccacatggct LYYLNRTQNQSGSAQNK gggcgacagagtcatcaccaccagcacc DLLFSRGSPAGMSVQPKN cgaacatgggccttgcccacctataacaa WLPGPCYRQQRVSKTKTD ccacctctacaagcaaatctccagtgcttc NNNSNFTWTGASKYNLN aacgggggccagcaacgacaaccacta GRESIINPGTAMASHKDD cttcggctacagcaccccctgggggtattt KDKFFPMSGVMIFGKESA tgatttcaacagattccactgccatttctcac GASNTALDNVMITDEEEI cacgtgactggcagcgactcatcaacaac KATNPVATERFGTVAVNL aattggggattccggcccaagagactcaa QSSSTDPATGDVHVMGAL cttcaagctcttcaacatccaagtcaagga PGMVWQDRDVYLQGPIW ggtcacgacgaatgatggcgtcacgacc AKIPHTDGHFHPSPLMGG atcgctaataaccttaccagcacggttcaa FGLKHPPPQILIKNTPVPA gtcttctcggactcggagtaccagttgccg NPPAEFSATKFASFITQYS tacgtcctcggctctgcgcaccagggctg TGQVSVEIEWELQKENSK cctccctccgttcccggcggacgtgttcat RWNPEVQYTSNYAKSAN gattccgcagtacggctacctaacgctca VDFTVDNNGLYTEPRPIGT acaatggcagccaggcagtgggacggtc RYLTRPL atccttttactgcctggaatatttcccatcgc agatgctgagaacgggcaataactttacct tcagctacaccttcgaggacgtgcctttcc acagcagctacgcgcacagccagagcct ggaccggctgatgaatcctctcatcgacc agtacctgtattacctgaacagaactcaga atcagtccggaagtgcccaaaacaagga cttgctgtttagccgggggtctccagctgg catgtctgttcagcccaaaaactggctacc tggaccctgttaccggcagcagcgcgttt ctaaaacaaaaacagacaacaacaacag caactttacctggactggtgcttcaaaatat aaccttaatgggcgtgaatctataatcaac cctggcactgctatggcctcacacaaaga cgacaaagacaagttctttcccatgagcg gtgtcatgatttttggaaaggagagcgcc ggagcttcaaacactgcattggacaatgtc atgatcacagacgaagaggaaatcaaag ccactaaccccgtggccaccgaaagattt gggactgtggcagtcaatctccagagca gcagcacagaccctgcgaccggagatgt gcatgttatgggagccttacctggaatggt gtggcaagacagagacgtatacctgcag ggtcctatttgggccaaaattcctcacacg gatggacactttcacccgtctcctctcatg ggcggctttggacttaagcacccgcctcc tcagatcctcatcaaaaacacgcctgttcct gcgaatcctccggcagagttttcggctac aaagtttgcttcattcatcacccagtattcca caggacaagtgagcgtggagattgaatg ggagctgcagaaagaaaacagcaaacg ctggaatcccgaagtgcagtatacatctaa ctatgcaaaatctgccaacgttgatttcact gtggacaacaatggactttatactgagcct cgccccattggcacccgttacctcacccg tcccctgtaa Chimera 7 49 MTDGYLPDWLEDNLSEG 56 atgactgacggttaccttccagattggcta AAV4VP1u- VREWWALQPGAPKPKAN gaggacaacctctctgaaggcgttcgaga AAV6VP2/3 QQHQDNARGLVLPGYKY gtggtgggcgctgcaacctggagcccct LGPGNGLDKGEPVNAAD aaacccaaggcaaatcaacaacatcagg AAALEHDKAYDQQLKAG acaacgctcggggtcttgtgcttccgggtt DNPYLKYNHADAEFQQR acaaatacctcggacccggcaacggact LQGDTSFGGNLGRAVFQA cgacaagggggaacccgtcaacgcagc KKRVLEPLGLVEQAGETA ggacgcggcagccctcgagcacgacaa PGKKRPVEQSPQEPDSSSG ggcctacgaccagcagctcaaggccggt IGKTGQQPAKKRLNFGQT gacaacccctacctcaagtacaaccacgc GDSESVPDPQPLGEPPATP cgacgcggagttccagcagcggcttcag AAVGPTTMASGGGAPMA ggcgacacatcgtttgggggcaacctcg DNNEGADGVGNASGNWH gcagagcagtcttccaggccaaaaagag CDSTWLGDRVITTSTRTW ggttcttgaacctcttggtctggttgagcaa ALPTYNNHLYKQISSASTG gcgggtgagacggctcctggaaagaaac ASNDNHYFGYSTPWGYF gtccggtagagcagtcgccacaagagcc DFNRFHCHFSPRDWQRLI agactcctcctcgggcattggcaagacag NNNWGFRPKRLNFKLFNI gccagcagcccgctaaaaagagactcaa QVKEVTTNDGVTTIANNL ttttggtcagactggcgactcagagtcagt TSTVQVFSDSEYQLPYVL ccccgacccacaacctctcggagaacctc GSAHQGCLPPFPADVFMIP cagcaacccccgctgctgtgggacctact QYGYLTLNNGSQAVGRSS acaatggcttcaggcggtggcgcaccaat FYCLEYFPSQMLRTGNNF ggcagacaataacgaaggcgccgacgg TFSYTFEDVPFHSSYAHSQ agtgggtaatgcctcaggaaattggcattg SLDRLMNPLIDQYLYYLN cgattccacatggctgggcgacagagtca RTQNQSGSAQNKDLLFSR tcaccaccagcacccgaacatgggccttg GSPAGMSVQPKNWLPGP cccacctataacaaccacctctacaagca CYRQQRVSKTKTDNNNS aatctccagtgcttcaacgggggccagca NFTWTGASKYNLNGRESII acgacaaccactacttcggctacagcacc NPGTAMASHKDDKDKFFP ccctgggggtattttgatttcaacagattcc MSGVMIFGKESAGASNTA actgccatttctcaccacgtgactggcagc LDNVMITDEEEIKATNPV gactcatcaacaacaattggggattccgg ATERFGTVAVNLQSSSTD cccaagagactcaacttcaagctcttcaac PATGDVHVMGALPGMV atccaagtcaaggaggtcacgacgaatg WQDRDVYLQGPIWAKIPH atggcgtcacgaccatcgctaataacctta TDGHFHPSPLMGGFGLKH ccagcacggttcaagtcttctcggactcg PPPQILIKNTPVPANPPAEF gagtaccagttgccgtacgtcctcggctct SATKFASFITQYSTGQVSV gcgcaccagggctgcctccctccgttccc EIEWELQKENSKRWNPEV ggcggacgtgttcatgattccgcagtacg QYTSNYAKSANVDFTVD gctacctaacgctcaacaatggcagccag NNGLYTEPRPIGTRYLTRP gcagtgggacggtcatccttttactgcctg L gaatatttcccatcgcagatgctgagaacg ggcaataactttaccttcagctacaccttcg aggacgtgcctttccacagcagctacgcg cacagccagagcctggaccggctgatga atcctctcatcgaccagtacctgtattacct gaacagaactcagaatcagtccggaagt gcccaaaacaaggacttgctgtttagccg ggggtctccagctggcatgtctgttcagcc caaaaactggctacctggaccctgttacc ggcagcagcgcgtttctaaaacaaaaaca gacaacaacaacagcaactttacctggac tggtgcttcaaaatataaccttaatgggcgt gaatctataatcaaccctggcactgctatg gcctcacacaaagacgacaaagacaagt tctttcccatgagcggtgtcatgatttttgga aaggagagcgccggagcttcaaacactg cattggacaatgtcatgatcacagacgaa gaggaaatcaaagccactaaccccgtgg ccaccgaaagatttgggactgtggcagtc aatctccagagcagcagcacagaccctg cgaccggagatgtgcatgttatgggagcc ttacctggaatggtgtggcaagacagaga cgtatacctgcagggtcctatttgggccaa aattcctcacacggatggacactttcaccc gtctcctctcatgggcggctttggacttaa gcacccgcctcctcagatcctcatcaaaa acacgcctgttcctgcgaatcctccggca gagttttcggctacaaagtttgcttcattcat cacccagtattccacaggacaagtgagc gtggagattgaatgggagctgcagaaag aaaacagcaaacgctggaatcccgaagt gcagtatacatctaactatgcaaaatctgc caacgttgatttcactgtggacaacaatgg actttatactgagcctcgccccattggcac ccgttacctcacccgtc Chimera 8 50 MAADGYLPDWLEDNLSE 57 atggctgctgacggttatcttccagattgg AAV12VP1u- GIREWWALKPGAPQPKA ctcgaggacaacctctctgaaggcattcg AAV6VP2/3 NQQHQDNGRGLVLPGYK cgagtggtgggcgctgaaacctggagct YLGPFNGLDKGEPVNEAD ccacaacccaaggccaaccaacagcatc AAALEHDKAYDKQLEQG aggacaacggcaggggtcttgtgcttcct DNPYLKYNHADAEFQQR gggtacaagtacctcggacccttcaacgg LATDTSFGGNLGRAVFQA actcgacaagggagagccggtcaacga KKRILEPLGLVEEGVKTAP ggcagacgccgcggccctcgagcacga GKKRPVEQSPQEPDSSSGI caaggcctacgacaagcagctcgagcag GKTGQQPAKKRLNFGQT ggggacaacccgtatctcaagtacaacca GDSESVPDPQPLGEPPATP cgccgacgccgagttccagcagcgcttg AAVGPTTMASGGGAPMA gcgaccgacacctcttttgggggcaacct DNNEGADGVGNASGNWH cgggcgagcagtcttccaggccaaaaag CDSTWLGDRVITTSTRTW aggattctcgagcctctgggtctggttgaa ALPTYNNHLYKQISSASTG gagggcgttaaaacggctcctggaaaga ASNDNHYFGYSTPWGYF aacgtccggtagagcagtcgccacaaga DFNRFHCHFSPRDWQRLI gccagactcctcctcgggcattggcaaga NNNWGFRPKRLNFKLFNI caggccagcagcccgctaaaaagagact QVKEVTTNDGVTTIANNL caattttggtcagactggcgactcagagtc TSTVQVFSDSEYQLPYVL agtccccgacccacaacctctcggagaa GSAHQGCLPPFPADVFMIP cctccagcaacccccgctgctgtgggac QYGYLTLNNGSQAVGRSS ctactacaatggcttcaggcggtggcgca FYCLEYFPSQMLRTGNNF ccaatggcagacaataacgaaggcgccg TFSYTFEDVPFHSSYAHSQ acggagtgggtaatgcctcaggaaattgg SLDRLMNPLIDQYLYYLN cattgcgattccacatggctgggcgacag RTQNQSGSAQNKDLLFSR agtcatcaccaccagcacccgaacatgg GSPAGMSVQPKNWLPGP gccttgcccacctataacaaccacctctac CYRQQRVSKTKTDNNNS aagcaaatctccagtgcttcaacgggggc NFTWTGASKYNLNGRESII cagcaacgacaaccactacttcggctaca NPGTAMASHK gcaccccctgggggtattttgatttcaaca DDKDKFFPMSGVMIFGKE gattccactgccatttctcaccacgtgactg SAGASNTALDNVMITDEE gcagcgactcatcaacaacaattggggat EIKATNPVATERFGTVAV tccggcccaagagactcaacttcaagctc NLQSSSTDPATGDVHVMG ttcaacatccaagtcaaggaggtcacgac ALPGMVWQDRDVYLQGP gaatgatggcgtcacgaccatcgctaata IWAKIPHTDGHFHPSPLM accttaccagcacggttcaagtcttctcgg GGFGLKHPPPQILIKNTPV actcggagtaccagttgccgtacgtcctc PANPPAEFSATKFASFITQ ggctctgcgcaccagggctgcctccctcc YSTGQVSVEIEWELQKEN gttcccggcggacgtgttcatgattccgca SKRWNPEVQYTSNYAKS gtacggctacctaacgctcaacaatggca ANVDFTVDNNGLYTEPRP gccaggcagtgggacggtcatccttttact IGTRYLTRPL gcctggaatatttcccatcgcagatgctga gaacgggcaataactttaccttcagctaca ccttcgaggacgtgcctaccacagcagct acgcgcacagccagagcctggaccggc tgatgaatcctctcatcgaccagtacctgta ttacctgaacagaactcagaatcagtccg gaagtgcccaaaacaaggacttgctgttta gccgggggtctccagctggcatgtctgtt cagcccaaaaactggctacctggaccctg ttaccggcagcagcgcgtttctaaaacaa aaacagacaacaacaacagcaactttacc tggactggtgcttcaaaatataaccttaatg ggcgtgaatctataatcaaccctggcactg ctatggcctcacacaaagacgacaaaga caagttctacccatgagcggtgtcatgatt tttggaaaggagagcgccggagcttcaa acactgcattggacaatgtcatgatcacag acgaagaggaaatcaaagccactaaccc cgtggccaccgaaagatagggactgtgg cagtcaatctccagagcagcagcacaga ccctgcgaccggagatgtgcatgttatgg gagccttacctggaatggtgtggcaagac agagacgtatacctgcagggtcctatagg gccaaaattcctcacacggatggacacttt cacccgtctcctctcatgggcggctagga cttaagcacccgcctcctcagatcctcatc aaaaacacgcctgttcctgcgaatcctcc ggcagagttttcggctacaaagtagcttca ttcatcacccagtattccacaggacaagtg agcgtggagattgaatgggagctgcaga aagaaaacagcaaacgctggaatcccga agtgcagtatacatctaactatgcaaaatct gccaacgttgatttcactgtggacaacaat ggactttatactgagcctcgccccattggc acccgttacctcacccgtcccctgtaa Chimera 7b 58 ggtaccaaaacaaatgttctcgtcacgtgg AAV4VP1u- gcatgaatctgatgctgtttccctgcagac AAV6VP2/3 aatgcgagagaatgaatcagaattcaaat atctgcttcactcacggacagaaagactgt ttagagtgctttcccgtgtcagaatctcaac ccgtttctgtcgtcaaaaaggcgtatcaga aactgtgctacattcatcatatcatgggaaa ggtgccagacgcttgcactgcctgcgatc tggtcaatgtggatttggatgactgcatcttt gaacaataaatgatttaaatcaggtatgact gacggttaccttccagattggctagagga caacctctctgaaggcgttcgagagtggt gggcgctgcaacctggagcccctaaacc caaggcaaatcaacaacatcaggacaac gctcggggtcttgtgcttccgggttacaaa tacctcggacccggcaacggactcgaca agggggaacccgtcaacgcagcggacg cggcagccctcgagcacgacaaggccta cgaccagcagctcaaggccggtgacaac ccctacctcaagtacaaccacgccgacgc ggagttccagcagcggcttcagggcgac acatcgtttgggggcaacctcggcagag cagtcttccaggccaaaaagagggttctt gaacctcttggtctggttgagcaagcggg tgagacggctcctggaaagaaacgtccg gtagagcagtcgccacaagagccagact cctcctcgggcattggcaagacaggcca gcagcccgctaaaaagagactcaattttg gtcagactggcgactcagagtcagtcccc gacccacaacctctcggagaacctccag caacccccgctgctgtgggacctactaca atggcttcaggcggtggcgcaccaatgg cagacaataacgaaggcgccgacggag tgggtaatgcctcaggaaattggcattgcg attccacatggctgggcgacagagtcatc accaccagcacccgaacatgggccttgc ccacctataacaaccacctctacaagcaa atctccagtgcttcaacgggggccagcaa cgacaaccactacttcggctacagcaccc cctgggggtattttgatttcaacagattcca ctgccatttctcaccacgtgactggcagcg actcatcaacaacaattggggattccggc ccaagagactcaacttcaagctcttcaaca tccaagtcaaggaggtcacgacgaatgat ggcgtcacgaccatcgctaataaccttac cagcacggttcaagtcttctcggactcgg agtaccagttgccgtacgtcctcggctctg cgcaccagggctgcctccctccgttcccg gcggacgtgttcatgattccgcagtacgg ctacctaacgctcaacaatggcagccagg cagtgggacggtcatccttttactgcctgg aatatttcccatcgcagatgctgagaacgg gcaataactttaccttcagctacaccttcga ggacgtgcctttccacagcagctacgcgc acagccagagcctggaccggctgatgaa tcctctcatcgaccagtacctgtattacctg aacagaactcagaatcagtccggaagtg cccaaaacaaggacttgctgtttagccgg gggtctccagctggcatgtctgttcagccc aaaaactggctacctggaccctgttaccg gcagcagcgcgtttctaaaacaaaaacag acaacaacaacagcaactttacctggact ggtgcttcaaaatataaccttaatgggcgt gaatctataatcaaccctggcactgctatg gcctcacacaaagacgacaaagacaagt tctttcccatgagcggtgtcatgatttttgga aaggagagcgccggagcttcaaacactg cattggacaatgtcatgatcacagacgaa gaggaaatcaaagccactaaccccgtgg ccaccgaaagatttgggactgtggcagtc aatctccagagcagcagcacagaccctg cgaccggagatgtgcatgttatgggagcc ttacctggaatggtgtggcaagacagaga cgtatacctgcagggtcctatttgggccaa aattcctcacacggatggacactttcaccc gtctcctctcatgggcggctttggacttaa gcacccgcctcctcagatcctcatcaaaa acacgcctgttcctgcgaatcctccggca gagttttcggctacaaagtttgcttcattcat cacccagtattccacaggacaagtgagc gtggagattgaatgggagctgcagaaag aaaacagcaaacgctggaatcccgaagt gcagtatacatctaactatgcaaaatctgc caacgttgatttcactgtggacaacaatgg actttatactgagcctcgccccattggcac ccgttacctcacccgtcccctgtaattgtgt gttaatcaataaaccggt Chimera 2b 59 ggtaccaaaacaaatgttctcgtcacgtgg AAV5VP1u- gcatgaatctgatgctgtttccctgcagac AAV6VP2/3 aatgcgagagaatgaatcagaattcaaat atctgcttcactcacggacagaaagactgt ttagagtgctttcccgtgtcagaatctcaac ccgtttctgtcgtcaaaaaggcgtatcaga aactgtgctacattcatcatatcatgggaaa ggtgccagacgcttgcactgcctgcgatc tggtcaatgtggatttggatgactgcatcttt gaacaataaatgatttaaatcaggtatgtct tttgttgatcaccctccagattggttggaag aagttggtgaaggtcttcgcgagtttttgg gccttgaagcgggcccaccgaaaccaaa acccaatcagcagcatcaagatcaagccc gtggtcttgtgctgcctggttataactatctc ggacccggaaacggtctcgatcgaggag agcctgtcaacagggcagacgaggtcgc gcgagagcacgacatctcgtacaacgag cagcttgaggcgggagacaacccctacc tcaagtacaaccacgcggacgccgagttt caggagaagctcgccgacgacacatcct tcgggggaaacctcggaaaggcagtcttt caggccaagaaaagggttctcgaacctttt ggcctggttgaagagggtgctaagacgg ctcctggaaagaaacgtccggtagagca gtcgccacaagagccagactcctcctcg ggcattggcaagacaggccagcagccc gctaaaaagagactcaattttggtcagact ggcgactcagagtcagtccccgacccac aacctctcggagaacctccagcaaccccc gctgctgtgggacctactacaatggcttca ggcggtggcgcaccaatggcagacaata acgaaggcgccgacggagtgggtaatg cctcaggaaattggcattgcgattccacat ggctgggcgacagagtcatcaccaccag cacccgaacatgggccttgcccacctata acaaccacctctacaagcaaatctccagt gcttcaacgggggccagcaacgacaacc actacttcggctacagcaccccctggggg tattttgatttcaacagattccactgccatttc tcaccacgtgactggcagcgactcatcaa caacaattggggattccggcccaagaga ctcaacttcaagctcttcaacatccaagtca aggaggtcacgacgaatgatggcgtcac gaccatcgctaataaccttaccagcacgg ttcaagtcttctcggactcggagtaccagtt gccgtacgtcctcggctctgcgcaccagg gctgcctccctccgttcccggcggacgtg ttcatgattccgcagtacggctacctaacg ctcaacaatggcagccaggcagtgggac ggtcatccttttactgcctggaatatttccca tcgcagatgctgagaacgggcaataactt taccttcagctacaccttcgaggacgtgcc tttccacagcagctacgcgcacagccaga gcctggaccggctgatgaatcctctcatc gaccagtacctgtattacctgaacagaact cagaatcagtccggaagtgcccaaaaca aggacttgctgtttagccgggggtctcca gctggcatgtctgttcagcccaaaaactg gctacctggaccctgttaccggcagcagc gcgtttctaaaacaaaaacagacaacaac aacagcaactttacctggactggtgcttca aaatataaccttaatgggcgtgaatctataa tcaaccctggcactgctatggcctcacac aaagacgacaaagacaagactacccat gagcggtgtcatgatttttggaaaggaga gcgccggagcttcaaacactgcattggac aatgtcatgatcacagacgaagaggaaat caaagccactaaccccgtggccaccgaa agatttgggactgtggcagtcaatctccag agcagcagcacagaccctgcgaccgga gatgtgcatgttatgggagccttacctgga atggtgtggcaagacagagacgtatacct gcagggtcctatagggccaaaattcctca cacggatggacactttcacccgtctcctct catgggcggctttggacttaagcacccgc ctcctcagatcctcatcaaaaacacgcctg ttcctgcgaatcctccggcagagtatcgg ctacaaagtagcttcattcatcacccagtat tccacaggacaagtgagcgtggagattg aatgggagctgcagaaagaaaacagcaa acgctggaatcccgaagtgcagtatacat ctaactatgcaaaatctgccaacgagata cactgtggacaacaatggactttatactga gcctcgccccattggcacccgttacctca cccgtcccctgtaattgtgtgaaatcaata aaccggt AAV11VP1u- 60 ggtaccaaaacaaatgactcgtcacgtgg AAV6VP2/3 gcatgaatctgatgctgtaccctgcagac aatgcgagagaatgaatcagaattcaaat atctgcttcactcacggacagaaagactgt ttagagtgctacccgtgtcagaatctcaac ccgtactgtcgtcaaaaaggcgtatcaga aactgtgctacattcatcatatcatgggaaa ggtgccagacgcttgcactgcctgcgatc tggtcaatgtggataggatgactgcatcta gaacaataaatgatttaaatcaggtatggc tgctgacggttatcttccagattggctcga ggacaacctctctgagggcattcgcgagt ggtgggacctgaaacctggagccccgaa gcccaaggccaaccagcagaagcagga cgacggccggggtctggtgcttcctggct acaagtacctcggacccttcaacggactc gacaagggggagcccgtcaacgcggcg gacgcagcggccctcgagcacgacaag gcctacgaccagcagctcaaagcgggtg acaatccgtacctgcggtataaccacgcc gacgccgagtttcaggagcgtctgcaag aagatacgtcttagggggcaacctcggg cgagcagtcttccaggccaagaagaggg tactcgaacctctgggcctggttgaagaa ggtgctaaaacggctcctggaaagaaac gtccggtagagcagtcgccacaagagcc agactcctcctcgggcattggcaagacag gccagcagcccgctaaaaagagactcaa ttttggtcagactggcgactcagagtcagt ccccgacccacaacctctcggagaacctc cagcaacccccgctgctgtgggacctact acaatggcttcaggcggtggcgcaccaat ggcagacaataacgaaggcgccgacgg agtgggtaatgcctcaggaaattggcattg cgattccacatggctgggcgacagagtca tcaccaccagcacccgaacatgggccttg cccacctataacaaccacctctacaagca aatctccagtgcttcaacgggggccagca acgacaaccactacttcggctacagcacc ccctgggggtattttgatttcaacagattcc actgccatttctcaccacgtgactggcagc gactcatcaacaacaattggggattccgg cccaagagactcaacttcaagctcttcaac atccaagtcaaggaggtcacgacgaatg atggcgtcacgaccatcgctaataacctta ccagcacggttcaagtcttctcggactcg gagtaccagttgccgtacgtcctcggctct gcgcaccagggctgcctccctccgttccc ggcggacgtgttcatgattccgcagtacg gctacctaacgctcaacaatggcagccag gcagtgggacggtcatccttttactgcctg gaatatttcccatcgcagatgctgagaacg ggcaataactttaccttcagctacaccttcg aggacgtgcctttccacagcagctacgcg cacagccagagcctggaccggctgatga atcctctcatcgaccagtacctgtattacct gaacagaactcagaatcagtccggaagt gcccaaaacaaggacttgctgtttagccg ggggtctccagctggcatgtctgttcagcc caaaaactggctacctggaccctgttacc ggcagcagcgcgtttctaaaacaaaaaca gacaacaacaacagcaactttacctggac tggtgcttcaaaatataaccttaatgggcgt gaatctataatcaaccctggcactgctatg gcctcacacaaagacgacaaagacaagt tctttcccatgagcggtgtcatgatttttgga aaggagagcgccggagcttcaaacactg cattggacaatgtcatgatcacagacgaa gaggaaatcaaagccactaaccccgtgg ccaccgaaagatttgggactgtggcagtc aatctccagagcagcagcacagaccctg cgaccggagatgtgcatgttatgggagcc ttacctggaatggtgtggcaagacagaga cgtatacctgcagggtcctatttgggccaa aattcctcacacggatggacactttcaccc gtctcctctcatgggcggctttggacttaa gcacccgcctcctcagatcctcatcaaaa acacgcctgttcctgcgaatcctccggca gagttttcggctacaaagtttgcttcattcat cacccagtattccacaggacaagtgagc gtggagattgaatgggagctgcagaaag aaaacagcaaacgctggaatcccgaagt gcagtatacatctaactatgcaaaatctgc caacgttgatttcactgtggacaacaatgg actttatactgagcctcgccccattggcac ccgttacctcacccgtcccctgtaattgtgt gttaatcaataaaccggt Chimera 8b 61 ggtaccaaaacaaatgttctcgtcacgtgg AAV12VP1u- gcatgaatctgatgctgtttccctgcagac AAV6VP2/3 aatgcgagagaatgaatcagaattcaaat atctgcttcactcacggacagaaagactgt ttagagtgctttcccgtgtcagaatctcaac ccgtttctgtcgtcaaaaaggcgtatcaga aactgtgctacattcatcatatcatgggaaa ggtgccagacgcttgcactgcctgcgatc tggtcaatgtggatttggatgactgcatcttt gaacaataaatgatttaaatcaggtatggc tgctgacggttatcttccagattggctcga ggacaacctctctgaaggcattcgcgagt ggtgggcgctgaaacctggagctccaca acccaaggccaaccaacagcatcaggac aacggcaggggtcttgtgcttcctgggta caagtacctcggacccttcaacggactcg acaagggagagccggtcaacgaggcag acgccgcggccctcgagcacgacaagg cctacgacaagcagctcgagcaggggg acaacccgtatctcaagtacaaccacgcc gacgccgagttccagcagcgcttggcga ccgacacctcttttgggggcaacctcggg cgagcagtcttccaggccaaaaagagga ttctcgagcctctgggtctggttgaagagg gcgttaaaacggctcctggaaagaaacgt ccggtagagcagtcgccacaagagcca gactcctcctcgggcattggcaagacagg ccagcagcccgctaaaaagagactcaatt ttggtcagactggcgactcagagtcagtc cccgacccacaacctctcggagaacctcc agcaacccccgctgctgtgggacctacta caatggcttcaggcggtggcgcaccaat ggcagacaataacgaaggcgccgacgg agtgggtaatgcctcaggaaattggcattg cgattccacatggctgggcgacagagtca tcaccaccagcacccgaacatgggccttg cccacctataacaaccacctctacaagca aatctccagtgcttcaacgggggccagca acgacaaccactacttcggctacagcacc ccctgggggtattttgatttcaacagattcc actgccatttctcaccacgtgactggcagc gactcatcaacaacaattggggattccgg cccaagagactcaacttcaagctcttcaac atccaagtcaaggaggtcacgacgaatg atggcgtcacgaccatcgctaataacctta ccagcacggttcaagtcttctcggactcg gagtaccagttgccgtacgtcctcggctct gcgcaccagggctgcctccctccgttccc ggcggacgtgttcatgattccgcagtacg gctacctaacgctcaacaatggcagccag gcagtgggacggtcatccttttactgcctg gaatatttcccatcgcagatgctgagaacg ggcaataactttaccttcagctacaccttcg aggacgtgcctttccacagcagctacgcg cacagccagagcctggaccggctgatga atcctctcatcgaccagtacctgtattacct gaacagaactcagaatcagtccggaagt gcccaaaacaaggacttgctgtttagccg ggggtctccagctggcatgtctgttcagcc caaaaactggctacctggaccctgttacc ggcagcagcgcgtttctaaaacaaaaaca gacaacaacaacagcaactttacctggac tggtgcttcaaaatataaccttaatgggcgt gaatctataatcaaccctggcactgctatg gcctcacacaaagacgacaaagacaagt tctttcccatgagcggtgtcatgatttttgga aaggagagcgccggagcttcaaacactg cattggacaatgtcatgatcacagacgaa gaggaaatcaaagccactaaccccgtgg ccaccgaaagatttgggactgtggcagtc aatctccagagcagcagcacagaccctg cgaccggagatgtgcatgttatgggagcc ttacctggaatggtgtggcaagacagaga cgtatacctgcagggtcctatttgggccaa aattcctcacacggatggacactttcaccc gtctcctctcatgggcggctttggacttaa gcacccgcctcctcagatcctcatcaaaa acacgcctgttcctgcgaatcctccggca gagttttcggctacaaagtttgcttcattcat cacccagtattccacaggacaagtgagc gtggagattgaatgggagctgcagaaag aaaacagcaaacgctggaatcccgaagt gcagtatacatctaactatgcaaaatctgc caacgttgatttcactgtggacaacaatgg actttatactgagcctcgccccattggcac ccgttacctcacccgtcccctgtaattgtgt gttaatcaataaaccggt Chimera 3b 62 ggtaccaaaacaaatgttctcgtcacgtgg AAV4VP1/2- gcatgaatctgatgctgtttccctgcagac AAV6VP3 aatgcgagagaatgaatcagaattcaaat atctgcttcactcacggacagaaagactgt ttagagtgctttcccgtgtcagaatctcaac ccgtttctgtcgtcaaaaaggcgtatcaga aactgtgctacattcatcatatcatgggaaa ggtgccagacgcttgcactgcctgcgatc tggtcaatgtggatttggatgactgcatcttt gaacaataaatgatttaaatcaggtatgact gacggttaccttccagattggctagagga caacctctctgaaggcgttcgagagtggt gggcgctgcaacctggagcccctaaacc caaggcaaatcaacaacatcaggacaac gctcggggtcttgtgcttccgggttacaaa tacctcggacccggcaacggactcgaca agggggaacccgtcaacgcagcggacg cggcagccctcgagcacgacaaggccta cgaccagcagctcaaggccggtgacaac ccctacctcaagtacaaccacgccgacgc ggagttccagcagcggcttcagggcgac acatcgtttgggggcaacctcggcagag cagtcttccaggccaaaaagagggttctt gaacctcttggtctggttgagcaagcggg tgagacggctcctggaaagaagagaccg ttgattgaatccccccagcagcccgactc ctccacgggtatcggcaaaaaaggcaag cagccggctaaaaagaagctcgttttcga agacgaaactggagcaggcgacggacc ccctgagggatcaacttccggagccatgt ctgatgacagtgagatggcttcaggcggt ggcgcaccaatggcagacaataacgaag gcgccgacggagtgggtaatgcctcagg aaattggcattgcgattccacatggctggg cgacagagtcatcaccaccagcacccga acatgggccttgcccacctataacaacca cctctacaagcaaatctccagtgcttcaac gggggccagcaacgacaaccactacttc ggctacagcaccccctgggggtattttgat ttcaacagattccactgccatttctcaccac gtgactggcagcgactcatcaacaacaat tggggattccggcccaagagactcaactt caagctcttcaacatccaagtcaaggagg tcacgacgaatgatggcgtcacgaccatc gctaataaccttaccagcacggttcaagtc ttctcggactcggagtaccagttgccgtac gtcctcggctctgcgcaccagggctgcct ccctccgttcccggcggacgtgttcatgat tccgcagtacggctacctaacgctcaaca atggcagccaggcagtgggacggtcatc cttttactgcctggaatatttcccatcgcag atgctgagaacgggcaataactttaccttc agctacaccttcgaggacgtgcctttccac agcagctacgcgcacagccagagcctg gaccggctgatgaatcctctcatcgacca gtacctgtattacctgaacagaactcagaa tcagtccggaagtgcccaaaacaaggac ttgctgtttagccgggggtctccagctggc atgtctgttcagcccaaaaactggctacct ggaccctgttaccggcagcagcgcgtttc taaaacaaaaacagacaacaacaacagc aactttacctggactggtgcttcaaaatata accttaatgggcgtgaatctataatcaacc ctggcactgctatggcctcacacaaagac gacaaagacaagttctttcccatgagcggt gtcatgatttttggaaaggagagcgccgg agcttcaaacactgcattggacaatgtcat gatcacagacgaagaggaaatcaaagcc actaaccccgtggccaccgaaagatttgg gactgtggcagtcaatctccagagcagca gcacagaccctgcgaccggagatgtgca tgttatgggagccttacctggaatggtgtg gcaagacagagacgtatacctgcagggt cctatttgggccaaaattcctcacacggat ggacactttcacccgtctcctctcatgggc ggctaggacttaagcacccgcctcctcag atcctcatcaaaaacacgcctgttcctgcg aatcctccggcagagttttcggctacaaag tttgcttcattcatcacccagtattccacag gacaagtgagcgtggagattgaatggga gctgcagaaagaaaacagcaaacgctgg aatcccgaagtgcagtatacatctaactat gcaaaatctgccaacgttgatttcactgtg gacaacaatggactttatactgagcctcgc cccattggcacccgttacctcacccgtccc ctgtaattgtgtgttaatcaataaaccggt Chimera 4b 63 ggtaccaaaacaaatgttctcgtcacgtgg AAV5VP1_2- gcatgaatctgatgctgtttccctgcagac AAV6VP3 aatgcgagagaatgaatcagaattcaaat atctgcttcactcacggacagaaagactgt ttagagtgctttcccgtgtcagaatctcaac ccgtttctgtcgtcaaaaaggcgtatcaga aactgtgctacattcatcatatcatgggaaa ggtgccagacgcttgcactgcctgcgatc tggtcaatgtggatttggatgactgcatcttt gaacaataaatgatttaaatcaggtatgtct tttgttgatcaccctccagattggttggaag aagttggtgaaggtcttcgcgagtttttgg gccttgaagcgggcccaccgaaaccaaa acccaatcagcagcatcaagatcaagccc gtggtcttgtgctgcctggttataactatctc ggacccggaaacggtctcgatcgaggag agcctgtcaacagggcagacgaggtcgc gcgagagcacgacatctcgtacaacgag cagcttgaggcgggagacaacccctacc tcaagtacaaccacgcggacgccgagttt caggagaagctcgccgacgacacatcct tcgggggaaacctcggaaaggcagtcttt caggccaagaaaagggttctcgaacctttt ggcctggttgaagagggtgctaagacgg cccctaccggaaagcggatagacgacca ctttccaaaaagaaagaaggctcggacc gaagaggactccaagccttccacctcgtc agacgccgaagctggacccagcggatc ccagcagctgcaaatcccagcccaacca gcctcaagtttgggagctgatacaatggct tcaggcggtggcgcaccaatggcagaca ataacgaaggcgccgacggagtgggtaa tgcctcaggaaattggcattgcgattccac atggctgggcgacagagtcatcaccacc agcacccgaacatgggccttgcccaccta taacaaccacctctacaagcaaatctccag tgcttcaacgggggccagcaacgacaac cactacttcggctacagcaccccctgggg gtattttgatttcaacagattccactgccattt ctcaccacgtgactggcagcgactcatca acaacaattggggattccggcccaagag actcaacttcaagctcttcaacatccaagtc aaggaggtcacgacgaatgatggcgtca cgaccatcgctaataaccttaccagcacg gttcaagtcttctcggactcggagtaccag ttgccgtacgtcctcggctctgcgcacca gggctgcctccctccgttcccggcggac gtgttcatgattccgcagtacggctaccta acgctcaacaatggcagccaggcagtgg gacggtcatccttttactgcctggaatatttc ccatcgcagatgctgagaacgggcaata actttaccttcagctacaccttcgaggacgt gcctttccacagcagctacgcgcacagcc agagcctggaccggctgatgaatcctctc atcgaccagtacctgtattacctgaacaga actcagaatcagtccggaagtgcccaaaa caaggacttgctgtttagccgggggtctcc agctggcatgtctgttcagcccaaaaactg gctacctggaccctgttaccggcagcagc gcgtttctaaaacaaaaacagacaacaac aacagcaactttacctggactggtgcttca aaatataaccttaatgggcgtgaatctataa tcaaccctggcactgctatggcctcacac aaagacgacaaagacaagttctttcccat gagcggtgtcatgatttttggaaaggaga gcgccggagcttcaaacactgcattggac aatgtcatgatcacagacgaagaggaaat caaagccactaaccccgtggccaccgaa agatttgggactgtggcagtcaatctccag agcagcagcacagaccctgcgaccgga gatgtgcatgttatgggagccttacctgga atggtgtggcaagacagagacgtatacct gcagggtcctatagggccaaaattcctca cacggatggacactttcacccgtctcctct catgggcggctaggacttaagcacccgc ctcctcagatcctcatcaaaaacacgcctg ttcctgcgaatcctccggcagagtatcgg ctacaaagtagcttcattcatcacccagtat tccacaggacaagtgagcgtggagattg aatgggagctgcagaaagaaaacagcaa acgctggaatcccgaagtgcagtatacat ctaactatgcaaaatctgccaacgagata cactgtggacaacaatggactttatactga gcctcgccccattggcacccgttacctca cccgtcccctgtaattgtgtgaaatcaata aaccggt Chimera 5b 64 ggtaccaaaacaaatgttctcgtcacgtgg AAV11VP1/2- gcatgaatctgatgctgtaccctgcagac AAV6VP3 aatgcgagagaatgaatcagaattcaaat atctgcttcactcacggacagaaagactgt ttagagtgctacccgtgtcagaatctcaac ccgtactgtcgtcaaaaaggcgtatcaga aactgtgctacattcatcatatcatgggaaa ggtgccagacgcttgcactgcctgcgatc tggtcaatgtggataggatgactgcatcta gaacaataaatgatttaaatcaggtatggc tgctgacggttatcttccagattggctcga ggacaacctctctgagggcattcgcgagt ggtgggacctgaaacctggagccccgaa gcccaaggccaaccagcagaagcagga cgacggccggggtctggtgcttcctggct acaagtacctcggacccttcaacggactc gacaagggggagcccgtcaacgcggcg gacgcagcggccctcgagcacgacaag gcctacgaccagcagctcaaagcgggtg acaatccgtacctgcggtataaccacgcc gacgccgagtttcaggagcgtctgcaag aagatacgtcttagggggcaacctcggg cgagcagtcttccaggccaagaagaggg tactcgaacctctgggcctggttgaagaa ggtgctaaaacggctcctggaaagaaga gaccgttagagtcaccacaagagcccga ctcctcctcgggcatcggcaaaaaaggc aaacaaccagccagaaagaggctcaact ttgaagaggacactggagccggagacg gaccccctgaaggatcagataccagcgc catgtcttcagacattgaaatggcttcagg cggtggcgcaccaatggcagacaataac gaaggcgccgacggagtgggtaatgcct caggaaattggcattgcgattccacatgg ctgggcgacagagtcatcaccaccagca cccgaacatgggccttgcccacctataac aaccacctctacaagcaaatctccagtgct tcaacgggggccagcaacgacaaccact acttcggctacagcaccccctgggggtat tttgatttcaacagattccactgccatttctc accacgtgactggcagcgactcatcaaca acaattggggattccggcccaagagactc aacttcaagctcttcaacatccaagtcaag gaggtcacgacgaatgatggcgtcacga ccatcgctaataaccttaccagcacggttc aagtcttctcggactcggagtaccagttgc cgtacgtcctcggctctgcgcaccagggc tgcctccctccgttcccggcggacgtgttc atgattccgcagtacggctacctaacgctc aacaatggcagccaggcagtgggacggt catccttttactgcctggaatatttcccatcg cagatgctgagaacgggcaataactttac cttcagctacaccttcgaggacgtgccttt ccacagcagctacgcgcacagccagag cctggaccggctgatgaatcctctcatcga ccagtacctgtattacctgaacagaactca gaatcagtccggaagtgcccaaaacaag gacttgctgtttagccgggggtctccagct ggcatgtctgttcagcccaaaaactggcta cctggaccctgttaccggcagcagcgcgt ttctaaaacaaaaacagacaacaacaaca gcaactttacctggactggtgcttcaaaat ataaccttaatgggcgtgaatctataatcaa ccctggcactgctatggcctcacacaaag acgacaaagacaagttctttcccatgagc ggtgtcatgatttttggaaaggagagcgc cggagcttcaaacactgcattggacaatgt catgatcacagacgaagaggaaatcaaa gccactaaccccgtggccaccgaaagatt tgggactgtggcagtcaatctccagagca gcagcacagaccctgcgaccggagatgt gcatgttatgggagccttacctggaatggt gtggcaagacagagacgtatacctgcag ggtcctatttgggccaaaattcctcacacg gatggacactttcacccgtctcctctcatg ggcggctttggacttaagcacccgcctcc tcagatcctcatcaaaaacacgcctgttcct gcgaatcctccggcagagttttcggctac aaagtttgcttcattcatcacccagtattcca caggacaagtgagcgtggagattgaatg ggagctgcagaaagaaaacagcaaacg ctggaatcccgaagtgcagtatacatctaa ctatgcaaaatctgccaacgttgatttcact gtggacaacaatggactttatactgagcct cgccccattggcacccgttacctcacccg tcccctgtaattgtgtgttaatcaataaacc ggt Chimera 6b 65 ggtaccaaaacaaatgttctcgtcacgtgg AAV12VP1/2- gcatgaatctgatgctgtttccctgcagac AAV6VP3 aatgcgagagaatgaatcagaattcaaat atctgcttcactcacggacagaaagactgt ttagagtgctttcccgtgtcagaatctcaac ccgtttctgtcgtcaaaaaggcgtatcaga aactgtgctacattcatcatatcatgggaaa ggtgccagacgcttgcactgcctgcgatc tggtcaatgtggatttggatgactgcatcttt gaacaataaatgatttaaatcaggtatggc tgctgacggttatcttccagattggctcga ggacaacctctctgaaggcattcgcgagt ggtgggcgctgaaacctggagctccaca acccaaggccaaccaacagcatcaggac aacggcaggggtcttgtgcttcctgggta caagtacctcggacccttcaacggactcg acaagggagagccggtcaacgaggcag acgccgcggccctcgagcacgacaagg cctacgacaagcagctcgagcaggggg acaacccgtatctcaagtacaaccacgcc gacgccgagttccagcagcgcttggcga ccgacacctcttttgggggcaacctcggg cgagcagtcttccaggccaaaaagagga ttctcgagcctctgggtctggttgaagagg gcgttaaaacggctcctggaaagaaacg cccattagaaaagactccaaatcggccga ccaacccggactctgggaaggccccgg ccaagaaaaagcaaaaagacggcgaac cagccgactctgctagaaggacactcga ctttgaagactctggagcaggagacgga ccccctgagggatcatcttccggagaaat gtctcatgatgctgagatggcttcaggcg gtggcgcaccaatggcagacaataacga aggcgccgacggagtgggtaatgcctca ggaaattggcattgcgattccacatggctg ggcgacagagtcatcaccaccagcaccc gaacatgggccttgcccacctataacaac cacctctacaagcaaatctccagtgcttca acgggggccagcaacgacaaccactact tcggctacagcaccccctgggggtattttg atttcaacagattccactgccatttctcacc acgtgactggcagcgactcatcaacaaca attggggattccggcccaagagactcaac ttcaagctcttcaacatccaagtcaaggag gtcacgacgaatgatggcgtcacgaccat cgctaataaccttaccagcacggttcaagt cttctcggactcggagtaccagttgccgta cgtcctcggctctgcgcaccagggctgcc tccctccgttcccggcggacgtgttcatga ttccgcagtacggctacctaacgctcaac aatggcagccaggcagtgggacggtcat ccttttactgcctggaatatacccatcgca gatgctgagaacgggcaataactttacctt cagctacaccttcgaggacgtgcctacca cagcagctacgcgcacagccagagcctg gaccggctgatgaatcctctcatcgacca gtacctgtattacctgaacagaactcagaa tcagtccggaagtgcccaaaacaaggac ttgctgatagccgggggtctccagctggc atgtctgttcagcccaaaaactggctacct ggaccctgttaccggcagcagcgcgtac taaaacaaaaacagacaacaacaacagc aactttacctggactggtgcttcaaaatata accttaatgggcgtgaatctataatcaacc ctggcactgctatggcctcacacaaagac gacaaagacaagttctacccatgagcggt gtcatgatattggaaaggagagcgccgg agcttcaaacactgcattggacaatgtcat gatcacagacgaagaggaaatcaaagcc actaaccccgtggccaccgaaagatttgg gactgtggcagtcaatctccagagcagca gcacagaccctgcgaccggagatgtgca tgttatgggagccttacctggaatggtgtg gcaagacagagacgtatacctgcagggt cctatttgggccaaaattcctcacacggat ggacactacacccgtctcctctcatgggc ggctttggacttaagcacccgcctcctcag atcctcatcaaaaacacgcctgttcctgcg aatcctccggcagagtatcggctacaaag tagcttcattcatcacccagtattccacag gacaagtgagcgtggagattgaatggga gctgcagaaagaaaacagcaaacgctgg aatcccgaagtgcagtatacatctaactat gcaaaatctgccaacgttgatttcactgtg gacaacaatggactttatactgagcctcgc cccattggcacccgttacctcacccgtccc ctgtaattgtgtgaaatcaataaaccggt
TABLE-US-00002 TABLE 2 WT AAV capsid amino acid and nucleic acid sequences Virus SEQ SEQ Serotype ID NO. Amino acid sequence ID NO. Nucleic acid sequence AAV6 26 MAADGYLPDWLEDNLSE 31 atggctgccgatggttatcttccagattgg GIREWWDLKPGAPKPKA ctcgaggacaacctctctgagggcattcg NQQKQDDGRGLVLPGYK cgagtggtgggacttgaaacctggagcc YLGPFNGLDKGEPVNAAD ccgaaacccaaagccaaccagcaaaag AAALEHDKAYDQQLKAG caggacgacggccggggtctggtgcttc DNPYLRYNHADAEFQERL ctggctacaagtacctcggacccttcaac QEDTSFGGNLGRAVFQAK ggactcgacaagggggagcccgtcaac KRVLEPFGLVEEGAKTAP gcggcggatgcagcggccctcgagcac GKKRPVEQSPQEPDSSSGI gacaaggcctacgaccagcagctcaaag GKTGQQPAKKRLNFGQT cgggtgacaatccgtacctgcggtataac GDSESVPDPQPLGEPPATP cacgccgacgccgagtttcaggagcgtct AAVGPTTMASGGGAPMA gcaagaagatacgtcttttgggggcaacc DNNEGADGVGNASGNWH tcgggcgagcagtcttccaggccaagaa CDSTWLGDRVITTSTRTW gagggttctcgaaccttttggtctggttgag ALPTYNNHLYKQISSASTG gaaggtgctaagacggctcctggaaaga ASNDNHYFGYSTPWGYF aacgtccggtagagcagtcgccacaaga DFNRFHCHFSPRDWQRLI gccagactcctcctcgggcattggcaaga NNNWGFRPKRLNFKLFNI caggccagcagcccgctaaaaagagact QVKEVTTNDGVTTIANNL caattttggtcagactggcgactcagagtc TSTVQVFSDSEYQLPYVL agtccccgacccacaacctctcggagaa GSAHQGCLPPFPADVFMIP cctccagcaacccccgctgctgtgggac QYGYLTLNNGSQAVGRSS ctactacaatggcttcaggcggtggcgca FYCLEYFPSQMLRTGNNF ccaatggcagacaataacgaaggcgccg TFSYTFEDVPFHSSYAHSQ acggagtgggtaatgcctcaggaaattgg SLDRLMNPLIDQYLYYLN cattgcgattccacatggctgggcgacag RTQNQSGSAQNKDLLFSR agtcatcaccaccagcacccgaacatgg GSPAGMSVQPKNWLPGP gccttgcccacctataacaaccacctctac CYRQQRVSKTKTDNNNS aagcaaatctccagtgcttcaacgggggc NFTWTGASKYNLNGRESII cagcaacgacaaccactacttcggctaca NPGTAMASHKDDKDKFFP gcaccccctgggggtattttgatttcaaca MSGVMIFGKESAGASNTA gattccactgccatttctcaccacgtgactg LDNVMITDEEEIKATNPV gcagcgactcatcaacaacaattggggat ATERFGTVAVNLQSSSTD tccggcccaagagactcaacttcaagctc PATGDVHVMGALPGMV ttcaacatccaagtcaaggaggtcacgac WQDRDVYLQGPIWAKIPH gaatgatggcgtcacgaccatcgctaata TDGHFHPSPLMGGFGLKH accttaccagcacggttcaagtcttctcgg PPPQILIKNTPVPANPPAEF actcggagtaccagttgccgtacgtcctc SATKFASFITQYSTGQVSV ggctctgcgcaccagggctgcctccctcc EIEWELQKENSKRWNPEV gttcccggcggacgtgttcatgattccgca QYTSNYAKSANVDFTVD gtacggctacctaacgctcaacaatggca NNGLYTEPRPIGTRYLTRP gccaggcagtgggacggtcatccttttact L gcctggaatatttcccatcgcagatgctga gaacgggcaataactttaccttcagctaca ccttcgaggacgtgcctttccacagcagct acgcgcacagccagagcctggaccggc tgatgaatcctctcatcgaccagtacctgta ttacctgaacagaactcagaatcagtccg gaagtgcccaaaacaaggacttgctgttta gccgggggtctccagctggcatgtctgtt cagcccaaaaactggctacctggaccctg ttaccggcagcagcgcgtttctaaaacaa aaacagacaacaacaacagcaactttacc tggactggtgcttcaaaatataaccttaatg ggcgtgaatctataatcaaccctggcactg ctatggcctcacacaaagacgacaaaga caagttctttcccatgagcggtgtcatgatt tttggaaaggagagcgccggagcttcaa acactgcattggacaatgtcatgatcacag acgaagaggaaatcaaagccactaaccc cgtggccaccgaaagatttgggactgtgg cagtcaatctccagagcagcagcacaga ccctgcgaccggagatgtgcatgttatgg gagccttacctggaatggtgtggcaagac agagacgtatacctgcagggtcctatttgg gccaaaattcctcacacggatggacacttt cacccgtctcctctcatgggcggctttgga cttaagcacccgcctcctcagatcctcatc aaaaacacgcctgttcctgcgaatcctcc ggcagagttttcggctacaaagtttgcttca ttcatcacccagtattccacaggacaagtg agcgtggagattgaatgggagctgcaga aagaaaacagcaaacgctggaatcccga agtgcagtatacatctaactatgcaaaatct gccaacgttgatttcactgtggacaacaat ggactttatactgagcctcgccccattggc acccgttacctcacccgtcccctgtaa AAV4 27 MTDGYLPDWLEDNLSEG 32 atgactgacggttaccttccagattggcta VREWWALQPGAPKPKAN gaggacaacctctctgaaggcgttcgaga QQHQDNARGLVLPGYKY gtggtgggcgctgcaacctggagcccct LGPGNGLDKGEPVNAAD aaacccaaggcaaatcaacaacatcagg AAALEHDKAYDQQLKAG acaacgctcggggtcttgtgcttccgggtt DNPYLKYNHADAEFQQR acaaatacctcggacccggcaacggact LQGDTSFGGNLGRAVFQA cgacaagggggaacccgtcaacgcagc KKRVLEPLGLVEQAGETA ggacgcggcagccctcgagcacgacaa PGKKRPLIESPQQPDSSTGI ggcctacgaccagcagctcaaggccggt GKKGKQPAKKKLVFEDET gacaacccctacctcaagtacaaccacgc GAGDGPPEGSTSGAMSDD cgacgcggagttccagcagcggcttcag SEMRAAAGGAAVEGGQG ggcgacacatcgtttgggggcaacctcg ADGVGNASGDWHCDSTW gcagagcagtcttccaggccaaaaagag SEGHVTTTSTRTWVLPTY ggttcttgaacctcttggtctggttgagcaa NNHLYKRLGESLQSNTYN gcgggtgagacggctcctggaaagaag GFSTPWGYFDFNRFHCHF agaccgttgattgaatccccccagcagcc SPRDWQRLINNNWGMRP cgactcctccacgggtatcggcaaaaaa KAMRVKIFNIQVKEVTTS ggcaagcagccggctaaaaagaagctc NGETTVANNLTSTVQIFA glatcgaagacgaaactggagcaggcg DS SYELPYVMDAGQEGSL acggaccccctgagggatcaacttccgg PPFPNDVFMVPQYGYCGL agccatgtctgatgacagtgagatgcgtg VTGNTSQQQTDRNAFYCL cagcagctggcggagctgcagtcgagg EYFPSQMLRTGNNFEITYS gcggacaaggtgccgatggagtgggtaa FEKVPFHSMYAHSQSLDR tgcctcgggtgattggcattgcgattccac LMNPLIDQYLWGLQSTTT ctggtctgagggccacgtcacgaccacc GTTLNAGTATTNFTKLRP agcaccagaacctgggtcttgcccaccta TNFSNFKKNVVLPGPSIKQ caacaaccacctctacaagcgactcgga QGFSKTANQNYKIPATGS gagagcctgcagtccaacacctacaacg DSLIKYETHSTLDGRWSA gattctccaccccctggggatactttgactt LTPGPPMATAGPADSKFS caaccgcttccactgccacttctcaccacg NSQLIFAGPKQNGNTATV tgactggcagcgactcatcaacaacaact PGTLIFTSEEELAATNATD ggggcatgcgacccaaagccatgcgggt TDMWGNLPGGDQSNSNL caaaatcttcaacatccaggtcaaggagg PTVDRLTALGAVPGMVW tcacgacgtcgaacggcgagacaacggt QNRDIYYQGPIWAKIPHT ggctaataaccttaccagcacggttcagat DGHFHPSPLIGGFGLKHPP ctttgcggactcgtcgtacgaactgccgta PQIFIKNTPVPANPATTFSS cgtgatggatgcgggtcaagagggcagc TPVNSFITQYSTGQVSVQI ctgcctccttttcccaacgacgtctttatggt DWEIQKERSKRWNPEVQF gccccagtacggctactgtggactggtga TSNYGQQNSLLWAPDAA ccggcaacacttcgcagcaacagactga GKYTEPRAIGTRYLTHHL cagaaatgccttctactgcctggagtacttt ccttcgcagatgctgcggactggcaacaa ctttgaaattacgtacagttttgagaaggtg cctttccactcgatgtacgcgcacagcca gagcctggaccggctgatgaaccctctca tcgaccagtacctgtggggactgcaatcg accaccaccggaaccaccctgaatgccg ggactgccaccaccaactttaccaagctg cggcctaccaacttttccaactttaaaaaga actggctgcccgggccttcaatcaagcag cagggcttctcaaagactgccaatcaaaa ctacaagatccctgccaccgggtcagaca gtctcatcaaatacgagacgcacagcact ctggacggaagatggagtgccctgaccc ccggacctccaatggccacggctggacc tgcggacagcaagttcagcaacagccag ctcatctttgcggggcctaaacagaacgg caacacggccaccgtacccgggactctg atcttcacctctgaggaggagctggcagc caccaacgccaccgatacggacatgtgg ggcaacctacctggcggtgaccagagca acagcaacctgccgaccgtggacagact gacagccttgggagccgtgcctggaatg gtctggcaaaacagagacatttactacca gggtcccatttgggccaagattcctcatac cgatggacactttcacccctcaccgctgat tggtgggtttgggctgaaacacccgcctc ctcaaatttttatcaagaacaccccggtacc tgcgaatcctgcaacgaccttcagctctac tccggtaaactccttcattactcagtacagc actggccaggtgtcggtgcagattgactg ggagatccagaaggagcggtccaaacg ctggaaccccgaggtccagtttacctcca actacggacagcaaaactctctgttgtgg gctcccgatgcggctgggaaatacactga gcctagggctatcggtacccgctacctca cccaccacctgtaa AAV5 28 MSFVDHPPDWLEEVGEGL 33 atgtcttttgttgatcaccctccagattggtt REFLGLEAGPPKPKPNQQ ggaagaagttggtgaaggtcttcgcgagt HQDQARGLVLPGYNYLG ttttgggccttgaagcgggcccaccgaaa PGNGLDRGEPVNRADEVA ccaaaacccaatcagcagcatcaagatca REHDISYNEQLEAGDNPY agcccgtggtcttgtgctgcctggttataa LKYNHADAEFQEKLADD ctatctcggacccggaaacggtctcgatc TSFGGNLGKAVFQAKKRV gaggagagcctgtcaacagggcagacg LEPFGLVEEGAKTAPTGK aggtcgcgcgagagcacgacatctcgta RIDDHFPKRKKARTEEDS caacgagcagcttgaggcgggagacaa KPSTSSDAEAGPSGSQQL cccctacctcaagtacaaccacgcggac QIPAQPASSLGADTMSAG gccgagtttcaggagaagctcgccgacg GGGPLGDNNQGADGVGN acacatccttcgggggaaacctcggaaa ASGDWHCDSTWMGDRV ggcagtctttcaggccaagaaaagggttc VTKSTRTWVLPSYNNHQY tcgaaccttttggcctggttgaagagggtg REIKSGSVDGSNANAYFG ctaagacggcccctaccggaaagcggat YSTPWGYFDFNRFHSHWS agacgaccactttccaaaaagaaagaag PRDWQRLINNYWGFRPRS gctcggaccgaagaggactccaagcctt LRVKIFNIQVKEVTVQDST ccacctcgtcagacgccgaagctggacc TTIANNLTSTVQVFTDDD cagcggatcccagcagctgcaaatccca YQLPYVVGNGTEGCLPAF gcccaaccagcctcaagtttgggagctga PPQVFTLPQYGYATLNRD tacaatgtctgcgggaggtggcggcccat NTENPTERSSFFCLEYFPS tgggcgacaataaccaaggtgccgatgg KMLRTGNNFEFTYNFEEV agtgggcaatgcctcgggagattggcatt PFHSSFAPSQNLFKLANPL gcgattccacgtggatgggggacagagt VDQYLYRFVSTNNTGGV cgtcaccaagtccacccgaacctgggtg QFNKNLAGRYANTYKNW ctgcccagctacaacaaccaccagtaccg FPGPMGRTQGWNLGSGV agagatcaaaagcggctccgtcgacgga NRASVSAFATTNRMELEG agcaacgccaacgcctactttggatacag ASYQVPPQPNGMTNNLQ caccccctgggggtactttgactttaaccg GSNTYALENTMIFNSQPA cttccacagccactggagcccccgagact NPGTTATYLEGNMLITSES ggcaaagactcatcaacaactactgggg ETQPVNRVAYNVGGQMA cttcagaccccggtccctcagagtcaaaa TNNQSSTTAPATGTYNLQ tcttcaacattcaagtcaaagaggtcacgg EIVPGSVWMERDVYLQGP tgcaggactccaccaccaccatcgccaac IWAKIPETGAHFHPSPAM aacctcacctccaccgtccaagtgtttacg GGFGLKHPPPMMLIKNTP gacgacgactaccagctgccctacgtcgt VPGNITSFSDVPVSSFITQY cggcaacgggaccgagggatgcctgcc STGQVTVEMEWELKKEN ggccttccctccgcaggtctttacgctgcc SKRWNPEIQYTNNYNDPQ gcagtacggttacgcgacgctgaaccgc FVDFAPDSTGEYRTTRPIG gacaacacagaaaatcccaccgagagga TRYLTRPL gcagcttcttctgcctagagtactttcccag caagatgctgagaacgggcaacaactttg agtttacctacaactttgaggaggtgccctt ccactccagcttcgctcccagtcagaacct gttcaagctggccaacccgctggtggacc agtacttgtaccgcttcgtgagcacaaata acactggcggagtccagttcaacaagaa cctggccgggagatacgccaacacctac aaaaactggttcccggggcccatgggcc gaacccagggctggaacctgggctccgg ggtcaaccgcgccagtgtcagcgccttcg ccacgaccaataggatggagctcgaggg cgcgagttaccaggtgcccccgcagccg aacggcatgaccaacaacctccagggca gcaacacctatgccctggagaacactatg atcttcaacagccagccggcgaacccgg gcaccaccgccacgtacctcgagggcaa catgctcatcaccagcgagagcgagacg cagccggtgaaccgcgtggcgtacaacg tcggcgggcagatggccaccaacaacca gagctccaccactgcccccgcgaccggc acgtacaacctccaggaaatcgtgcccg gcagcgtgtggatggagagggacgtgta cctccaaggacccatctgggccaagatcc cagagacgggggcgcactttcacccctct ccggccatgggcggattcggactcaaac acccaccgcccatgatgctcatcaagaac acgcctgtgcccggaaatatcaccagctt ctcggacgtgcccgtcagcagcttcatca cccagtacagcaccgggcaggtcaccgt ggagatggagtgggagctcaagaagga aaactccaagaggtggaacccagagatc cagtacacaaacaactacaacgaccccc agtttgtggactttgccccggacagcacc ggggaatacagaaccaccagacctatcg gaacccgataccttacccgacccctttaa AAV11 29 MAADGYLPDWLEDNLSE 34 atggctgctgacggttatcttccagattgg GIREWWDLKPGAPKPKA ctcgaggacaacctctctgagggcattcg NQQKQDDGRGLVLPGYK cgagtggtgggacctgaaacctggagcc YLGPFNGLDKGEPVNAAD ccgaagcccaaggccaaccagcagaag AAALEHDKAYDQQLKAG caggacgacggccggggtctggtgcttc DNPYLRYNHADAEFQERL ctggctacaagtacctcggacccttcaac QEDTSFGGNLGRAVFQAK ggactcgacaagggggagcccgtcaac KRVLEPLGLVEEGAKTAP gcggcggacgcagcggccctcgagcac GKKRPLESPQEPDSSSGIG gacaaggcctacgaccagcagctcaaag KKGKQPARKRLNFEEDTG cgggtgacaatccgtacctgcggtataac AGDGPPEGSDTSAMSSDIE cacgccgacgccgagtttcaggagcgtct MRAAPGGNAVDAGQGSD gcaagaagatacgtcttttgggggcaacc GVGNASGDWHCDSTWSE tcgggcgagcagtcttccaggccaagaa GKVTTTSTRTWVLPTYNN gagggtactcgaacctctgggcctggttg HLYLRLGTTSSSNTYNGFS aagaaggtgctaaaacggctcctggaaa TPWGYFDFNRFHCHFSPR gaagagaccgttagagtcaccacaagag DWQRLINNNWGLRPKAM cccgactcctcctcgggcatcggcaaaaa RVKIFNIQVKEVTTSNGET aggcaaacaaccagccagaaagaggct TVANNLTSTVQIFADSSYE caactttgaagaggacactggagccgga LPYVMDAGQEGSLPPFPN gacggaccccctgaaggatcagatacca DVFMVPQYGYCGIVTGEN gcgccatgtcttcagacattgaaatgcgtg QNQTDRNAFYCLEYFPSQ cagcaccgggcggaaatgctgtcgatgc MLRTGNNFECANNFEKVP gggacaaggttccgatggagtgggtaat FHSMYAHSQSLDRLMNPL gcctcgggtgattggcattgcgattccacc LDQYLWHLQSTTSGETLN tggtctgagggcaaggtcacaacaacctc QGNAATTFGKIRSGDFAF gaccagaacctgggtcttgcccacctaca YRKNWLPGPCVKQQRFS acaaccacttgtacctgcgtctcggaaca KTASQNYKIPASGGNALL acatcaagcagcaacacctacaacggatt KYDTHYTLNNRWSNIAPG ctccaccccctggggatattttgacttcaac PPMATAGPSDGDFSNAQL agattccactgtcacttctcaccacgtgact IFPGPSVTGNTTTSANNLL ggcaaagactcatcaacaacaactgggg FTSEEEIAATNPRDTDMFG actacgaccaaaagccatgcgcgttaaaa QIADNNQNATTAPITGNV tcttcaatatccaagttaaggaggtcacaa TAMGVLPGMVWQNRDIY cgtcgaacggcgagactacggtcgctaat YQGPIWAKIPHADGHFHP aaccttaccagcacggttcagatatttgcg SPLIGGFGLKHPPPQIFIKN gactcgtcgtatgagctcccgtacgtgatg TPVPANPATTFTAARVDSF gacgctggacaagaggggagcctgcctc ITQYSTGQVAVQIEWEIEK ctttccccaatgacgtgttcatggtgcctca ERSKRWNPEVQFTSNYGN atatggctactgtggcatcgtgactggcga QSSMLWAPDTTGKYTEPR gaatcagaaccaaacggacagaaacgct VIGSRYLTNHL ttctactgcctggagtattttccttcgcaaat gttgagaactggcaacaactttgaaatgg cttacaactttgagaaggtgccgttccact caatgtatgctcacagccagagcctggac agactgatgaatcccctcctggaccagta cctgtggcacttacagtcgactacctctgg agagactctgaatcaaggcaatgcagca accacatttggaaaaatcaggagtggaga ctttgccttttacagaaagaactggctgcct gggccttgtgttaaacagcagagattctca aaaactgccagtcaaaattacaagattcct gccagcgggggcaacgctctgttaaagt atgacacccactataccttaaacaaccgct ggagcaacatcgcgcccggacctccaat ggccacagccggaccttcggatggggac ttcagtaacgcccagcttatattccctggac catctgttaccggaaatacaacaacttcag ccaacaatctgttgtttacatcagaagaag aaattgctgccaccaacccaagagacac ggacatgtttggccagattgctgacaataa tcagaatgctacaactgctcccataaccg gcaacgtgactgctatgggagtgctgcct ggcatggtgtggcaaaacagagacattta ctaccaagggccaatttgggccaagatcc cacacgcggacggacattttcatccttcac cgctgattggtgggtttggactgaaacacc cgcctccccagatattcatcaagaacactc ccgtacctgccaatcctgcgacaaccttca ctgcagccagagtggactctttcatcacac aatacagcaccggccaggtcgctgttcag attgaatgggaaattgaaaaggaacgctc caaacgctggaatcctgaagtgcagtttac ttcaaactatgggaaccagtcttctatgttgt gggctcctgatacaactgggaagtataca gagccgcgggttattggctctcgttatttga ctaatcatttgtaa AAV12 30 MAADGYLPDWLEDNLSE 35 atggctgctgacggttatcttccagattgg GIREWWALKPGAPQPKA ctcgaggacaacctctctgaaggcattcg NQQHQDNGRGLVLPGYK cgagtggtgggcgctgaaacctggagct YLGPFNGLDKGEPVNEAD ccacaacccaaggccaaccaacagcatc AAALEHDKAYDKQLEQG aggacaacggcaggggtcttgtgcttcct DNPYLKYNHADAEFQQR gggtacaagtacctcggacccttcaacgg LATDTSFGGNLGRAVFQA actcgacaagggagagccggtcaacga KKRILEPLGLVEEGVKTAP ggcagacgccgcggccctcgagcacga GKKRPLEKTPNRPTNPDS caaggcctacgacaagcagctcgagcag GKAPAKKKQKDGEPADS ggggacaacccgtatctcaagtacaacca ARRTLDFEDSGAGDGPPE cgccgacgccgagttccagcagcgcttg GSSSGEMSHDAEMRAAP gcgaccgacacctcttttgggggcaacct GGNAVEAGQGADGVGNA cgggcgagcagtcttccaggccaaaaag SGDWHCDSTWSEGRVTT aggattctcgagcctctgggtctggttgaa TSTRTWVLPTYNNHLYLR gagggcgttaaaacggctcctggaaaga IGTTANSNTYNGFSTPWG aacgcccattagaaaagactccaaatcgg YFDFNRFHCHFSPRDWQR ccgaccaacccggactctgggaaggccc LINNNWGLRPKSMRVKIF cggccaagaaaaagcaaaaagacggcg NIQVKEVTTSNGETTVAN aaccagccgactctgctagaaggacactc NLTSTVQIFADSTYELPYV gactttgaagactctggagcaggagacg MDAGQEGSFPPFPNDVFM gaccccctgagggatcatcttccggagaa VPQYGYCGVVTGKNQNQ atgtctcatgatgctgagatgcgtgcggc TDRNAFYCLEYFPSQMLR gccaggcggaaatgctgtcgaggcggg TGNNFEVSYQFEKVPFHS acaaggtgccgatggagtgggtaatgcct MYAHSQSLDRMMNPLLD ccggtgattggcattgcgattccacctggt QYLWHLQSTTTGNSLNQG cagagggccgagtcaccaccaccagca TATTTYGKITTGDFAYYR cccgaacctgggtcctacccacgtacaac KNWLPGACIKQQKFSKNA aaccacctgtacctgcgaatcggaacaac NQNYKIPASGGDALLKYD ggccaacagcaacacctacaacggattct THTTLNGRWSNMAPGPP ccaccccctggggatactttgactttaacc MATAGAGDSDFSNSQLIF gcttccactgccacttttccccacgcgact AGPNPSGNTTTSSNNLLFT ggcagcgactcatcaacaacaactgggg SEEEIATTNPRDTDMFGQI actcaggccgaaatcgatgcgtgttaaaat ADNNQNATTAPHIANLDA cttcaacatacaggtcaaggaggtcacga MGIVPGMVWQNRDIYYQ cgtcaaacggcgagactacggtcgctaat GPIWAKVPHTDGHFHPSP aaccttaccagcacggttcagatctttgcg LMGGFGLKHPPPQIFIKNT gattcgacgtatgaactcccatacgtgatg PVPANPNTTFSAARINSFL gacgccggtcaggaggggagctttcctc TQYSTGQVAVQIDWEIQK cgtttcccaacgacgtctttatggttcccca EHSKRWNPEVQFTSNYGT atacggatactgcggagttgtcactggaa QNSMLWAPDNAGNYHEL aaaaccagaaccagacagacagaaatgc RAIGSRFLTHHL ctatactgcctggaatactaccatcccaaa tgctaagaactggcaacaattttgaagtca gttaccaatagaaaaagttcctaccattca atgtacgcgcacagccagagcctggaca gaatgatgaatcctttactggatcagtacct gtggcatctgcaatcgaccactaccggaa attcccttaatcaaggaacagctaccacca cgtacgggaaaattaccactggagacttt gcctactacaggaaaaactggttgcctgg agcctgcattaaacaacaaaaattacaaa gaatgccaatcaaaactacaagattcccg ccagcgggggagacgcccattaaagtat gacacgcataccactctaaatgggcgatg gagtaacatggctcctggacctccaatgg caaccgcaggtgccggggactcggatttt agcaacagccagctgatctttgccggacc caatccgagcggtaacacgaccacatctt caaacaatagttgatacctcagaagagg agattgccacaacaaacccacgagacac ggacatgtaggacagattgcagataataa tcaaaatgccaccaccgcccctcacatcg ctaacctggacgctatgggaattgttcccg gaatggtctggcaaaacagagacatctac taccagggccctatagggccaaggtccc tcacacggacggacactttcacccttcgc cgctgatgggaggatttggactgaaacac ccgcctccacagattttcatcaaaaacacc cccgtacccgccaatcccaatactaccttt agcgctgcaaggattaattcttactgacgc agtacagcaccggacaagttgccgttcag atcgactgggaaattcagaaggagcattc caaacgctggaatcccgaagttcaatttac ttcaaactacggcactcaaaattctatgctg tgggctcccgacaatgctggcaactacca cgaactccgggctattgggtcccgtacct cacccaccacttgtaa
[0137] In some cases, an engineered AAV can include exogenous sequences from alternate serotypes. For example, a chimeric AAV, that can include sequences from at least two different AAV serotypes, can be generated. The term “serotype” can be a distinction with respect to an AAV having a capsid which is serologically distinct from other AAV serotypes. Serologic distinctiveness can be determined on the basis of the lack of cross-reactivity between antibodies to the AAV as compared to other AAVs. Cross-reactivity can be measured in a neutralizing antibody assay. For this assay polyclonal serum can be generated against a specific AAV in a rabbit or other suitable animal model using the adeno-associated viruses. In this assay, serum generated against a specific AAV can then be tested in its ability to neutralize either the same (homologous) or a heterologous AAV. The dilution that achieves 50% neutralization is considered the neutralizing antibody titer. If, for two AAVs, the quotient of the heterologous titer divided by the homologous titer is lower than 16 in a reciprocal manner, those two vectors are considered as the same serotype. Conversely, if the ratio of the heterologous titer over the homologous titer is 16 or more in a reciprocal manner, the two AAVs are considered distinct serotypes.
[0138] Homologous recombination can be used to generate capsids with new features and unique properties. Epitope coding sequences fused to either the N or C termini of the capsid coding sequences can be used to expose new peptides on the surface of the viral capsid without affecting gene function. In some embodiments, epitope sequences are inserted into specific positions in the capsid coding sequence by tagging the epitope into the coding sequences itself. In some embodiments, a chimeric capsid uses an epitope identified from a peptide library inserted into a specific position in the capsid coding sequence. The use of gene library to screen can be performed. For example, a screen of chimeras or mutant AAVs can be performed to identify chimeras and mutants that when used to transduce a cell confer increased transduction efficiency and/or increased expression of a transgene, such as an exogenous receptor.
[0139] Chimeric capsids in AAV vectors can expand the range of cell types that can be transfected and can increase the efficiency of transduction. Increased transduction or transfection can be from about a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 150%, 200%, 250% increase to about a 300% increase as compared to a transduction using an AAV with an unmodified capsid. For example, increased transduction or transfection can be measured as compared to a WT AAV in terms of the detection of a transgene present (as a nucleic acid or polypeptide) on or in a cell. In some embodiments, an AAV comprising a chimeric capsid of two different AAV serotypes will have increased transduction efficiency as compared to one or both of the WT AAVs from which the capsid was derived. A chimeric capsid can contain a degenerate, recombined, shuffled, or otherwise modified Cap protein. For example, targeted insertion of receptor-specific ligands or single-chain antibodies at the N-terminus of VP proteins can be performed. An insertion of a lymphocyte antibody or target into an AAV can be performed to improve binding and infection of a T-cell. In some cases, virions having chimeric capsids (e.g., capsids containing a degenerate or otherwise modified Cap protein) can be made. To further alter the capsids of such virions, for example, to enhance or modify the binding affinity for a specific cell type, such as a lymphocyte, additional mutations can be introduced into the capsid of the virion. For example, suitable chimeric capsids can have ligand insertion mutations to facilitate viral targeting to specific cell types. The construction and characterization of AAV capsid mutants including insertion mutants, alanine screening mutants, and epitope tag mutants are described in Wu et al., J. Virol. 74:8635-45, 2000. Methods of making AAV capsid mutants are known, and include site-directed mutagenesis (Wu et al., J. Virol. 72:5919-5926); molecular breeding, nucleic acid, exon, and DNA family shuffling (Soong et al., Nat. Genet. 25:436-439, 2000; Coco et al., Nature Biotech. 2001; 19:354; and U.S. Pat. Nos. 5,837,458; 5,811,238; and 6,180,406; Kolkman and Stemmer, Nat. Biotech. 19:423-428, 2001; Fisch et al., Proceedings of the National Academy of Sciences 93:7761-7766, 1996; Christians et al., Nat. Biotech. 17:259-264, 1999); ligand insertions (Girod et al. Nat. Med. 9:1052-1056, 1999); cassette mutagenesis (Rueda et al. Virology 263:89-99, 1999; Boyer et al., J. Virol. 66:1031-1039, 1992); and the insertion of short random oligonucleotide sequences.
[0140] In some cases, a transcapsidation can be performed. Transcapsidation can be a process that involves the packaging of the ITR of one AAV serotype into the capsid of a different serotype. In another case, adsorption of receptor ligands to an AAV capsid surface can be performed and can be the addition of foreign peptides to the surface of an AAV capsid. In some cases, this can confer the ability to specifically target cells that no AAV serotype currently has a tropism towards, and this can greatly expand the uses of AAV as a gene therapy tool.
AAP Modifications and Chimeras
[0141] In some embodiments, a modified AAV described herein comprises an AAP protein that comprises at least one amino acid modification compared to an AAP protein in a WT AAV of the same serotype. In some embodiments, said modified AAV comprises an AAP protein that comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid modifications compared to WT AAP of the same serotype. Modifications can include amino acid substitutions, deletions, or additions. In some embodiments, said modified AAV comprises an AAP protein that comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid substitutions compared to WT AAP of the same serotype. In some embodiments, said modified AAV comprises an AAP protein that comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid substitutions compared to WT AAP of the same serotype.
[0142] In some embodiments, said modified AAV comprises an AAP protein with a at least one amino acid modification (e.g., substitution) between amino acid positions 1 and 50, 5 and 40, 10 and 35, 13 and 27, 13 and 21, or 21 and 27 of the AAP protein, as compared to a WT AAP protein of the same serotype. In some embodiments, a mutation in AAP region is at amino acid position 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 of said AAP protein, as compared to a WT AAP protein of the same serotype. One of ordinary skill in the art will readily understand that a sequence alignment of AAP sequences can be used to determine corresponding amino acid numbers in various AAP serotypes. An exemplary sequence alignment is provided in
[0143] Exemplary AAP chimeras are disclosed in Table 4 (nucleic acid sequences) and Table 5 (amino acid sequences). Exemplary WT AAP sequences are disclosed in Table 6.
[0144] In some embodiments, the chimera comprises an AAP protein encoded by a nucleic acid sequence in Table 4 or Table 5. In some embodiments, the chimera comprises an AAP protein comprising an amino acid sequence in Table 5. In some embodiments, the chimera comprises an AAP protein encoded by a nucleic acid sequence in Table 4. In some embodiments, the chimera comprises an AAP protein encoded by a nucleic acid sequence that shares at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identity with SEQ ID NOs: 3-15. In some embodiments, the chimera comprises an AAP protein that comprises an amino acid sequence that shares at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identity with SEQ ID NOs: 2, 16-25. In some embodiments, the chimera comprises an AAP protein encoded by a nucleic acid sequence that shares at least 99% or 100% identity with SEQ ID NOs: 3-15. In some embodiments, the chimera comprises an AAP protein that comprises an amino acid sequence that shares at least 99% or 100% identity with SEQ ID NOs: 2, 16-25.
Transgenes, and Modified ITRs
[0145] In some embodiments, an AAV viral vector is used to introduce an exogenous transgene, such as a cellular receptor, into a cell. In some embodiments, said transgene encodes a functional protein. In some embodiments, said transgene encodes a cell surface receptor. In some embodiments said transgene encodes an intracellular protein. In some embodiments, said transgene encodes an exogenous T cell receptor (TCR), chimeric antigen receptor (CAR), or B cell receptor. In some embodiments, said transgene encodes an exogenous receptor that specifically binds to a cancer cells. In some embodiments, said transgene comprises homology arms for targeted integration of the transgene into the genome of a cell. In some embodiments, said transgene is randomly integrated into the genome of a cell.
[0146] In some embodiments, each end of the AAV single-stranded DNA genome contains an inverted terminal repeat (ITR). In some embodiments, said ITRs are the only cis-acting element required for genome replication and packaging. An ITR can be from any AAV serotype. For example, an ITR can be from the following AAV serotypes, AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, or AAV12. In some embodiments, said ITR is from AAV2.
Helper Viruses
[0147] In some cases, the present disclosure provides construction of helper vectors that provide AAV Rep, Cap, and/or AAP proteins for producing stocks of virions composed of an AAV vector (e.g., a vector encoding an exogenous receptor sequence) and a chimeric capsid (e.g., a capsid containing a degenerate, recombined, shuffled or otherwise modified Cap protein). In some cases, a modification can involve the production of AAV cap nucleic acids that are modified, e.g., cap nucleic acids that contain portions of sequences derived from more than one AAV serotype (e.g., AAV serotypes 1-12). Such chimeric nucleic acids can be produced by a number of mutagenesis techniques. A method for generating chimeric cap genes can involve the use of degenerate oligonucleotides in an in vitro DNA amplification reaction. A protocol for incorporating degenerate mutations (e.g., polymorphisms from different AAV serotypes) into a nucleic acid sequence is described in Coco et al. (Nature Biotechnology 20:1246-1250, 2002). In this method, known as degenerate homoduplex recombination, “top-strand” oligonucleotides, that contain polymorphisms (degeneracies) from genes within a gene family, are constructed. Complementary degeneracies are engineered into multiple bridging “scaffold” oligonucleotides. A single sequence of annealing, gap-filling, and ligation steps results in the production of a library of nucleic acids capturing every possible permutation of the parental polymorphisms. Any portion of a capsid gene can be mutated using methods such as degenerate homoduplex recombination. Particular capsid gene sequences, however, are preferred. For example, critical residues responsible for binding of an AAV2 capsid to its cell surface receptor heparin sulfate proteoglycan (HSPG) have been mapped. Arginine residues at positions 585 and 588 appear to be critical for binding, as non-conservative mutations within these residues eliminate binding to heparin-agarose. Computer modeling of the AAV2 and AAV4 atomic structures identified seven hypervariable regions that overlap arginine residues 585 and 588, and that are exposed to the surface of the capsid. These hypervariable regions are thought to be exposed as surface loops on the capsid that mediates receptor binding. Therefore, these loops can be used as targets for mutagenesis in methods of producing chimeric virions with tropisms different from WT virions.
Multiplicity of Infection
[0148] In some cases, a mutated or chimeric adeno-associated viral vector of the disclosure can be measured using multiplicity of infection (MOI). In some cases, MOI can refer to the ratio, or multiple of vector or viral genomes to the cells to which the nucleic can be delivered. In some cases, the MOI can be 1×10.sup.6 GC/mL. In some cases, the MOI can be 1×10.sup.5 GC/mL to 1×10.sup.7 GC/mL. In some cases, the MOI can be 1×10.sup.4 GC/mL to 1×10.sup.8 GC/mL. In some cases, recombinant viruses of the disclosure are at least about 1×10.sup.1 GC/mL, 1×10.sup.2 GC/mL, 1×10.sup.3 GC/mL, 1×10.sup.4 GC/mL, 1×10.sup.5 GC/mL, 1×10.sup.6 GC/mL, 1×10.sup.7 GC/mL, 1×10.sup.8 GC/mL, 1×10.sup.9 GC/mL, 1×10.sup.10 GC/mL, 1×10.sup.11 GC/mL, 1×10.sup.12 GC/mL, 1×10.sup.13 GC/mL, 1×10.sup.14 GC/mL, 1×10.sup.15 GC/mL, 1×10.sup.16 GC/mL, 1×10.sup.17 GC/mL, and 1×10.sup.18 GC/mL MOI. In some cases, a mutated or chimeric adeno-associated viruses of this disclosure are from about 1×10.sup.8 GC/mL to about 3×10.sup.14 GC/mL MOI, or are at most about 1×10.sup.1 GC/mL, 1×10.sup.2 GC/mL, 1×10.sup.3 GC/mL, 1×10.sup.4 GC/mL, 1×10.sup.5 GC/mL, 1×10.sup.6 GC/mL, 1×10.sup.7 GC/mL, 1×10.sup.8 GC/mL, 1×10.sup.9 GC/mL, 1×10.sup.10 GC/mL, 1×10.sup.11 GC/mL, 1×10.sup.12 GC/mL, 1×10.sup.13 GC/mL, 1×10.sup.14 GC/mL, 1×10.sup.15 GC/mL, 1×10.sup.16 GC/mL, 1×10.sup.17 GC/mL, and 1×10.sup.18 GC/mL MOI. In some cases, the viral vectors of the present disclosure are more effective and may have lower off-target effects during transduction of cells as compared to unmodified vectors. For example, a lower MOI of a modified virus may result in fewer off-target transgene insertions as compared to transducing a comparable cell with an unmodified vector.
Methods of Producing Modified AAVs
[0149] The present disclosure provides methods and materials for producing recombinant modified AAV vectors and virions described herein. In some embodiments, the modified AAV vectors are chimeric and comprise a modified AAP protein. The present disclosure provides methods and materials for producing recombinant AAVs that can express one or more proteins of interest in a cell. As described herein, the methods and materials disclosed herein allow for high production or production of the proteins of interest at levels that achieve a therapeutic effect in vivo. An example of a protein of interest is an exogenous receptor. Exemplary exogenous receptors include, but are not limited to, a T-cell receptor (TCR), a B cell receptor, or a chimeric antigen receptor (CAR).
[0150] To generate AAV virions or viral particles, an AAV expression vector is introduced into a suitable host cell using known techniques, such as by transfection. Transfection techniques are known in the art. See, e.g., Graham et al. (1973) Virology, 52:456, Sambrook et al. (1989) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratories, New York, Davis et al. (1986) Basic Methods in Molecular Biology, Elsevier, and Chu et al. (1981) Gene 13:197. Suitable transfection methods include, but are not limited to, calcium phosphate co-precipitation, direct micro-injection, electroporation, liposome mediated gene transfer, and nucleic acid delivery using high-velocity microprojectiles, which are known in the art.
[0151] In some embodiments, methods for producing a recombinant AAV virions include providing a packaging cell line with a viral construct comprising a 5′ inverted terminal repeat (ITR) of AAV and a 3′ AAV ITR (such as those described herein), helper functions for generating a productive AAV infection, and AAV cap genes; and recovering a recombinant AAV virions from the supernatant of the packaging cell line. Various types of cells can be used as the packaging cell line. For example, packaging cell lines include, but are not limited to, HEK 293 cells, HeLa cells, and Vero cells. In some embodiments, supernatant of the packaging cell line is treated by PEG precipitation for concentrating the virus. In some embodiments, a centrifugation step is be used to concentrate a virus. For example a column can be used to precipitate virus during a centrifugation. In some embodiments, a precipitation occurs at no more than about 4° C. (for example about 3° C., about 2° C., about 1° C., or about 1° C.) for at least about 2 hours, at least about 3 hours, at least about 4 hours, at least about 6 hours, at least about 9 hours, at least about 12 hours, or at least about 24 hours. In some embodiments, the recombinant AAV is isolated from the PEG-precipitated supernatant by low-speed centrifugation followed by cesium chloride gradient. In some embodiment, the low-speed centrifugation is carried out at about 4000 rpm, about 4500 rpm, about 5000 rpm, or about 6000 rpm for about 20 minutes, about 30 minutes, about 40 minutes, about 50 minutes or about 60 minutes. In some embodiments, recombinant AAV is isolated from PEG-precipitated supernatant by centrifugation at about 5000 rpm for about 30 minutes followed by purification using a cesium chloride gradient. In some embodiments, cesium chloride purification can be replaced with IDX gradient ultracentrifugation. Supernatant can be collected at about 12 hours, about 24 hours, about 36 hours, about 48 hours, about 72 hours, about 96 hours, or about 120 hours after transfection, or a time between any of these two time points after a transfection. Supernatant can also be purified, concentrated, or a combination thereof. For example, a concentration or viral titer can be determined by qPCR or silver stain. An optimal viral titer can vary depending on cell type to be transduced. A range of virus can be from about 1000 MOI to 2000 MOI, from 1500 MOI to 2500 MOI, from 2000 MOI to 3000 MOI, from 3000 MOI to 4000 MOI, from 4000 MOI to 5000 MOI, from 5000 MOI to 6000 MOI, from 6000 MOI to 7000 MOI, from 7000 MOI to 8000 MOI, from 8000 MOI to 9000 MOI, or from 9000 MOI to 10,000 MOI. The For example, to infect 1 million cells using a MOI of 10,000, one will need 10,000×1,000,000=10.sup.10 GC.
[0152] Introduction of plasmids or viruses into a host cell can also be accomplished using techniques known to those of ordinary skill in the art and as discussed throughout the specification. In some cases, standard transfection techniques are used, e.g., calcium phosphate transfection or electroporation, and/or infection by hybrid adenovirus/AAV vectors into cell lines such as HEK 293 (a human embryonic kidney cell line containing functional adenovirus E1 genes which provides trans-acting E1 proteins). One of skill in the art will readily understand that the novel AAV sequences described herein can be readily adapted for use in these and other viral vector systems for in vitro, ex vivo, or in vivo gene delivery. Similarly, one of skill in the art can readily select other fragments of the AAV genome for use in a variety of AAV and non-AAV vector systems. Such vectors systems can include, e.g., lentiviruses, retroviruses, poxviruses, vaccinia viruses, and adenoviral systems, among others. Selection of these vector systems is not a limitation of the present disclosure.
[0153] In some embodiments, helper functions are provided by one or more helper plasmids or helper viruses comprising adenoviral helper genes. Non-limiting examples of the adenoviral helper genes include E1A, E1B, E2A, E4 and VA, which can provide helper functions to AAV packaging. In some cases, an AAV cap gene can be present in a plasmid. A plasmid can further comprise an AAV rep gene. In other cases, an AAP gene can be present in a plasmid.
[0154] Helper viruses of AAV are known in the art and include, for example, viruses from the family Adenoviridae and the family Herpesviridae. Examples of helper viruses of AAV include, but are not limited to, SAdV-13 helper virus and SAdV-13-like helper virus described in US Publication No. 20110201088, helper vectors pHELP (Applied Viromics). A skilled artisan will appreciate that any helper virus or helper plasmid of AAV that can provide adequate helper function to AAV can be used herein. The recombinant AAV viruses disclosed herein can also be produced using any convention methods known in the art suitable for producing infectious recombinant AAV. In some cases, a recombinant AAV can be produced by using a cell line that stably expresses some of the necessary components for AAV particle production. For example, a plasmid (or multiple plasmids) comprising AAV rep and cap genes, and a selectable marker, such as a neomycin resistance gene, can be integrated into the genome of a cell (the packaging cells). The packaging cell line can then be co-infected with a helper virus (e.g., adenovirus providing the helper functions) and the viral vector comprising the 5′ and 3′ AAV ITR and the nucleotide sequence encoding the protein(s) of interest. In another non-limiting example, adenovirus or baculovirus rather than plasmids can be used to introduce rep and cap genes into packaging cells. As yet another non-limiting example, both the viral vector containing the 5′ and 3′ AAV ITRs and the rep and cap genes can be stably integrated into the DNA of producer cells, and the helper functions can be provided by a WT adenovirus to produce the recombinant AAV.
[0155] In some cases, a packaging plasmid can contain all the necessary viral proteins on one plasmid to enable packing of an ITR-flanked donor template into replication-incompetent virus particles.
[0156] Suitable host cells that can be used to produce AAV virions or viral particles include yeast cells, insect cells, microorganisms, and mammalian cells. Various stable human cell lines can be used, including, but not limited to, HEK 293 cells. Host cells can be engineered to provide helper functions in order to replicate and encapsidate nucleotide sequences flanked by AAV ITRs to produce viral particles or AAV virions. AAV helper functions can be provided by AAV-derived coding sequences that are expressed in host cells to provide AAV gene products in trans for AAV replication and packaging. AAV virus can be made replication-competent or replication-incompetent. In general, a replication-incompetent AAV virus lacks one or more AAV packaging genes. Cells can be contacted with viral vectors, viral particles, or virus as described herein in vitro, in vivo, or ex vivo. In some embodiments, cells that are contacted in vitro can be derived from established cell lines or primary cells derived from a subject, either modified ex vivo for return to the subject, or allowed to grow in culture in vitro. In some aspects, a virus is used to deliver a viral vector into primary cells ex vivo to modify the cells, such as introducing an exogenous nucleic acid sequence, a transgene, or an engineered cell receptor in an immune cell, or a T-cell in particular, followed by expansion, selection, or limited number of passages in culture before such modified cells are returned back to the subject. In some aspects, such modified cells are used in cell-based therapy to treat a disease or condition, including cancer.
[0157] Any conventional methods suitable for purifying AAV can be used in the embodiments described herein to purify the recombinant AAV. For example, the recombinant AAV can be isolated and purified from packaging cells and/or the supernatant of the packaging cells. In some embodiments, the AAV can be purified by separation method using a cesium chloride gradient. Also, US Patent Publication No. 20020136710 describes another non-limiting example of method for purifying AAV, in which AAV was isolated and purified from a sample using a solid support that includes a matrix to which an artificial receptor or receptor-like molecule that mediates AAV attachment is immobilized.
[0158] Disclosed herein can be a functional AAV. A functional AAV can be an AAV characterized by the ability to produce viral particles with equivalent or greater packaging and transduction efficiency as any one of a WT AAV, such as AAV6. Function can be assessed in a pseudotyping setting with AAV6 rep and AAV6 ITRs. Thus, an altered parental AAV can be constructed using conventional techniques and the AAV vector can be considered functional if virus is produced from the parental AAV at titers of at least 50% when compared to production of a WT AAV such as AAV6. Further, the ability of AAV to transduce cells can be readily determined by one of skill in the art. For example, a parental AAV can be constructed such that it contains a marker gene which allows easy detection of virus. For example, an AAV can contain eGFP or another transgene which allows fluorescent detection. Where the AAV contains CMV-eGFP, when the virus produced from the altered parental AAV capsid is transduced into HEK 293 cells at a multiplicity of infection of 10.sup.4, function is demonstrated where transduction efficiency is greater than 5% GFP fluorescence of total cells in a context where the cells were pretreated with WT human adenovirus type 5 at a multiplicity of infection of 20 for 2 hours.
Methods of Engineering Cells Using Modified AAVs and Populations of Engineered Cells
[0159] Provided herein are compositions of cells engineered using a modified AAV described herein. In some embodiments, said cells are immune cells. In some embodiments, said cells are primary cells. In some embodiments, said cells are engineered ex vivo. In some embodiments, said cells are primary cells. In some embodiments, said cells are engineered ex vivo and administered to the subject the cells were obtained from. In some embodiments, said cells are primary cells. In some embodiments, said cells are engineered ex vivo and administered to a subject different from the subject (but of the same species) than the cells were obtained from. In some embodiments, the cells comprise T cells (e.g., CD4+ T cells, CD8+ T cells), tumor infiltrating lymphocytes (TILs), B cells, NK cells, NK T cells, macrophages, monocytes, or dendritic cells.
[0160] In some embodiments, said cells comprise a transgene integrated into the genome of the cell, wherein said integration is mediated by a modified AAV described herein. In some embodiments, the transgene encodes a cell surface receptor. In some embodiments, the transgene encodes a T cell receptor (TCR), B cell receptor, or chimeric antigen receptor (CAR). In some embodiments, the transgene is integrated into a safe harbor locus, e.g., HPRT, AAVS1, CCR5, or Rosa26. In some embodiments, the transgene is a TCR or a CAR and is integrated into TRAC or TCRB locus. In some embodiments, said transgene is integrated into a gene encoding an immune checkpoint protein. In some embodiments, said immune checkpoint protein is selected from the group consisting of cytokine inducible SH2-containing protein (CISH), programmed cell death 1 (PD-1), cytotoxic T-lymphocyte-associated protein 4 (CTLA4), adenosine A2a receptor (ADORA), CD276, V-set domain containing T cell activation inhibitor 1 (VTCN1), B and T lymphocyte associated (BTLA), indoleamine 2,3-dioxygenase 1 (IDO1), killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1 (KIR3DL1), lymphocyte-activation gene 3 (LAG3), hepatitis A virus cellular receptor 2 (HAVCR2), V-domain immunoglobulin suppressor of T-cell activation (VISTA), natural killer cell receptor 2B4 (CD244), hypoxanthine phosphoribosyltransferase 1 (HPRT), adeno-associated virus integration site 1 (AAVS1), or chemokine (C-C motif) receptor 5 (gene/pseudogene) (CCR5), CD160 molecule (CD160), T-cell immunoreceptor with Ig and ITIM domains (TIGIT), CD96 molecule (CD96), cytotoxic and regulatory T-cell molecule (CRTAM), leukocyte associated immunoglobulin like receptor 1 (LAIR1), sialic acid binding Ig like lectin 7 (SIGLEC7), sialic acid binding Ig like lectin 9 (SIGLEC9), tumor necrosis factor receptor superfamily member 10b (TNFRSF10B), tumor necrosis factor receptor superfamily member 10a (TNFRSF10A), caspase 8 (CASP8), caspase 10 (CASP10), caspase 3 (CASP3), caspase 6 (CASP6), caspase 7 (CASP7), Fas associated via death domain (FADD), Fas cell surface death receptor (FAS), transforming growth factor beta receptor II (TGFBRII), transforming growth factor beta receptor I (TGFBR1), SMAD family member 2 (SMAD2), SMAD family member 3 (SMAD3), SMAD family member 4 (SMAD4), SKI proto-oncogene (SKI), SKI-like proto-oncogene (SKIL), TGFB induced factor homeobox 1 (TGIF1), interleukin 10 receptor subunit alpha (IL10RA), interleukin 10 receptor subunit beta (IL10RB), heme oxygenase 2 (HMOX2), interleukin 6 receptor (IL6R), interleukin 6 signal transducer (IL6ST), c-src tyrosine kinase (CSK), phosphoprotein membrane anchor with glycosphingolipid microdomains 1 (PAG1), signaling threshold regulating transmembrane adaptor 1 (SIT1), forkhead box P3 (FOXP3), PR domain 1 (PRDM1), basic leucine zipper transcription factor, ATF-like (BATF), guanylate cyclase 1, soluble, alpha 2 (GUCY1A2), guanylate cyclase 1, soluble, alpha 3 (GUCY1A3), guanylate cyclase 1, soluble, beta 2 (GUCY1B2), prolyl hydroxylase domain (PHD1, PHD2, PHD3) family of proteins, or guanylate cyclase 1, soluble, beta 3 (GUCY1B3), T-cell receptor alpha locus (TRA), T cell receptor beta locus (TRB), egl-9 family hypoxia-inducible factor 1 (EGLN1), egl-9 family hypoxia-inducible factor 2 (EGLN2), egl-9 family hypoxia-inducible factor 3 (EGLN3), and protein phosphatase 1 regulatory subunit 12C (PPP1R12C).
[0161] In some embodiments, said cells comprise an alteration (e.g., disruption) of at least one gene in the genome, wherein said alteration (e.g., disruption) results in inhibition or decrease in expression of a function protein encoded by said gene. In some embodiments, said disruption is mediated by integration of a transgene into the genome of the cell, wherein said integration is mediated by a modified AAV described herein. In some embodiments, said disruption is mediated by a CRISPR system, TALEN system, Zinc Finger nuclease system, transposon-based system, ZEN system, meganuclease system, or Mega-TAL system. In some embodiments, said disruption is mediated by a CRISPR system that comprises a gRNA that binds to a target DNA sequence and a Cas endonuclease. In some embodiments, said Cas endonuclease is Cas1, Cas1B, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9, Cas10, Csy1, Csy2, Csy3, Cse1, Cse2, Csc1, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cmr5, Cmr6, Csb1, Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csx1, Csx1S, Csf1, Csf2, CsO, Csf4, Cpf1, c2c1, c2c3, Cas9HiFi, homologues thereof or modified versions thereof. In some embodiments, said Cas endonuclease is Cas9. In some embodiments, the gRNA and cas9 endonuclease are transfected into said cells (e.g., via electroporation). In some embodiments, said disruption is in a gene (coding sequence) or regulatory element of a gene (e.g., promoter or enhancer) of a gene encoding an immune checkpoint protein. In some embodiments, said disruption is in a gene (coding sequence) or regulatory element of a gene (e.g., promoter or enhancer) of a gene selected from the group consisting of cytokine inducible SH2-containing protein (CISH), programmed cell death 1 (PD-1), cytotoxic T-lymphocyte-associated protein 4 (CTLA4), adenosine A2a receptor (ADORA), CD276, V-set domain containing T cell activation inhibitor 1 (VTCN1), B and T lymphocyte associated (BTLA), indoleamine 2,3-dioxygenase 1 (IDO1), killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1 (KIR3DL1), lymphocyte-activation gene 3 (LAG3), hepatitis A virus cellular receptor 2 (HAVCR2), V-domain immunoglobulin suppressor of T-cell activation (VISTA), natural killer cell receptor 2B4 (CD244), hypoxanthine phosphoribosyltransferase 1 (HPRT), adeno-associated virus integration site 1 (AAVS1), or chemokine (C-C motif) receptor 5 (gene/pseudogene) (CCR5), CD160 molecule (CD160), T-cell immunoreceptor with Ig and ITIM domains (TIGIT), CD96 molecule (CD96), cytotoxic and regulatory T-cell molecule (CRTAM), leukocyte associated immunoglobulin like receptor 1 (LAIR1), sialic acid binding Ig like lectin 7 (SIGLEC7), sialic acid binding Ig like lectin 9 (SIGLEC9), tumor necrosis factor receptor superfamily member 10b (TNFRSF10B), tumor necrosis factor receptor superfamily member 10a (TNFRSF10A), caspase 8 (CASP8), caspase 10 (CASP10), caspase 3 (CASP3), caspase 6 (CASP6), caspase 7 (CASP7), Fas associated via death domain (FADD), Fas cell surface death receptor (FAS), transforming growth factor beta receptor II (TGFBRII), transforming growth factor beta receptor I (TGFBR1), SMAD family member 2 (SMAD2), SMAD family member 3 (SMAD3), SMAD family member 4 (SMAD4), SKI proto-oncogene (SKI), SKI-like proto-oncogene (SKIL), TGFB induced factor homeobox 1 (TGIF1), interleukin 10 receptor subunit alpha (IL10RA), interleukin 10 receptor subunit beta (IL10RB), heme oxygenase 2 (HMOX2), interleukin 6 receptor (IL6R), interleukin 6 signal transducer (IL6ST), c-src tyrosine kinase (CSK), phosphoprotein membrane anchor with glycosphingolipid microdomains 1 (PAG1), signaling threshold regulating transmembrane adaptor 1 (SIT1), forkhead box P3 (FOXP3), PR domain 1 (PRDM1), basic leucine zipper transcription factor, ATF-like (BATF), guanylate cyclase 1, soluble, alpha 2 (GUCY1A2), guanylate cyclase 1, soluble, alpha 3 (GUCY1A3), guanylate cyclase 1, soluble, beta 2 (GUCY1B2), prolyl hydroxylase domain (PHD1, PHD2, PHD3) family of proteins, or guanylate cyclase 1, soluble, beta 3 (GUCY1B3), T-cell receptor alpha locus (TRA), T cell receptor beta locus (TRB), egl-9 family hypoxia-inducible factor 1 (EGLN1), egl-9 family hypoxia-inducible factor 2 (EGLN2), egl-9 family hypoxia-inducible factor 3 (EGLN3), and protein phosphatase 1 regulatory subunit 12C (PPP1R12C).
Methods of Identifying AAV Serotypes
[0162] Disclosed herein are, inter alia, methods of identifying an AAV serotype. In some embodiments, an AAV serotype is identified using a PCR approach. Using PCR, one or ordinary skill in the art can amplify regions of the AAV genome, principally a 255 bp fragment of the capsid gene called the “signature region” in which the 5′ and 3′ sequences are conserved but the central sequence can be variable and unique to each AAV serotype. In some embodiments, the signature region is from about 50 bp, 75 bp, 80 bp, 100 bp, 125 bp, 150 bp, 175 bp, 200 bp, 225 bp, 255 bp, 260 bp, 270 bp, 280 bp, 290 bp, 300 bp, 325 bp, 350 bp, 375 bp, 400 bp, or up to about 450 bp. Primers can be designed to anneal to conserved regions of the rep and cap genes to amplify and identify novel AAV serotypes (e.g., as shown in Gao et al., 2002). The signature region of AAV can be amplified from genomic DNA (gDNA). gDNA can be extracted from a mammalian cell or a non-mammalian cell. In some cases, gDNA can be extracted from a cell line such as HCT116, HEK293, Jurkat, U-937, NCI-H838, pDG, AAV DJ, or a combination thereof. In some cases, gDNA can be extracted from a human cell. gDNA can be extracted from peripheral blood mononuclear cells (PBMCs). gDNA can be extracted from liver, heart, brain, kidney, lung, spleen, bone, skin, buccal, blood, saliva, and the like.
Methods of Using Modified AAVs and Cells Produced Using Modified AAVs to Treat Cancer
[0163] The present disclosure provides, inter alia, methods of using modified AAVs described herein to treat cancer. In some embodiments, cells engineered ex vivo using a modified AAV described herein are administered to a subject in need thereof, (e.g., a subject having cancer). In some embodiments, said cells are administered to an autologous subject. In some embodiments, said cells are administered to an allogenic subject. The dosing and regimen of administration can be determined by a person of ordinary skill in the art. In some embodiments, 0.1 to 10.0×10.sup.6 cells per kg body weight of said subject, 0.1 to 9.0×10.sup.6 cells per kg body weight of said subject, 0.1 to 8.0×10.sup.6 cells per kg body weight of said subject, 0.1 to 7.0×10.sup.6 cells per kg body weight of said subject, 0.1 to 6.0×10.sup.6 cells per kg body weight of said subject, 0.1 to 5.0×10.sup.6 cells per kg body weight of said subject, 0.1 to 4.0×10.sup.6 cells per kg body weight of said subject, 0.1 to 3.0×10.sup.6 cells per kg body weight of said subject, 0.1 to 2.0×10.sup.6 cells per kg body weight of said subject, or 0.1 to 1.0×10.sup.6 cells per kg body weight of said subject are administered to said subject. In some embodiments, 0.1 to 10×10.sup.8 cells, 0.1 to 9×10.sup.8 cells, 0.1 to 8×10.sup.8 cells, 0.1 to 7×10.sup.8 cells, 0.1 to 6×10.sup.8 cells, 0.1 to 5×10.sup.8 cells, 0.1 to 4×10.sup.8 cells, 0.1 to 3×10.sup.8 cells, 0.1 to 2×10.sup.8 cells, or 0.1 to 1×10.sup.8 cells are administered to said subject. In some embodiments, said cells are immune cells (e.g., immune cells described herein). In some embodiments, said immune cells are T cells, tumor infiltrating lymphocytes, B cells, NK cells, macrophages, monocytes, or dendritic cells.
[0164] In some embodiments, the cancer is a solid tumor. In some embodiments, the cancer is a hematological malignancy. In some embodiments, the cancer is acute lymphocytic cancer, acute myeloid leukemia, alveolar rhabdomyosarcoma, bladder cancer, bone cancer, brain cancer, breast cancer, cancer of the anus, anal canal, rectum, cancer of the eye, cancer of the intrahepatic bile duct, cancer of the joints, cancer of the neck, gallbladder, or pleura, cancer of the nose, nasal cavity, or middle ear, cancer of the oral cavity, cancer of the vulva, chronic lymphocytic leukemia, chronic myeloid cancer, colon cancer, esophageal cancer, cervical cancer, fibrosarcoma, gastrointestinal carcinoid tumor, Hodgkin lymphoma, hypopharynx cancer, kidney cancer, larynx cancer, leukemia, liquid tumors, liver cancer, lung cancer, lymphoma, malignant mesothelioma, mastocytoma, melanoma, multiple myeloma, nasopharynx cancer, non-Hodgkin lymphoma, ovarian cancer, pancreatic cancer, peritoneum, omentum, and mesentery cancer, pharynx cancer, prostate cancer, rectal cancer, renal cancer, skin cancer, small intestine cancer, soft tissue cancer, solid tumors, stomach cancer, testicular cancer, thyroid cancer, ureter cancer, and/or urinary bladder cancer. In some embodiments, the cancer is metastatic.
EXAMPLES
[0165] The present disclosure will be described in greater detail by way of the following specific examples. The following examples are offered for illustrative purposes, and are not intended to limit the disclosure in any manner. Those of skill in the art will readily recognize a variety of non-critical parameters that can be changed or modified to yield alternative embodiments according to the invention. All patents, patent applications, and printed publications listed herein are incorporated herein by reference in their entirety.
Example 1—AAP Nucleotide and Polypeptide Sequences
[0166] A number of AAV chimeras (e.g., having VP1, VP2, and VP3 sequences from at least two different AAV serotypes, resulting in chimeric AAP sequences) were identified and isolated. Among the chimeras, chimera 6, which has VP1 and VP2 sequences from AAV serotype 12 and VP3 sequence from AAV serotype 6 with a chimeric AAP sequence of AAV serotype 12 and 6, significantly increased AAV infectivity (see
TABLE-US-00003 TABLE 3 AAP Nucleic Acid and amino acid sequence of WT AAV6. AAP nucleic acid sequence AAP amino acid sequence (portion corresponding to (portion corresponding SEQ amino acids 13-27 of AAV6 SEQ ID to amino acids 13-27 of ID NO: bold and underlined) NO: AAV6 bold and underlined) 1 ctggcgactcagagtcagtccccgacccaca 2 LATQSQSPTHNLSENLQQPPLLW acctctcggagaacctccagcaacccccgc DLLQWLQAVAHQWQTITKAPTE tgctgtgggacctactacaatggcttcaggc WVMPQEIGIAIPHGWATESSPPAP ggtggcgcaccaatggcagacaataacgaa EHGPCPPITTTSTSKSPVLQRGPAT ggcgccgacggagtgggtaatgcctcagga TTTTSATAPPGGILISTDSTAISHH aattggcattgcgattccacatggctgggcga VTGSDSSTTIGDSGPRDSTSSSSTS cagagtcatcaccaccagcacccgaacatgg KSRRSRRMMASRPSLITLPARFKS gccttgcccacctataacaaccacctctacaa SRTRSTSCRTSSALRTRAASLRSR gcaaatctccagtgcttcaacgggggccagc RTCS aacgacaaccactacttcggctacagcaccc cctgggggtattttgatttcaacagattccactg ccatttctcaccacgtgactggcagcgactcat caacaacaattggggattccggcccaagaga ctcaacttcaagctcttcaacatccaagtcaag gaggtcacgacgaatgatggcgtcacgacca tcgctaataaccttaccagcacggttcaagtctt ctcggactcggagtaccagttgccgtacgtcc tcggctctgcgcaccagggctgcctccctccg ttcccggcggacgtgttcatga
TABLE-US-00004 TABLE 4 AAP Nucleic Acid Sequences of Chimeras (Chimeras 3, 4, 5, and 6 have AAP sequences formed from two different AAV serotypes.) SEQ ID Chimera NO: AAP nucleic acid sequence Chimera 2 3 ctggcgactcagagtcagtccccgacccacaacctctcggagaacctccagcaacccccgctgctgtg AAV5VP1u- ggacctactacaatggcttcaggcggtggcgcaccaatggcagacaataacgaaggcgccgacggag AAV6VP2/3 tgggtaatgcctcaggaaattggcattgcgattccacatggctgggcgacagagtcatcaccaccagca cccgaacatgggccttgcccacctataacaaccacctctacaagcaaatctccagtgcttcaacggggg ccagcaacgacaaccactacttcggctacagcaccccctgggggtattttgatttcaacagattccactgc catttctcaccacgtgactggcagcgactcatcaacaacaattggggattccggcccaagagactcaact tcaagctcttcaacatccaagtcaaggaggtcacgacgaatgatggcgtcacgaccatcgctaataacct taccagcacggttcaagtcttctcggactcggagtaccagttgccgtacgtcctcggctctgcgcaccag ggctgcctccctccgttcccggcggacgtgttcatga Chimera 3 4 ttgaatccccccagcagcccgactcctccacgggtatcggcaaaaaaggcaagcagccggctaaaaa rAAV4P1/2- gaagctcgttttcgaagacgaaactggagcaggcgacggaccccctgagggatcaacttccggagcc AAV6VP3 atgtctgatgacagtgagatggcttcaggcggtggcgcaccaatggcagacaataacgaaggcgccga cggagtgggtaatgcctcaggaaattggcattgcgattccacatggctgggcgacagagtcatcaccac cagcacccgaacatgggccttgcccacctataacaaccacctctacaagcaaatctccagtgcttcaacg ggggccagcaacgacaaccactacttcggctacagcaccccctgggggtattttgatttcaacagattcc actgccatttctcaccacgtgactggcagcgactcatcaacaacaattggggattccggcccaagagact caacttcaagctcttcaacatccaagtcaaggaggtcacgacgaatgatggcgtcacgaccatcgctaat aaccttaccagcacggttcaagtcttctcggactcggagtaccagttgccgtacgtcctcggctctgcgca ccagggctgcctccctccgttcccggcggacgtgttcatga Chimera 4 5 acgaccactttccaaaaagaaagaaggctcggaccgaagaggactccaagccttccacctcgtcagac rAAV5VP1/2- gccgaagctggacccagcggatcccagcagctgcaaatcccagcccaaccagcctcaagtttgggag AAV6VP3 ctgatacaatggcttcaggcggtggcgcaccaatggcagacaataacgaaggcgccgacggagtggg taatgcctcaggaaattggcattgcgattccacatggctgggcgacagagtcatcaccaccagcacccg aacatgggccttgcccacctataacaaccacctctacaagcaaatctccagtgcttcaacgggggccag caacgacaaccactacttcggctacagcaccccctgggggtallllgatttcaacagattccactgccattt ctcaccacgtgactggcagcgactcatcaacaacaattggggattccggcccaagagactcaacttcaa gctcttcaacatccaagtcaaggaggtcacgacgaatgatggcgtcacgaccatcgctaataaccttacc agcacggttcaagtcttctcggactcggagtaccagttgccgtacgtcctcggctctgcgcaccagggct gcctccctccgttcccggcggacgtgttcatga Chimera 5 6 agtcaccacaagagcccgactcctcctcgggcatcggcaaaaaaggcaaacaaccagccagaaaga rAAV11VP1/2- ggctcaactttgaagaggacactggagccggagacggaccccctgaaggatcagataccagcgccat AAV6VP3 gtcttcagacattgaaatggcttcaggcggtggcgcaccaatggcagacaataacgaaggcgccgacg gagtgggtaatgcctcaggaaattggcattgcgattccacatggctgggcgacagagtcatcaccacca gcacccgaacatgggccttgcccacctataacaaccacctctacaagcaaatctccagtgcttcaacgg gggccagcaacgacaaccactacttcggctacagcaccccctgggggtattttgatttcaacagattcca ctgccatttctcaccacgtgactggcagcgactcatcaacaacaattggggattccggcccaagagactc aacttcaagctcttcaacatccaagtcaaggaggtcacgacgaatgatggcgtcacgaccatcgctaata accttaccagcacggttcaagtcttctcggactcggagtaccagttgccgtacgtcctcggctctgcgcac cagggctgcctccctccgttcccggcggacgtgttcatga Chimera 6 7 aaaagactccaaatcggccgaccaacccggactctgggaaggccccggccaagaaaaagcaaaaag AAV12VP1/2- acggcgaaccagccgactctgctagaaggacactcgactttgaagactctggagcaggagacggacc AAV6VP3 ccctgagggatcatcttccggagaaatgtctcatgatgctgagatggcttcaggcggtggcgcaccaatg gcagacaataacgaaggcgccgacggagtgggtaatgcctcaggaaattggcattgcgattccacatg gctgggcgacagagtcatcaccaccagcacccgaacatgggccttgcccacctataacaaccacctct acaagcaaatctccagtgcttcaacgggggccagcaacgacaaccactacttcggctacagcaccccc tgggggtattttgatttcaacagattccactgccatttctcaccacgtgactggcagcgactcatcaacaac aattggggattccggcccaagagactcaacttcaagctcttcaacatccaagtcaaggaggtcacgacg aatgatggcgtcacgaccatcgctaataaccttaccagcacggttcaagtcttctcggactcggagtacc agttgccgtacgtcctcggctctgcgcaccagggctgcctccctccgttcccggcggacgtgttcatga Chimera 7 8 ctggcgactcagagtcagtccccgacccacaacctctcggagaacctccagcaacccccgctgctgtg AAV4VP1u- ggacctactacaatggcttcaggcggtggcgcaccaatggcagacaataacgaaggcgccgacggag AAV6VP2/3 tgggtaatgcctcaggaaattggcattgcgattccacatggctgggcgacagagtcatcaccaccagca cccgaacatgggccttgcccacctataacaaccacctctacaagcaaatctccagtgcttcaacggggg ccagcaacgacaaccactacttcggctacagcaccccctgggggtattttgatttcaacagattccactgc catttctcaccacgtgactggcagcgactcatcaacaacaattggggattccggcccaagagactcaact tcaagctcttcaacatccaagtcaaggaggtcacgacgaatgatggcgtcacgaccatcgctaataacct taccagcacggttcaagtcttctcggactcggagtaccagttgccgtacgtcctcggctctgcgcaccag ggctgcctccctccgttcccggcggacgtgttcatga Chimera 8 9 ctggcgactcagagtcagtccccgacccacaacctctcggagaacctccagcaacccccgctgctgtg AAV12VP1u- ggacctactacaatggcttcaggcggtggcgcaccaatggcagacaataacgaaggcgccgacggag AAV6VP2/3 tgggtaatgcctcaggaaattggcattgcgattccacatggctgggcgacagagtcatcaccaccagca cccgaacatgggccttgcccacctataacaaccacctctacaagcaaatctccagtgcttcaacggggg ccagcaacgacaaccactacttcggctacagcaccccctgggggtattttgatttcaacagattccactgc catttctcaccacgtgactggcagcgactcatcaacaacaattggggattccggcccaagagactcaact tcaagctcttcaacatccaagtcaaggaggtcacgacgaatgatggcgtcacgaccatcgctaataacct taccagcacggttcaagtcttctcggactcggagtaccagttgccgtacgtcctcggctctgcgcaccag ggctgcctccctccgttcccggcggacgtgttcatga Chimera 10 aaaagactccaaatcggccgaccaacccggactctgggaaggccccggccaagaaaaagcaaaaag 6.1 acggcgaaccagccgactctgctagaaggacactcgactttgaagactctggagcaggagacggact AAV12VP1u- cggagaacctccagcaacccccgctgctgtgggacctactacaatggcttcaggcggtggcgcacc AAV6VP2/3 aatggcagacaataacgaaggcgccgacggagtgggtaatgcctcaggaaattggcattgcgattcca catggctgggcgacagagtcatcaccaccagcacccgaacatgggccttgcccacctataacaaccac ctctacaagcaaatctccagtgcttcaacgggggccagcaacgacaaccactacttcggctacagcacc ccctgggggtattttgatttcaacagattccactgccatttctcaccacgtgactggcagcgactcatcaac aacaattggggattccggcccaagagactcaacttcaagctcttcaacatccaagtcaaggaggtcacg acgaatgatggcgtcacgaccatcgctaataaccttaccagcacggttcaagtcttctcggactcggagt accagttgccgtacgtcctcggctctgcgcaccagggctgcctccctccgttcccggcggacgtgttcat ga Chimera 11 aaaagactccaaatcggccgaccaacccggactctgggaaggccccggccaagaaaaagcaaaaag 6.2 acggcgaaccagccgactctgctagaaggacactcgactttgaagactctggagcaggagacggact AAV12VP1u- cggagaacctccagcaacccccgaaatgtctcatgatgctgagatggcttcaggcggtggcgcacc AAV6VP2/3 aatggcagacaataacgaaggcgccgacggagtgggtaatgcctcaggaaattggcattgcgattcca catggctgggcgacagagtcatcaccaccagcacccgaacatgggccttgcccacctataacaaccac ctctacaagcaaatctccagtgcttcaacgggggccagcaacgacaaccactacttcggctacagcacc ccctgggggtattttgatttcaacagattccactgccatttctcaccacgtgactggcagcgactcatcaac aacaattggggattccggcccaagagactcaacttcaagctcttcaacatccaagtcaaggaggtcacg acgaatgatggcgtcacgaccatcgctaataaccttaccagcacggttcaagtcttctcggactcggagt accagttgccgtacgtcctcggctctgcgcaccagggctgcctccctccgttcccggcggacgtgttcat ga Chimera 12 aaaagactccaaatcggccgaccaacccggactctgggaaggccccggccaagaaaaagcaaaaag 6.3 acggcgaaccagccgactctgctagaaggacactcgactttgaagactctggagcaggagacggacc AAV12VP1u- ccctgagggatcatcttccggagctgctgtgggacctactacaatggcttcaggcggtggcgcacca AAV6VP2/3 atggcagacaataacgaaggcgccgacggagtgggtaatgcctcaggaaattggcattgcgattccac atggctgggcgacagagtcatcaccaccagcacccgaacatgggccttgcccacctataacaaccacc tctacaagcaaatctccagtgcttcaacgggggccagcaacgacaaccactacttcggctacagcaccc cctgggggtattttgatttcaacagattccactgccatttctcaccacgtgactggcagcgactcatcaaca acaattggggattccggcccaagagactcaacttcaagctcttcaacatccaagtcaaggaggtcacga cgaatgatggcgtcacgaccatcgctaataaccttaccagcacggttcaagtcttctcggactcggagta ccagttgccgtacgtcctcggctctgcgcaccagggctgcctccctccgttcccggcggacgtgttcatg a Chimera 13 aaaagactccaaatcggccgaccaacccggactctgggaaggccccggccaagaaaaagcaaaaag 6.4 acggcgaaccagccgactctgctagaaggacactcgactttgaagactctggagcaggagacggacc AAV12VPlu- ccctgagggatcatcttccggagaaatgtctcatgatgctgcaatggcttcaggcggtggcgcacca AAV6VP2/3 atggcagacaataacgaaggcgccgacggagtgggtaatgcctcaggaaattggcattgcgattccac atggctgggcgacagagtcatcaccaccagcacccgaacatgggccttgcccacctataacaaccacc tctacaagcaaatctccagtgcttcaacgggggccagcaacgacaaccactacttcggctacagcaccc cctgggggtattttgatttcaacagattccactgccatttctcaccacgtgactggcagcgactcatcaaca acaattggggattccggcccaagagactcaacttcaagctcttcaacatccaagtcaaggaggtcacga cgaatgatggcgtcacgaccatcgctaataaccttaccagcacggttcaagtcttctcggactcggagta ccagttgccgtacgtcctcggctctgcgcaccagggctgcctccctccgttcccggcggacgtgttcatg a Chimera 14 aaaagactccaaatcggccgaccaacccggactctgggaaggccccggccaagaaaaagcaaaaag 6.5 acggcgaaccagccgactctgctagaaggacactcgactttgaagactctggagcaggagacggacc AAV12VP1u- ccctgagggatcatcttccggagaaatgtctcgacatgctgagatggcttcaggcggtggcgcacc AAV6VP2/3 aatggcagacaataacgaaggcgccgacggagtgggtaatgcctcaggaaattggcattgcgattcca catggctgggcgacagagtcatcaccaccagcacccgaacatgggccttgcccacctataacaaccac ctctacaagcaaatctccagtgcttcaacgggggccagcaacgacaaccactacttcggctacagcacc ccctgggggtattttgatttcaacagattccactgccatttctcaccacgtgactggcagcgactcatcaac aacaattggggattccggcccaagagactcaacttcaagctcttcaacatccaagtcaaggaggtcacg acgaatgatggcgtcacgaccatcgctaataaccttaccagcacggttcaagtcttctcggactcggagt accagttgccgtacgtcctcggctctgcgcaccagggctgcctccctccgttcccggcggacgtgttcat ga Chimera 15 aaaagactccaaatcggccgaccaacccggactctgggaaggccccggccaagaaaaagcaaaaag 6.6 acggcgaaccagccgactctgctagaaggacactcgactttgaagactctggagcaggagacggacc AAV12VP1u- ccctgagggatcatcttccggagaaactgctcatgatgctgagatggcttcaggcggtggcgcacc AAV6VP2/3 aatggcagacaataacgaaggcgccgacggagtgggtaatgcctcaggaaattggcattgcgattcca catggctgggcgacagagtcatcaccaccagcacccgaacatgggccttgcccacctataacaaccac ctctacaagcaaatctccagtgcttcaacgggggccagcaacgacaaccactacttcggctacagcacc ccctgggggtattttgatttcaacagattccactgccatttctcaccacgtgactggcagcgactcatcaac aacaattggggattccggcccaagagactcaacttcaagctcttcaacatccaagtcaaggaggtcacg acgaatgatggcgtcacgaccatcgctaataaccttaccagcacggttcaagtcttctcggactcggagt accagttgccgtacgtcctcggctctgcgcaccagggctgcctccctccgttcccggcggacgtgttcat ga
TABLE-US-00005 TABLE 5 AAP Amino Acid Sequences of Chimeras (amino acids 13-27 of AAV6 AAP or corresponding amino acids in AAP of Chimera 6, 6.1, 6.2, 6.3, 6.4, 6.5 and 6.6 are underlined; SEQ ID NO: 9 is the same for WT AAV6 and Chimeras 2, 7, and 8) SEQ ID Chimera NO: AAP amino acid sequence Chimera 2 2 LATQSQSPTHNLSENLQQPPLLWDLLQWLQAVAHQWQTITKAP AAV5VP1u- TEWVMPQEIGIAIPHGWATESSPPAPEHGPCPPITTTSTSKSPVLQ AAV6VP2/3 RGPATTTTTSATAPPGGILISTDSTAISHHVTGSDSSTTIGDSGPR DSTSSSSTSKSRRSRRMMASRPSLITLPARFKSSRTRSTSCRTSSA LRTRAASLRSRRTCS Chimera 7 2 LATQSQSPTHNLSENLQQPPLLWDLLQWLQAVAHQWQTITKAP AAV4VP1u- TEWVMPQEIGIAIPHGWATESSPPAPEHGPCPPITTTSTSKSPVLQ AAV6VP2/3 RGPATTTTTSATAPPGGILISTDSTAISHHVTGSDSSTTIGDSGPR DSTSSSSTSKSRRSRRMMASRPSLITLPARFKSSRTRSTSCRTSSA LRTRAASLRSRRTCS Chimera 8 2 LATQSQSPTHNLSENLQQPPLLWDLLQWLQAVAHQWQTITKAP AAV12VP1u- TEWVMPQEIGIAIPHGWATESSPPAPEHGPCPPITTTSTSKSPVLQ AAV6VP2/3 RGPATTTTTSATAPPGGILISTDSTAISHHVTGSDSSTTIGDSGPR DSTSSSSTSKSRRSRRMMASRPSLITLPARFKSSRTRSTSCRTSSA LRTRAASLRSRRTCS Chimera 3 16 LNPPSSPTPPRVSAKKASSRLKRSSFSKTKLEQATDPLRDQLPEP rAAV4P1/2- CLMTVRWLQAVAHQWQTITKAPTEWVMPQEIGIAIPHGWATE AAV6VP3 SSPPAPEHGPCPPITTTSTSKSPVLQRGPATTTTTSATAPPGGILIS TDSTAISHHVTGSDSSTTIGDSGPRDSTSSSSTSKSRRSRRMMAS RPSLITLPARFKSSRTRSTSCRTSSALRTRAASLRSRRTCS Chimera 4 17 TTTFQKERRLGPKRTPSLPPRQTPKLDPADPSSCKSQPNQPQVW rAAV5VP1/2- ELIQWLQAVAHQWQTITKAPTEWVMPQEIGIAIPHGWATESSPP AAV6VP3 APEHGPCPPITTTSTSKSPVLQRGPATTTTTSATAPPGGILISTDST AISHHVTGSDSSTTIGDSGPRDSTSSSSTSKSRRSRRMMASRPSLI TLPARFKSSRTRSTSCRTSSALRTRAASLRSRRTCS Chimera 5 18 SHHKSPTPPRASAKKANNQPERGSTLKRTLEPETDPLKDQIPAP rAAV11VP1/2- CLQTLKWLQAVAHQWQTITKAPTEWVMPQEIGIAIPHGWATES AAV6VP3 SPPAPEHGPCPPITTTSTSKSPVLQRGPATTTTTSATAPPGGILIST DSTAISHHVTGSDSSTTIGDSGPRDSTSSSSTSKSRRSRRMMASR PSLITLPARFKSSRTRSTSCRTSSALRTRAASLRSRRTCS Chimera 6 19 KRLQIGRPTRTLGRPRPRKSKKTANQPTLLEGHSTLKTLEQETD AAV12VP1/2- PLRDHLPEKCLMMLRWLQAVAHQWQTITKAPTEWVMPQEIGI AAV6VP3 AIPHGWATESSPPAPEHGPCPPITTTSTSKSPVLQRGPATTTTTSA TAPPGGILISTDSTAISHHVTGSDSSTTIGDSGPRDSTSSSSTSKSR RSRRMMASRPSLITLPARFKSSRTRSTSCRTSSALRTRAASLRSR RTCS Chimera 20 KRLQIGRPTRTLGRPRPRKSKKTANQPTLLEGHSTLKTLEQETD 6.1 SENLQQPPLLWDLLQWLQAVAHQWQTITKAPTEWVMPQEIGI AAV12VP1/2- AIPHGWATESSPPAPEHGPCPPITTTSTSKSPVLQRGPATTTTTSA AAV6VP3 TAPPGGILISTDSTAISHHVTGSDSSTTIGDSGPRDSTSSSSTSKSR RSRRMMASRPSLITLPARFKSSRTRSTSCRTSSALRTRAASLRSR RTCS Chimera 21 KRLQIGRPTRTLGRPRPRKSKKTANQPTLLEGHSTLKTLEQETD 6.2 SENLQQPPKCLMMLRWLQAVAHQWQTITKAPTEWVMPQEIGI AAV12VP1/2- AIPHGWATESSPPAPEHGPCPPITTTSTSKSPVLQRGPATTTTTSA AAV6VP3 TAPPGGILISTDSTAISHHVTGSDSSTTIGDSGPRDSTSSSSTSKSR RSRRMMASRPSLITLPARFKSSRTRSTSCRTSSALRTRAASLRSR RTCS Chimera 22 KRLQIGRPTRTLGRPRPRKSKKTANQPTLLEGHSTLKTLEQETD 6.3 PLRDHLPELLWDLLQWLQAVAHQWQTITKAPTEWVMPQEIGI AAV12VP1/2- AIPHGWATESSPPAPEHGPCPPITTTSTSKSPVLQRGPATTTTTSA AAV6VP3 TAPPGGILISTDSTAISHHVTGSDSSTTIGDSGPRDSTSSSSTSKSR RSRRMMASRPSLITLPARFKSSRTRSTSCRTSSALRTRAASLRSR RTCS Chimera 23 KRLQIGRPTRTLGRPRPRKSKKTANQPTLLEGHSTLKTLEQETD 6.4 PLRDHLPEKCLMMLQWLQAVAHQWQTITKAPTEWVMPQEIGI AAV12VP1/2- AIPHGWATESSPPAPEHGPCPPITTTSTSKSPVLQRGPATTTTTSA AAV6VP3 TAPPGGILISTDSTAISHHVTGSDSSTTIGDSGPRDSTSSSSTSKSR RSRRMMASRPSLITLPARFKSSRTRSTSCRTSSALRTRAASLRSR RTCS Chimera 24 KRLQIGRPTRTLGRPRPRKSKKTANQPTLLEGHSTLKTLEQETD 6.5 PLRDHLPEKCLDMLRWLQAVAHQWQTITKAPTEWVMPQEIGI AAV12VP1/2- AIPHGWATESSPPAPEHGPCPPITTTSTSKSPVLQRGPATTTTTSA AAV6VP3 TAPPGGILISTDSTAISHHVTGSDSSTTIGDSGPRDSTSSSSTSKSR RSRRMMASRPSLITLPARFKSSRTRSTSCRTSSALRTRAASLRSR RTCS Chimera 25 KRLQIGRPTRTLGRPRPRKSKKTANQPTLLEGHSTLKTLEQETD 6.6 PLRDHLPEKLLMMLRWLQAVAHQWQTITKAPTEWVMPQEIGI AAV12VP1/2- AIPHGWATESSPPAPEHGPCPPITTTSTSKSPVLQRGPATTTTTSA AAV6VP3 TAPPGGILISTDSTAISHHVTGSDSSTTIGDSGPRDSTSSSSTSKSR RSRRMMASRPSLITLPARFKSSRTRSTSCRTSSALRTRAASLRSR RTCS
TABLE-US-00006 TABLE 6 WT AAV alternative reading frame (AAP) amino acid and nucleic acid sequences SEQ ID SEQ ID Construct NO Amino acid sequence NO Nucleic acid sequence AAV6 1 LATQSQSPTHNLSENLQQ 2 ctggcgactcagagtcagtccccga PPLLWDLLQWLQAVAHQ cccacaacctctcggagaacctcca WQTITKAPTEWVMPQEI gcaacccccgctgctgtgggaccta GIAIPHGWATESSPPAPEH ctacaatggcttcaggcggtggcgc GPCPPITTTSTSKSPVLQR accaatggcagacaataacgaagg GPATTTTTSATAPPGGILI cgccgacggagtgggtaatgcctca STDSTAISHHVTGSDSSTT ggaaattggcattgcgattccacatg IGDSGPRDSTSSSSTSKSR gctgggcgacagagtcatcaccacc RSRRMMASRPSLITLPAR agcacccgaacatgggccttgccca FKSSRTRSTSCRTSSALRT cctataacaaccacctctacaagcaa RAASLRSRRTCS atctccagtgcttcaacgggggcca gcaacgacaaccactacttcggcta cagcaccccctgggggtattttgattt caacagattccactgccatttctcacc acgtgactggcagcgactcatcaac aacaattggggattccggcccaaga gactcaacttcaagctcttcaacatcc aagtcaaggaggtcacgacgaatga tggcgtcacgaccatcgctaataacc ttaccagcacggttcaagtcttctcgg actcggagtaccagttgccgtacgtc ctcggctctgcgcaccagggctgcc tccctccgttcccggcggacgtgttc atga AAV4 36 LNPPSSPTPPRVSAKKASS 40 ttgaatccccccagcagcccgactc RLKRSSFSKTKLEQATDP ctccacgggtatcggcaaaaaaggc LRDQLPEPCLMTVRCVQ aagcagccggctaaaaagaagctc QLAELQSRADKVPMEWV gattcgaagacgaaactggagcag MPRVIGIAIPPGLRATSRP gcgacggaccccctgagggatcaa PAPEPGSCPPTTTTSTSDS cttccggagccatgtctgatgacagt ERACSPTPTTDSPPPGDTL gagatgcgtgcagcagctggcgga TSTASTATSHHVTGSDSS gctgcagtcgagggcggacaaggt TTTGACDPKPCGSKS STS gccgatggagtgggtaatgcctcgg RSRRSRRRTARQRWLITL gtgattggcattgcgattccacctggt PARFRSLRTRRTNCRT ctgagggccacgtcacgaccacca gcaccagaacctgggtcttgcccac ctacaacaaccacctctacaagcga ctcggagagagcctgcagtccaaca cctacaacggattctccaccccctgg ggatactttgacttcaaccgcttccac tgccacttctcaccacgtgactggca gcgactcatcaacaacaactggggc atgcgacccaaagccatgcgggtca aaatcttcaacatccaggtcaaggag gtcacgacgtcgaacggcgagaca acggtggctaataaccttaccagcac ggttcagatctttgcggactcgtcgta cgaactgccgtacgtga AAV5 37 TTTFQKERRLGPKRTPSL 41 acgaccactttccaaaaagaaagaa PPRQTPKLDPADPSSCKS ggctcggaccgaagaggactccaa QPNQPQVWELIQCLREV gccttccacctcgtcagacgccgaa AAHWATITKVPMEWAM gctggacccagcggatcccagcag PREIGIAIPRGWGTESSPS ctgcaaatcccagcccaaccagcct PPEPGCCPATTTTSTERSK caagtttgggagctgatacaatgtct AAPSTEATPTPTLDTAPP gcgggaggtggcggcccattgggc GGTLTLTASTATGAPETG gacaataaccaaggtgccgatggag KDSSTTTGASDPGPSESK tgggcaatgcctcgggagattggca SSTFKSKRSRCRTPPPPSP ttgcgattccacgtggatgggggac TTSPPPSKCLRTTTTSCPT agagtcgtcaccaagtccacccgaa SSATGPRDACRPSLRRSL cctgggtgctgcccagctacaacaa RCRSTVTRR ccaccagtaccgagagatcaaaagc ggctccgtcgacggaagcaacgcc aacgcctactttggatacagcacccc ctgggggtactttgactttaaccgctt ccacagccactggagcccccgaga ctggcaaagactcatcaacaactact ggggcttcagaccccggtccctcag agtcaaaatcttcaacattcaagtcaa agaggtcacggtgcaggactccacc accaccatcgccaacaacctcacctc caccgtccaagtgtttacggacgac gactaccagctgccctacgtcgtcg gcaacgggaccgagggatgcctgc cggccttccctccgcaggtctttacg ctgccgcagtacggttacgcgacgc tga AAV11 38 SHHKSPTPPRASAKKANN 42 agtcaccacaagagcccgactcctc QPERGSTLKRTLEPETDP ctcgggcatcggcaaaaaaggcaa LKDQIPAPCLQTLKCVQH acaaccagccagaaagaggctcaa RAEMLSMRDKVPMEWV ctttgaagaggacactggagccgga MPRVIGIAIPPGLRARSQQ gacggaccccctgaaggatcagata PRPEPGSCPPTTTTCTCVS ccagcgccatgtcttcagacattgaa EQHQAATPTTDSPPPGDI atgcgtgcagcaccgggcggaaat LTSTDSTVTSHHVTGKDS gctgtcgatgcgggacaaggttccg STTTGDYDQKPCALKSSI atggagtgggtaatgcctcgggtgat SKLRRSQRRTARLRSLITL tggcattgcgattccacctggtctga PARFRYLRTRRMSSRT gggcaaggtcacaacaacctcgac cagaacctgggtcttgcccacctaca acaaccacttgtacctgcgtctcgga acaacatcaagcagcaacacctaca acggattctccaccccctggggatat tttgacttcaacagattccactgtcact tctcaccacgtgactggcaaagactc atcaacaacaactggggactacgac caaaagccatgcgcgttaaaatcttc aatatccaagttaaggaggtcacaac gtcgaacggcgagactacggtcgct aataaccttaccagcacggttcagat atttgcggactcgtcgtatgagctccc gtacgtga AAV12 39 KRLQIGRPTRTLGRPRPR 43 aaaagactccaaatcggccgaccaa KSKKTANQPTLLEGHSTL cccggactctgggaaggccccggc KTLEQETDPLRDHLPEKC caagaaaaagcaaaaagacggcga LMMLRCVRRQAEMLSRR accagccgactctgctagaaggaca DKVPMEWVMPPVIGIAIP ctcgactttgaagactctggagcagg PGQRAESPPPAPEPGSYP agacggaccccctgagggatcatct RTTTTCTCESEQRPTATP tccggagaaatgtctcatgatgctga TTDSPPPGDTLTLTASTA gatgcgtgcggcgccaggcggaaa TFPHATGSDSSTTTGDSG tgctgtcgaggcgggacaaggtgcc RNRCVLKSSTYRSRRSRR gatggagtgggtaatgcctccggtg QTARLRSLITLPARFRSLR attggcattgcgattccacctggtcag IRRMNSHT agggccgagtcaccaccaccagca cccgaacctgggtcctacccacgta caacaaccacctgtacctgcgaatc ggaacaacggccaacagcaacacc tacaacggattctccaccccctgggg atactttgactttaaccgcttccactgc cacttttccccacgcgactggcagcg actcatcaacaacaactggggactc aggccgaaatcgatgcgtgttaaaat cttcaacatacaggtcaaggaggtca cgacgtcaaacggcgagactacggt cgctaataaccttaccagcacggttc agatctttgcggattcgacgtatgaac tcccatacgtga
Example 2—Viral Titer of Chimeras 6, 6.1, 6.2, 6.3, 6.4, 6.5, and 6.6
[0167] The AAV vectors containing AAV chimera 6, 6.1, 6.2, 6.3, 6.4, 6.5, or 6.6 were transformed into One Shot TOP10 Chemically Competent E. coli (Thermo Fisher). One mg of plasmid DNA for each vector was purified from the bacteria using the EndoFree Plasmid Maxi Kit (Qiagen) and sent to Vigene Biosciences, MD USA, for production of infectious AAV. The titer of the purified virus was determined (
[0168] The virus titer data show that chimera 6.1 has a viral titer that is similar to WT AAV6, which is about 1000× higher than chimera 6, as shown in
Example 3—T-Cells Transduced with Chimeras 6, 6.1, and 6.3
[0169] To determine how chimera 6, chimera 6.1, and chimera 6.3 each compares to WT AAV6 at a MOI of 1e6, 1e5, and 1e4 GC (genome copies)/mL in terms of infectivity, T-cells were infected with WT AAV6, chimera 6, chimera 6.1, or chimera 6.3 (CMV NanoLuc virus) at an MOI of 1e6, 1e5, or 1e4 GC/mL.
[0170] NanoLuc results in
Example 4—Viral Titer of Chimera 6 Produced in the Presence of WT AAV6 AAP
[0171] The AAV vector plasmids containing AAV chimera 6 either produced with or without the presence of Met or Leu versions of WT AAV6 AAP (Met and Leu versions only differ in their start codon) were transformed into One Shot TOP10 Chemically Competent E. coli (Thermo Fisher). One mg of plasmid DNA for each vector was purified from the bacteria using the EndoFree Plasmid Maxi Kit (Qiagen) and sent to Vigene Biosciences, MD USA, for production of infectious AAV. The titer of the purified virus was then determined (
[0172] Vigene virus titer data show that chimera 6 produced in the presence of the Met version of WT AAV6 AAP has about 65× higher virus titer than chimera 6, as shown in
Example 5—T-Cells Transduced with Chimera 6 in the Presence of WT AAV6 AAP
[0173] To determine how chimera 6 (alone) or chimera 6 plus a WT AAV6 AAP sequence in trans (either Met or Leu version; Met and Leu versions only differ in their start codon) compares to WT AAV6 at a MOI of 1e4 GC/mL in terms of infectivity, T-cells were infected with WT AAV6, chimera 6, or chimera 6 with a trans WT AAV6 AAP (CMV NanoLuc virus) at a MOI of 1e4 GC/mL.
[0174] NanoLuc results show that, as compared to WT, both chimera 6 (about 100×) and chimera 6 produced in the presence of WT AAV6 AAP (about 100× for the Met version and about 10× for the Leu version) show increased luminescence (RLU), or superior infectivity in T-cells, as shown in