NUTRIENT MEDIA FOR THE PRODUCTION OF SLAUGHTER-FREE MEAT
20220073870 · 2022-03-10
Inventors
- Kalle Lukyan Johnson (Orinda, CA, US)
- Patricia R. BENTON (Huntington Beach, CA, US)
- Cameron Gentry COPELAND (Walnut Creek, CA, US)
- Sukhdeep Singh DHADWAR (El Cerrito, CA, US)
- Meri Teresa FIRPO (Oakland, CA, US)
- Marie Elizabeth GIBBONS (Emeryville, CA, US)
- Stephen K. Hsu (Albany, CA, US)
- Robert SIERRA (Berkeley, CA, US)
- Kevin John KAYSER (Chesterfield, MO, US)
Cpc classification
C12N2501/113
CHEMISTRY; METALLURGY
C12N2501/165
CHEMISTRY; METALLURGY
C12N5/0043
CHEMISTRY; METALLURGY
C12N2501/117
CHEMISTRY; METALLURGY
C12N2501/115
CHEMISTRY; METALLURGY
C12N2501/155
CHEMISTRY; METALLURGY
International classification
Abstract
Provided herein are nutrient media formulations and engineered growth factors, and methods thereof, useful for the production of slaughter-free meat.
Claims
1-31. (canceled)
32. A method for formulating a nutrient medium for the production of slaughter-free meat comprising: (a) providing a plurality of ingredients; and (b) one or more of: (i) replacing one or more ingredients currently not approved for use in food with an ingredient approved for use in food, comprising one or more of; A. wherein poloxamer is replaced with methylcellulose; B. wherein cobalt chloride is replaced with cyanocobalamin; C. wherein an anti-foaming agent currently not approved for use in food is replaced with simethicone; and D. wherein one or more ammonium molybdate, sodium molybdate, ammonium metavanadate, sodium metavanadate, rubidium chloride and strontium chloride hexahydrate is replaced with ferric ammonium citrate; (ii) removing one or more ingredients currently not approved for use in food; and (iii) formulating one or more ingredients currently not approved for use in food at or below ADI value.
33. The method of claim 32, wherein (i) replacing one or more ingredients currently not approved for use in food with an ingredient approved for use in food comprises replacing one or more of hypoxanthine, putrescine, and thymidine with optimized amino acid blends within the concentration ranges shown in Table 1.
34. The method of claim 32, wherein (i) replacing one or more ingredients currently not approved for use in food with an ingredient approved for use in food comprises replacing DL-alpha lipoic acid with plant derived oils or yeast hydrolysates.
35. The method of claim 32, wherein (i) replacing one or more ingredients currently not approved for use in food with an ingredient approved for use in food comprises replacing one or more category 3 ingredient with a category 1 or 2 ingredient listed in Table 16.
36. The method of claim 32, wherein (ii) removing one or more ingredients currently not approved for use in food comprises removing cobalt chloride.
37. The method of claim 32, wherein (ii) removing one or more ingredients currently not approved for use in food comprises removing one or more of rubidium chloride, strontium chloride hexahydrate, ammonium metavanadate, sodium metavanadate, ammonium molybdate, sodium molybdate, hypoxanthine, putrescine, thymidine, and DL-alpha-lipoic acid.
38. The method of claim 32, wherein (ii) removing one or more ingredients currently not approved for use in food comprises removing one or more category 3 ingredient listed in Table 16.
39. The method of claim 32, wherein (iii) formulating one or more ingredients currently not approved for use in food at or below ADI value comprises reducing the formulation of poloxamer in the cell culture medium to or below its ADI value.
40. The method of claim 32, wherein (iii) formulating one or more ingredients currently not approved for use in food at or below ADI value comprises reducing the formulation of one or more of rubidium chloride, strontium chloride hexahydrate, ammonium metavanadate, sodium metavanadate, ammonium molybdate, sodium molybdate, hypoxanthine, putrescine, thymidine, and DL-alpha-lipoic acid to or below their respective ADI value.
41. The method of claim 32, wherein (iii) formulating one or more ingredients currently not approved for use in food at or below ADI value comprises reducing one or more category 2 ingredients listed in Table 16 to or below their respective ADI value.
42. The method of claim 32, wherein the step of providing a plurality of ingredients comprises a subset of ingredients present in a common nutrient media.
43. The method of claim 42, including the steps of: (a) omitting one or more of ammonium molybdate, sodium molybdate, ammonium metavanadate, sodium metavanadate, rubidium chloride and strontium chloride hexahydrate, which provide trace elements and are not approved for use in food; and (b) adding ferric ammonium citrate to provide trace elements.
44. The method of claim 42, including the step of omitting any animal-derived component and omitting any animal-derived serum.
45. The method of claim 42, wherein the step of providing a plurality of ingredients is limited to Generally Recognized As Safe (GRAS) ingredients.
46. The method of claim 42, wherein the step of providing a plurality of ingredients includes adding one or more of glycolysis intermediates, iron carriers, ferric maltol, ferrous gluconate, shear protectants, polyethylene glycol, methylcellulose, simethicone, food-grade plant oils, and hydrolysates.
47. The method of claim 42, wherein the step of providing a plurality of ingredients includes adding a growth factor selected from the group consisting of IGF-1, LR3-IGF1, FGF-1, FGF-2, PDGF, CTGF, EGF, TGFB, BMP, HGF, transferrin, insulin, WNT, interleukins, albumin, VEGF, homologs, paralogs, orthologs, variants, precursors, isoforms, and combinations thereof.
48. The method of claim 42, wherein the step of providing a plurality of ingredients includes adding one or more of an adhesion protein selected from Table 14.
49. The method of claim 42, including the steps of: (a) omitting poloxamer, which provides shear protection; (b) omitting cobalt chloride, which provides an essential cofactor; (c) adding methylcellulose to provide shear protection; and (d) adding cyanocobalamin to provide the essential cofactor.
50. The method of claim 42, including the steps of omitting any animal-derived component and omitting any animal-derived serum, wherein the step of providing a plurality of ingredients is limited to Generally Recognized As Safe (GRAS) ingredients.
51. The method of claim 42, wherein the step of providing a plurality of ingredients includes adding glycolysis intermediates, shear protectants, polyethylene glycol, methylcellulose, food-grade plant oils, hydrolysates, and one or more of iron carriers, ferric maltol, ferrous gluconate, and an adhesion protein selected from Table 14.
52. The method of claim 42, wherein the step of providing a plurality of ingredients includes adding a growth factor selected from the group consisting of IGF-1, LR3-IGF1, FGF-1, FGF-2, PDGF, CTGF, EGF, TGFB, BMP, HGF, transferrin, insulin, WNT, interleukins, albumin, VEGF, homologs, paralogs, orthologs, variants, precursors, isoforms, and combinations thereof.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
DETAILED DESCRIPTION
[0044] Provided herein are compositions and methods for the making and using of cell culture medium useful for the culturing of cell-based meat (interchangeable referred to throughout as the slaughter-free meat of the disclosure).
[0045] Before describing particular embodiments in detail, it is to be understood that the disclosure is not limited to the particular embodiments described herein, which can vary. It is also to be understood that the terminology used herein is for the purpose of describing particular illustrative embodiments only and is not intended to be limiting unless otherwise defined. The terms used in this specification generally have their ordinary meaning in the art, within the context of this disclosure and in the specific context where each term is used. Certain terms are discussed below or elsewhere in the specification, to provide additional guidance to the practitioner in describing the compositions and methods of the disclosure and how to make and use them. The scope and meaning of any use of a term will be apparent from the specific context in which the term is used. As such, the definitions set forth herein are intended to provide illustrative guidance in ascertaining particular embodiments of the disclosure, without limitation to particular compositions or biological systems.
[0046] Standard techniques may be used for recombinant DNA, tissue culture, and transformation (e.g., electroporation, lipofection). Enzymatic reactions and purification techniques may be performed according to manufacturer's specifications or as commonly accomplished in the art or as described herein. These and related techniques and procedures may be generally performed according to conventional methods well known in the art and as described in various general and more specific references that are cited and discussed throughout the present specification. Unless specific definitions are provided, the nomenclature utilized in connection with, and the laboratory procedures and techniques of, molecular biology, analytical chemistry, synthetic organic chemistry, and medicinal and pharmaceutical chemistry described herein are those well-known and commonly used in the art. Standard techniques may be used for recombinant technology, molecular biological, microbiological, chemical syntheses, chemical analyses, pharmaceutical preparation, formulation, and delivery.
[0047] As used in the present disclosure and the appended claims, the singular forms “a,” “an” and “the” include plural references unless the content clearly dictates otherwise.
[0048] Throughout the present disclosure and the appended claims, unless the context requires otherwise, the word “comprise,” or variations such as “comprises” or “comprising,” will be understood to imply the inclusion of a stated element or group of elements but not the exclusion of any other element or group of elements.
[0049] As used in the present disclosure the term “about” shall generally mean an acceptable degree of error for the quantity measured. Exemplary degrees of error are within 20%, within 10%, and within 5% of a value or range of values.
[0050] The term “slaughter” as applied to the manner in which conventional meat is obtained covers all methods traditionally used to kill an animal, with the purpose of directly harvesting its meat for dietary consumption.
[0051] The term “slaughter-free” as applied to the cell-based meat products of the present disclosure refers to the process by which the meat is generated, starting with cells in culture, and that method which does not involve the slaughter of an animal in order to directly obtain meat from that animal for dietary consumption. It is understood that in some embodiments, it is possible that the starting cells for use in the cell culture methods may have been obtained following the slaughter of an animal, or a biopsy—although the starting cells for use in culture may have been obtained in this manner, the meat resulting from the culturing of cells, by harvest and a possible subsequent formulation are still considered to be meat obtained in a slaughter-free manner. It is noted that as a general matter, as used herein, harvesting of the slaughter-free cell-based meat product may involve using a buffered solution of water (or other aqueous solution) to remove the meat where it is grown (e.g. the surface of a bioreactor, or in a container comprising a the cells cultured in suspension), and the meat may then captured in a collection device (e.g. net, sieve, colander). In some embodiments the meat may be harvested by physical methods (such as scraping), enzymatic methods, and/or chemical methods. In some embodiments the meat may be harvested by any of the above-mentioned methods and subsequently rinsed with buffered solutions (or other aqueous solutions).
[0052] The phrases “cell-based meat”, “slaughter-free meat” “slaughter-free cell-based meat”, “in vitro produced meat”, “in vitro cell-based meat”, “cultured meat”, “slaughter-free cultured meat”, “in vitro produced cultured meat”, “in vitro meat”, “in vitro cultured meat” and other similar such phrases are interchangeably used herein, and refer to the meat that is generated in vitro, starting with cells in culture, and that method which does not involve the slaughter of an animal in order to directly obtain meat from that animal for dietary consumption.
[0053] The phrases “cell culture media”, “nutrient media”, “cell media”, “culture media”, “broth”, “feed” and other similar phrases are interchangeably used herein. “Nutrient media”, as used herein, is in the context of production of cell-based meat starting with cells in culture.
Slaughter-Free Cell-Based Meat
[0054] The slaughter-free cell-based meat products of the disclosure are produced by the in vitro culturing of naturally occurring, genetically engineered, or modified animal cells in culture.
[0055] The methods provided herein are applicable to any metazoan cell in culture. Generally, the cells are from any metazoan species whose tissues are suitable for dietary consumption. In some embodiments the cells may demonstrate a capacity for differentiation into mature tissue, such as skeletal muscle tissue, other muscle tissues, or any cell, cellular bio-mass, and/or tissue that can be consumed as meat. The cells used in the methods of the present disclosure can be primary cells, or cell lines.
[0056] In some embodiments, the cells are derived from any non-human animal species intended for human or non-human dietary consumption (e.g. cells of avian, ovine, caprine, porcine, bovine, piscine origin) (e.g. cells of livestock, poultry, avian, game, or aquatic species).
[0057] In some embodiments, the cells are from livestock such as domestic cattle, pigs, sheep, goats, camels, water buffalo, rabbits and the like. In some embodiments, the cells are from poultry such as domestic chicken, turkeys, ducks, geese, pigeons and the like. In some embodiments, the cells are from game species such as wild deer, gallinaceous fowl, waterfowl, hare and the like. In some embodiments, the cells are from aquatic species or semi-aquatic species harvested commercially from wild fisheries or aquaculture operations, or for sport, including certain fish, crustaceans, mollusks, cephalopods, cetaceans, crocodilians, turtles, frogs and the like.
[0058] In some embodiments, the cells are from exotic, conserved or extinct animal species. In some embodiments, the cells are from Gallus gallus, Gallus domesticus, Bos taurus, Sous scrofa, Meleagris gallopavo, Anas platyrynchos, Salmo salar, Thunnus thynnus, Ovis aries, Coturnix coturnix, Capra aegagrus hircus, or Homarus americanus. Accordingly, exemplary cell-based meat products of the disclosure include avian meat products, chicken meat products, duck meat products, and bovine meat products.
[0059] In some embodiments, the cells are primary stem cells, self-renewing stem cells, embryonic stem cells, pluripotent stem cells, induced pluripotent stem cells, or transdifferentiated pluripotent stem cells.
[0060] In some embodiments, the cells are modifiable by a genetic switch to induce rapid and efficient conversion of the cells to skeletal muscle tissue, connective tissue, fat tissue, and/or any other mature tissue for cultured meat production.
[0061] In some embodiments, the cells are myogenic cells, destined to become muscle, or muscle-like cells. In some embodiments, the myogenic cells are natively myogenic, e.g. myoblasts. Natively myogenic cells include, but are not limited to, myoblasts, myocytes, satellite cells, side population cells, muscle derived stem cells, mesenchymal stem cells, myogenic pericytes, or mesoangioblasts.
[0062] In some embodiments, cells are of the skeletal muscle lineage. Cells of the skeletal muscle lineage include myoblasts, myocytes, and skeletal muscle progenitor cells, also called myogenic progenitors that include satellite cells, side population cells, muscle derived stem cells, mesenchymal stem cells, myogenic pericytes, and mesoangioblasts.
[0063] In other embodiments, the cells are not natively myogenic (e.g. are non-myogenic cells such as fibroblasts or non-myogenic stem cells that are cultured to become myogenic cells in the cultivation infrastructure).
[0064] In some embodiments, the cells of the cellular biomass are somatic cells. In some embodiments, the cells of the cellular biomass are not somatic cells.
[0065] In some embodiments, the cells comprise a mixture of cell populations described herein, e.g. a mixture of fibrogenic cells and myogenic cells in co-culture, e.g. a mixture of fibroblasts and myoblasts in co-culture. In some embodiments the cells used for the production of cell-based meat are a mixture of fibroblasts and myoblasts in a suspension co-culture. In some embodiments the cells used for the production of cell-based meat are a mixture of fibroblasts and myoblasts in an adherent co-culture. In some embodiments cells in co-culture comprise additional cell types such as adipocytes, endothelial cells, and generally cells from the mesoderm lineage.
[0066] In some co-culture embodiments, the cells are in a suspension co-culture, in some embodiments, the cells are in an adherent co-culture, and in some embodiments, the culturing processing makes use of both techniques. The co-cultures provide herein comprise a mixture of at least fibroblasts and myoblasts. In some embodiments, the ratio of the fibroblasts to myoblasts (designated as F and M) ranges from about 5F:95M to about 95F:5M. In exemplary embodiments, the ratio of the fibroblasts to myoblasts is about 5F:95M, 10F:90M, 15F:85M, 20F:80M, 25F:75M, 30F:70M, 35F:65M, 40F:60M, 45F:55M, 50F:50M, 55F:45M, 60F:40M, 65F:35M, 70F:30M, 75F:25M, 80F:20M, 85F:15M, 90F:10M, or even about 95F:5M.
[0067] In some embodiments, the cells are non-myogenic, and such non-myogenic cells can be programmed to be myogenic, for example the cells may comprise fibroblasts modified to express one or more myogenic transcription factors. In exemplary embodiments, the myogenic transcription factors include MYOD1, MYOG, MYF5, MYF6, PAX3, PAX7, paralogs, orthologs, and genetic variants thereof. In some embodiments, the cells are modified to express one or more myogenic transcription factors as described in a PCT publication, WO/2015/066377, incorporated by reference herein in its entirety.
[0068] In some embodiments, the cells are genetically modified to inhibit a pathway, e.g. the HIPPO signaling pathway. Exemplary methods to inhibit the HIPPO signaling pathway as described in a PCT Application No. PCT/US2018/031276, incorporated by reference herein in its entirety.
[0069] In some embodiments, the cells are modified to express telomerase reverse transcriptase (TERT) and/or inhibit cyclin-dependent kinase inhibitors (CKI). In some embodiments, the cells are modified to express TERT and/or inhibit cyclin-dependent kinase inhibitors as described in a PCT publication, WO 2017/124100, incorporated by reference herein in its entirety.
[0070] In some embodiments, the cells are modified to express glutamine synthetase (GS), insulin-like growth factor (IGF), and/or albumin. Exemplary methods of modifying cells to express GS, IGF, and/or albumin are described in a PCT Application No. PCT/US2018/042187 which is incorporated by reference herein in its entirety.
[0071] In some embodiments, the cell-based meat product has various characteristics. Exemplary characteristics of the cell-based meat are described in U.S. application Ser. No. 17/033,635 and PCT Application No. PCT/US2021/016681, which are incorporated by reference herein in its entirety.
[0072] In some embodiments the cells are genetically edited, modified, or adapted to grow without the need of specific ingredients including specific amino acids, carbohydrates, vitamins, inorganic salts, trace metals, TCA cycle intermediates, lipids, fatty acids, supplementary compounds, growth factors, adhesion proteins and recombinant proteins.
[0073] In some embodiments, the cells may comprise any combinations of the modifications described herein.
[0074] The cell-based meat of the present disclosure, generated using the cell media formulations provided herein, is suitable for both human and non-human consumption. In some embodiments, the cell-based meat is suitable for consumption by animals, such as domesticated animals. Accordingly, the cell media formulations provided herein support the growth of “pet food”, e.g. dog food, cat food, and the like.
Cell Culture Media Formulations
[0075] Provided herein are nutrient media formulations and related compositions and methods, useful for the culturing and production of slaughter-free meat.
[0076] Safety for use in the production of meat intended for consumption is one of the many advantages of the cell culture media of the present disclosure. In some embodiments the cell culture media is itself edible, e.g. does not cause any deleterious effects if ingested. The media formulations provided herein generally comprise ingredients that are each individually or in combination edible, (e.g. safe to consume, food-grade, food-safe, food-quality, food-acceptable, food-compatible, food-category, foodstuff, for food use, eatable, comestible). Production of media formulations of the disclosure is achieved by engineering the media formulation to include ingredients that are inherently safe and/or customizing the concentrations of ingredients to be provided at safe levels, as determined by any one or more of the standards discussed below.
[0077] In some embodiment an edible nutrient medium for the production of slaughter-free meat comprises a plurality of ingredients, wherein each ingredient is approved for use in food and/or is at or below its ADI value. In some embodiments an intermediate version of the cell culture medium may or may not be edible. In some embodiments the cell culture medium comprises a plurality of ingredients wherein one or more ingredient is approved for use in food. In some embodiments the cell culture medium comprises a plurality of ingredients wherein each ingredient is approved for use in food. As used in the present disclosure, an ingredient “approved for use in food” refers to an ingredient that is approved for use in food by a widely accepted standard, e.g. a nationally or internationally accepted standard. These standards include, but are not limited to, standards set forth by regulatory bodies such as the Food and Drug Administration (FDA), the United States Department of Agriculture (USDA), the World Health Organization (WHO), the United Nations Food and Agriculture Organization (FAO), and the European Food Safety Authority (EFSA).
[0078] Accordingly, in some embodiments, the cell culture media of the present disclosure may comprise ingredients approved for use in food that are recognized by the FDA as Generally Recognized As Safe (GRAS). In some embodiments the cell culture media comprises ingredients that are GRAS certified ingredients, Non-GRAS certified ingredients, or mixtures thereof. In certain embodiments the cell culture media comprises only GRAS certified ingredients. As the list of GRAS substances is updated by the FDA, the GRAS certified ingredients that may be used in the formulation of the cell culture medium may be modified. In some embodiments the cell culture media comprise ingredients with a currently unknown GRAS status. It is contemplated the media provided herein may comprise an ingredient that may currently have an unknown GRAS status or a Non-GRAS status, but in the future may be GRAS certified.
[0079] In some embodiments the cell culture media of the present disclosure may comprise ingredients approved for use in food as recognized by the FDA.
[0080] In some embodiments the cell culture media of the present disclosure may comprise ingredients approved for use in food as recognized by the USDA.
[0081] In some embodiments the cell culture media of the present disclosure may comprise ingredients approved for use in food as recognized by the FAO.
[0082] In some embodiments the cell culture media of the present disclosure may comprise ingredients approved for use in food as recognized by the WHO.
[0083] In some embodiments the cell culture media of the present disclosure may comprise ingredients approved for use in food as recognized by the FAO and the WHO in the Codex Alimentarius.
[0084] In some embodiments the cell culture media of the present disclosure may comprise ingredients approved for use in food as recognized by the EFSA.
[0085] In some embodiments the cell culture media of the present disclosure may comprise ingredients approved for use in food as recognized by the Food Chemicals Codex (FCC).
[0086] In some embodiments the cell culture media comprises ingredients formulated at or below a safe concentration for consumption by humans and/or domesticated animals. In some embodiments, ingredients in the media may be deemed to be at a safe concentration for consumption by humans and/or domesticated animals if the theoretical maximum amount of the compound in the meat product is at or below the Average Daily Intake (ADI) level. The average daily intake (ADI) is conventionally determined as a result of a safety factor of 100-fold below the experimentally derived No Observable Adverse Effect Limits (NOAEL) for an appropriate animal species for sub-chronic or acute exposure. A skilled artisan in the field would understand how to compute the NOAEL value. For example, the FDA defines NOAEL as the highest dose level that does not produce a significant increase in adverse effects in comparison to the control group. The ADI is determined in an appropriately sensitive species, usually rodent, and it is reported as mg of substance/kg of animal body weight/24-hour period. Calculating the maximum theoretical concentration of each media compound in the final product is done by assuming 100% incorporation of the compound from the media into the product.
[0087] In some embodiments the cell culture medium comprises a plurality of ingredients wherein one or more ingredients is at or below its Average Daily Intake (ADI) value. In some embodiments the cell culture medium comprises a plurality of ingredients wherein each ingredient is at or below its ADI value. In some embodiments, the cell culture medium comprises a plurality of ingredients, wherein each ingredient is approved for use in food and/or is at or below its ADI value.
[0088] In some embodiments the cell culture media comprises ingredients currently not approved for use in food and/or ingredients currently having an unknown status for use in food. In some embodiments ingredients currently not approved for use in food are formulated at or below their ADI value.
[0089] In some embodiments the cell culture media comprises a combination of at least one ingredient approved for use in food and at least one ingredient currently not approved for use in food. In some embodiments the cell culture media comprises a combination of at least one ingredient approved for use in food and at least one ingredient currently not approved for use in food, wherein each ingredient is formulated at or below its ADI value.
[0090] In some embodiments the cell culture media comprises ingredients approved for use in food formulated at a concentration at or above its ADI value. In some embodiments the cell culture media comprises ingredients currently not approved for use in food formulated at a concentration at or above its ADI value. In some embodiments the cell culture media comprises a combination of at least one ingredient approved for use in food and at least one ingredient currently not approved for use in food, wherein each ingredient is formulated at or above its ADI values.
[0091] As shown in
[0092] Another advantage of the cell culture media of the present disclosure is the absence of animal-derived serum and other animal-derived components in the cell culture media which can impart contamination, batch-to-batch variability, microbial contamination, increase cost, and required additional quality control measures. The safe culture media formulations provided herein may be optimized to support the culture of a wide variety of cells in different cultivation formats, which is a challenging task in the absence of the nutrients commonly relied on from animal-derived serum. Accordingly, the cell culture media provided herein allow for the efficient culturing of cells under conditions of reduced animal-derived serum concentrations, or even in the absence of animal-derived serum entirely. In some embodiments, the cell culture medium comprises no more than 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05% or no more than 0.01% animal-derived serum. In some embodiments the cell culture medium is substantially free of animal-derived serum. Substantially free refers to an amount of animal-derived serum present at or below level of detection. A skilled artisan would know how to determine a level of detection. For example, the level of detection may be determined by mass spectrometry-based techniques, PCR-based techniques, antibody-based techniques, ELISA-based techniques, HPLC-based techniques, and other well-known chemical or biological detection methods. In some embodiments, the cell culture medium is free of animal-derived serum.
[0093] In some embodiments the cell culture medium comprises non-animal derived serum. Examples of non-animal derived serum include synthetic serum, serum substitutes, serum replacements, chemically defined serum, KnockOut™ Serum Replacement, and SigMatrix Serum diluent. In some embodiments, the cell culture medium comprises no more than 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05% or 0.01% non-animal derived serum. In some embodiments the cell culture medium is substantially free of non-animal derived serum. Substantially free refers to an amount of non-animal derived serum present at or below level of detection. A skilled artisan would know how to determine a level of detection. For example, the level of detection may be determined by mass spectrometry-based techniques, PCR-based techniques, antibody-based techniques, ELISA-based techniques, HPLC-based techniques, and other well-known chemical or biological detection methods. In some embodiments, the cell culture medium is free of non-animal derived serum.
[0094] Likewise, provided herein a cell culture medium provided herein comprises no more than 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05% or no more than 0.01% animal-derived components (including but not limited to animal-derived serum). In some embodiments the cell culture medium is substantially free of animal-derived components. Substantially free refers to an amount of an animal-derived component present at or below level of detection. A skilled artisan would know how to determine a level of detection. For example, the level of detection may be determined by mass spectrometry-based techniques, PCR-based techniques, antibody-based techniques, ELISA-based techniques, HPLC-based techniques, and other well-known chemical or biological detection methods. In some embodiments, the cell culture medium is free of animal-derived components.
[0095] The cell culture media of the present disclosure are customizable and modular. The ingredients of the media formulation may be customized to the specific type of cell-based meat being produced for optimal results. For example, for culturing chicken cells the media may comprise proteins, such as growth factors, that are also derived from chicken. Similarly, a media for culturing bovine cells may comprise proteins of only bovine origin. In some embodiments, the media for culturing chicken cells may comprise proteins, such as growth factors, of bovine origin. In some embodiments, the media may comprise a universal protein, such as a universal growth factor, for culturing any type of cell-based meat.
[0096] The cell-based meat produced by the cell culture media of the present disclosure may be equivalent or comparable to traditional meat obtained by slaughter. The cell culture media of the present disclosure allow for production of cell-based meat that is equivalent to its traditionally obtained counterparts in all respects, such as flavor, thickness, firmness, composition, etc. For example, riboflavin, a vitamin and cofactor, when added into the cell culture media increases fatty acid synthesis in the cells in culture. Accordingly, the levels of riboflavin in the cell culture media may be tuned such that the fatty acid content of the final cell-based meat matches that of traditional meat, and thus matching the flavor to equivalent traditional meat. In some embodiments the cell culture media comprises riboflavin. In some embodiments the cell culture media comprises galactose, uridine, and manganese (GUM).
[0097] The cell culture media of the present disclosure enable modulation of standard of identity (SOI) performance factors of the cell-based meat produced therefrom. Optimization of media components may be used to tune performance factors, such as to maintain cell viability, maximize the biomass/yield, tune the flavor/taste, and/or achieve desired tissue characteristics of the cell-based meat (thickness, firmness, etc.). In some embodiments the performance factor is cell viability. In some embodiments the performance factor is cell growth. In some embodiments the performance factor is biomass or yield of the final cell-based meat product. In some embodiments the performance factor is the taste or flavor of the cell-based meat. In some embodiments the performance factor is quality of the cell-based meat measured for instance in terms of tissue firmness, thickness, etc.
[0098] In some embodiments the performance factors are improved in cell-based meat produced by the cell culture media of the present disclosure as compared to cell-based meat produced by conventional media. In some embodiments the performance factors are improved in cell-based meat produced by the cell culture media of the present disclosure as compared to cell-based meat produced by media containing Non-GRAS ingredients. In some embodiments the performance factors are improved in cell-based meat produced by the cell culture media of the present disclosure as compared to cell-based meat produced by conventional media absent any ingredient that is not approved for use in food and/or is above its ADI value.
[0099] In some embodiments the cell viability is improved by at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% by culturing the cells in the cell culture media of the present disclosure as compared to culturing in conventional media. In some embodiments the cell viability is improved by at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% by culturing the cells in the cell culture media of the present disclosure as compared to culturing in media containing Non-GRAS ingredients.
[0100] In some embodiments the cell growth rate is improved by at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% by culturing the cells in the cell culture media of the present disclosure as compared to culturing in conventional media. In some embodiments the cell growth rate is improved by at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% by culturing the cells in the cell culture media of the present disclosure as compared to culturing in media containing Non-GRAS ingredients.
[0101] In some embodiments the final biomass/yield of the cell-based meat is improved by at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% by producing the cell based meat in the cell culture media of the present disclosure as compared to conventional media. In some embodiments the final biomass/yield of the cell-based meat is improved by at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% by producing the cell based meat in the cell culture media of the present disclosure as compared to media containing Non-GRAS ingredients.
[0102] Yet another advantage of the cell culture media of the present disclosure is their rapid application and formulation at any desired scale at low cost. For example, they are applicable in batch, fed-batch, chemostat, perfusion, and/or intensified bioreactor tissue cultivator processes.
[0103] In some embodiments the cell culture medium is chemically defined, i.e. a media in which all the ingredients and their concentrations are known. In some embodiments there may be a need to use a chemically defined, animal-component free medium to minimize any potential contaminants and decrease lot-to-lot variability while maintaining high cell growth, cultured meat production, and matching the similarity of these cell-based meat to the standard of identity of the conventional meat product. For example, many traditional cell culture media use animal derived oils, such as cod liver oil as a lipid source, as there are many methyl ester fatty acids in cod liver oil. However, cod liver oil does not allow control of the fatty acid composition of the cell-based meat and may give erroneous fatty acid profiles, e.g. chicken that has a fish profile. In some embodiments, the cell culture medium does not contain any undefined ingredients, such as hydrolysates, undefined serum replacements and animal-based oils (e.g. cod liver oil). In some embodiments provided herein are plant-derived food oils and/or synthetically derived fatty lipids to provide ideal ratios to achieve desired fatty acid profiles. In some embodiments, the cell culture medium does not contain dyes, such as pH indicator dyes (e.g. phenol red). Phenol red is commonly found in classical cell culture media (such as Ham's F12 and DMEM) as a colorimetric pH indicator. It bears structural resemblance to some nonsteroidal estrogens. Estrogens are considered hormones and not approved for use in food.
[0104] In some embodiments the cell culture medium may comprise undefined non-animal derived ingredients, such as plant hydrolysates.
Amino Acids
[0105] The cell culture media comprise one or more amino acids. The amino acids may be of either L stereochemistry, D stereochemistry, or in a combination of L and D isomers such as in the form of a racemate. In exemplary embodiments, the amino acids are of L stereochemistry. In some embodiments the amino acids comprise the twenty naturally occurring canonical amino acids.
[0106] Examples of amino acids included in the media of the disclosure include alanine, arginine, aspartic acid, asparagine, cysteine, cystine, glutamic acid, glutamine, glycine, histidine, proline, hydroxyproline, isoleucine, leucine, lysine, methionine, phenylalanine, serine, threonine, tryptophan, tyrosine, valine, and ornithine.
[0107] In some embodiments the cell culture media comprise one or more essential amino acids, non-essential amino acids, proteinogenic amino acids, non-proteinogenic amino acids, and/or branched chain amino acids.
[0108] In some embodiments the cell culture media comprise one or more unnatural amino acids, amino acids analogs, amino acid derivatives, beta-amino acids, gamma amino acids, amino acid mimetics, and/or oligopeptides. In some embodiments the cell culture media comprise taurine, carnosine, alpha-aminobutyric acid, beta-aminobutyric acid, and gamma-aminobutyric acid.
[0109] In some embodiments the cell culture media comprise one or more amino acids in the concentration range shown in Table 1 below. For this and other tables of the disclosure, the ranges are inclusive of the recited lowest and highest concentrations.
TABLE-US-00001 TABLE 1 Exemplary amino acids and related compounds Lowest Highest Exemplary Amino Acids Concentration Concentration and Related Compounds (g/L) (g/L) L-ALANINE 0.0001 0.5 L-ARGININE 0.01 2.5 L-ARGININE HYDROCHLORIDE 0.01 1 L-ASPARAGINE ANHYDROUS 0.1 1.5 L-ASPARAGINE MONOHYDRATE 0.01 0.9 L-CYSTEINE HYDROCHLORIDE 0.001 0.5 L-CYSTINE DIHYDROCHLORIDE 0.005 1.5 L-GLUTAMIC ACID 0.01 1.5 L-GLUTAMIC ACID MONOSODIUM 0.01 1.5 SALT MONOHYDRATE L-GLUTAMINE 0.14 1.5 L-GLYCINE 0.01 0.5 L-HISTIDINE FREE BASE 0.01 0.5 L-HISTIDINE HYDROCHLORIDE 0.01 0.5 HYDROXY-L-PROLINE 0.01 0.25 L-ISOLEUCINE 0.1 0.75 L-LEUCINE 0.01 0.75 L-LYSINE 0.01 1 L-METHIONINE 0.05 0.5 L-PHENYLALANINE 0.05 0.5 L-PROLINE 0.1 1 L-SERINE 0.1 1 L-THREONINE 0.05 0.5 L-TRYPTOPHAN 0.01 0.5 L-TYROSINE DISODIUM SALT 0.01 0.5 DIHYDRATE L-VALINE 0.1 0.75 L-ORNITHINE 0.001 0.05 L-ASPARTIC ACID 0.1 0.8 L-ALPHA-AMINOBUTYRIC ACID 0.001 0.025 GAMMA-AMINOBUTYRIC ACID 0.01 0.2 L-CARNOSINE 0.01 1
Carbohydrates
[0110] In some embodiments the cell culture media comprise one or more carbohydrates. The carbohydrates may comprise monosaccharides, disaccharides, oligosaccharides, polysaccharides, and/or polyols. Examples of carbohydrates include glucose, galactose, mannose, maltose, fucose, sucrose, fructose, allose, altrose, gulose, idose, talose, psicose, sorbose, tagatose, lactose, ribose and myo-inositol.
[0111] In some embodiments the cell culture media comprise carbohydrate derivatives and/or synthetic carbohydrates. Examples include amino sugars, reduced sugars, oxidized sugars, artificial sugars, deoxy sugars, gluconic acid, glucuronic acid, glucaric acid, glycerol, glucosamine, galactosamine, mannosamine, fucose, and deoxyribose.
[0112] In some embodiments the cell culture media comprise one or more carbohydrates in the concentration range shown in Table 2 below.
TABLE-US-00002 TABLE 2 Exemplary carbohydrates and related compounds Lowest Highest Exemplary Carbohydrates Concentration Concentration and Related Compounds (g/L) (g/L) D-GLUCOSE 1 12 GALACTOSE 0.1 2 MANNOSE 0.1 2 MALTOSE 0.1 2 FUCOSE 0.1 2 SUCROSE 0.1 12 FRUCTOSE 0.1 2 ALLOSE 0.1 2 ALTROSE 0.1 2 GULOSE 0.1 2 IDOSE 0.1 2 TALOSE 0.1 2 PSICOSE 0.1 2 SORBOSE 0.1 2 TAGATOSE 0.1 2 LACTOSE 0.1 2 MYO-INOSITOL 0.01 0.25 RIBOSE 0.1 2
Vitamins
[0113] In some embodiments the cell culture media comprise one or more vitamins. Examples of vitamins include vitamin C, vitamin B1, vitamin B2, vitamin B7, vitamin D, vitamin B9, vitamin B3, vitamin B5, vitamin B6, vitamin B12, vitamin E.
[0114] In some embodiments the cell culture media comprise vitamin precursors, intermediates, and metabolites. Examples include, niacinamide, menadione, choline chloride, and para-amino benzoic acid.
[0115] In some embodiments the cell culture media comprise vitamins in the concentration range shown in Table 3 below.
TABLE-US-00003 TABLE 3 Exemplary vitamins and related compounds Lowest Highest Exemplary Vitamins Concentration Concentration and Related Compounds (g/L) (g/L) ASCORBIC ACID (Vit C) 0.0001 0.5 D-BIOTIN (Vit B7) 1.00E−06 0.005 ERGOCALCIFEROL (Vit D2) 1.00E−06 5.00E−05 FOLIC ACID (Vit B9) 0.0015 0.02 MENADIONE (Vit K3) 0.00001 0.0005 NIACINAMIDE 0.001 0.01 (NICOTINAMIDE)(Vit B3) NIACIN (Vit B3) 1.00E−06 5.00E−02 CALCIUM D-PANTOTHENATE 0.0005 0.01 (Vit B5) PYRIDOXINE HYDROCHLORIDE 1.00E−05 0.01 (Vit B6) RIBOFLAVIN (Vit B2) 0.0001 0.005 THIAMINE HCL (Vit B1) 0.0025 0.05 CYANOCOBALAMIN (Vit B12) 1.00E−05 0.005 DL-ALPHA-TOCOPHEROL (Vit E) 1.00E−07 0.002 D-ALPHA-TOCOPHEROL (Vit E) 1.00E−07 0.002 PARA-AMINOBENZOIC ACID 0.001 0.01 (PABA) PYRIDOXAL HYDROCHLORIDE 0.0005 0.01 (Vit B6)
Inorganic Salts
[0116] In some embodiments the cell culture media comprise one or more inorganic salts. Examples of inorganic salts include calcium chloride, sodium chloride, sodium phosphate, magnesium chloride, magnesium sulfate, and potassium chloride.
[0117] In some embodiments the cell culture media comprise inorganic salts in the concentration range shown in Table 4 below.
TABLE-US-00004 TABLE 4 Exemplary inorganic salts and related compounds Lowest Highest Exemplary Inorganic Salts Concentration Concentration and Related Compounds (g/L) (g/L) CALCIUM CHLORIDE 0.0005 0.2 SODIUM CHLORIDE 0.1 10 SODIUM PHOSPHATE MONOBASIC 0.01 5 SODIUM PHOSPHATE DIBASIC 0.01 5 MAGNESIUM CHLORIDE 0.0005 0.1 MAGNESIUM SULFATE 0.0005 0.1 POTASSIUM CHLORIDE 0.001 1.5
Trace Metals
[0118] In some embodiments the cell culture media comprise one or more trace metals. Examples of trace metals include cadmium, strontium, copper, selenium, silicon, copper, iron, nickel, and tin. The trace metals may be present in different oxidation states, salts, solvates, and hydrates.
[0119] In some embodiments the cell culture media comprise trace metals in the concentration range shown in Table 5 below.
TABLE-US-00005 TABLE 5 Exemplary trace metals and related compounds Lowest Highest Exemplary Trace Metals Concentration Concentration and Related Compounds (g/L) (g/L) CADMIUM HEMIPENTAHYDRATE 0.00000001 0.000001 COBALT CHLORIDE 0.0000001 0.00001 AMMONIUM MOLYBDATE 0.0000001 0.0001 SODIUM MOLYBDATE 0.0000001 0.0001 AMMONIUM METAVANADATE 0.00000001 0.000005 SODIUM METAVANADATE 0.000000001 0.000005 STRONTIUM CHLORIDE 0.00001 0.01 HEXAHYDRATE COPPER SULFATE 2.50E−06 0.0025 SODIUM SELENITE 1.00E−06 1.00E−04 SODIUM METASILICATE 0.00001 0.001 CUPRIC CHLORIDE 1.00E−07 0.001 FERRIC AMMONIUM CITRATE 0.001 1 FERROUS SULFATE 1.00E−05 0.001 FERRIC NITRATE 1.00E−05 0.001 NICKEL SULFATE HEXAHYDRATE 1.00E−07 2.00E−06 STANNOUS CHLORIDE 1.00E−07 1.00E−06 DIHYDRATE FERRIC CITRATE 0.01 1 RUBIDIUM CHLORIDE 1.00E+07 5.00E+05
Lipids
[0120] In some embodiments the cell culture media comprise one or more lipids. Examples of lipids include fatty acids, fats, oils, glycerides, non-glyceride lipids, sphingolipids, glycolipids, phospholipids, sulfolipids, steroids, complex lipids, derived lipids, and lipid mixtures. Examples include oleic acid, linoleic, acid, arachidonic acid, linolenic acid, myristic acid, palmitic acid, palmitoleic acid, stearic acid, and lecithin. In some embodiments the cell culture media comprise food oils and food-grade plant oils. Examples of oils include flaxseed oil, canola oil, and algal oil.
[0121] In some embodiments the cell culture media comprise lipids in the concentration range shown in Table 6 below.
TABLE-US-00006 TABLE 6 Exemplary lipids, food oils and related compounds Lowest Highest Exemplary Lipids Concentration Concentration and Related Compounds (g/L) (g/L) DL-ALPHA-LIPOIC-ACID 0.00001 0.005 OLEIC ACID 1.00E−06 0.001 CHOLESTEROL 0.00005 0.005 LECITHIN 1.00E−05 0.01 LINOLEIC ACID 1.00E−05 0.005 ARACHIDONIC ACID 1.00E−08 5.00E−05 LINOLENIC ACID 1.00E−06 1.00E−03 MYRISTIC ACID 1.00E−06 1.00E−03 PALMITIC ACID 1.00E−06 1.00E−03 PALMITOLEIC ACID 1.00E−06 1.00E−03 STEARIC ACID 1.00E−06 1.00E−03 FLAXSEED OIL 1.00E−06 5.00E−03 CANOLA OIL 1.00E−06 5.00E−03 ALGAL OIL 1.00E−06 5.00E−03 OTHER FOOD OILS 1.00E−06 5.00E−03
TCA Cycle Intermediates
[0122] In some embodiments the cell culture media comprise one or more TCA cycle intermediates. Examples of TCA cycle intermediates include pyruvic acid, succinic acid, citric acid, isocitric acid, alpha-ketoglutaric acid, fumaric acid, malic acid, oxaloacetic acid, acetylcholine, acetyl CoA, and succinyl CoA.
[0123] In some embodiments the cell culture media comprise TCA cycle intermediates in the concentration range shown in Table 7 below.
TABLE-US-00007 TABLE 7 Exemplary TCA cycle intermediates and related compounds Exemplary TCA Cycle Lowest Highest Intermediates and Concentration Concentration Related Compounds (g/L) (g/L) SODIUM PYRUVATE 0.01 0.5 SUCCINIC ACID 0.005 1.5 SODIUM SUCCINATE 0.005 0.1
Supplementary Ingredients
[0124] In some embodiments the cell culture media comprise one or more supplementary ingredients. Examples of supplementary compounds include Polysorbate 80®, ethanolamine, ethanol, sodium citrate, sodium gluconate, methyl-beta-cyclodextrin, glycolysis intermediates, iron carriers, ferric maltol, ferrous gluconate, shear protectants, polyethylene glycol, antifoaming agents, methyl cellulose, poloxamers, and Simethicone®.
[0125] In some embodiments the cell culture media comprise supplementary compounds in the concentration range shown in Table 8 below.
TABLE-US-00008 TABLE 8 Exemplary supplementary ingredients Lowest Highest Exemplary Supplementary Concentration Concentration Ingredients (g/L) (g/L) HYPOXANTHINE 0.0001 0.01 THYMIDINE 1.50E−04 0.001 TWEEN 80 (POLYSORBATE) 1.00E−04 0.005 PUTRESCINE DIHYDROCHLORIDE 1.00E−04 0.0009 SPERMINE 1.00E−02 0.05 TETRAHYDROCHLORIDE SPERMIDINE 1.00E−04 0.05 CADAVERINE 1.00E−04 0.05 ETHANOLAMINE 2.00E−03 0.08 ETHANOL (ETHYL ALCOHOL) 6.00E−05 1 SODIUM CITRATE 0.5 0.5 SODIUM GLUCONATE 0.5 1.5 METHYL BETA CYCLODEXTRIN 0.05 0.075 L-TAURINE 0.01 0.1 CHOLINE CHLORIDE 0.001 0.5
[0126] In some embodiments, the cell culture media comprises a core set of ingredients, depending on the properties of the cell culture as desired. In exemplary embodiments the core ingredients of the cell culture media include at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, at least twelve, at least thirteen, at least fourteen, at least fifteen, at least sixteen, at least seventeen, at least eighteen, at least nineteen, at least twenty, at least twenty one, at least twenty two, at least twenty three, at least twenty four or more of L-arginine, L-cysteine, L-cystine, L-glutamine, L-histidine, L-isoleucine, L-leucine, L-lysine, L-methionine, L-phenylalanine, L-proline, L-tryptophan, L-tyrosine, L-valine, D-glucose, niacin, riboflavin, ergocalciferol, ascorbic acid, copper salts, sodium salts, iron salts, magnesium salts, and zinc salts.
[0127] In exemplary embodiments the core ingredients of the cell culture media include at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, at least twelve, at least thirteen, at least fourteen, at least fifteen, at least sixteen, at least seventeen, at least eighteen, at least nineteen, at least twenty, at least twenty one, at least twenty two, at least twenty three, at least twenty four or more of L-arginine, L-cysteine, L-cystine, L-glutamine, L-histidine, L-isoleucine, L-leucine, L-lysine, L-methionine, L-phenylalanine, L-proline, L-tryptophan, L-tyrosine, L-valine, D-glucose, niacin, riboflavin, ergocalciferol, ascorbic acid, copper sulfate, sodium selenite, ferric ammonium citrate, magnesium chloride, magnesium sulfate, and zinc sulfate.
[0128] In other embodiments the cell culture media comprises L-arginine, L-cysteine, L-cystine, L-glutamine, L-histidine, L-isoleucine, L-leucine, L-lysine, L-methionine, L-phenylalanine, L-proline, L-tryptophan, L-tyrosine, L-valine, D-glucose, niacin, riboflavin, ergocalciferol, ascorbic acid, copper sulfate, sodium selenite, ferric ammonium citrate, magnesium chloride, magnesium sulfate, and zinc sulfate.
[0129] In some embodiments the cell culture media comprise at least the ingredients shown in Table 9 below.
TABLE-US-00009 TABLE 9 Exemplary ingredients Lowest Highest Concentration Concentration Exemplary Ingredients (g/L) (g/L) L-ARGININE 0.01 2.5 L-CYSTEINE 0.001 0.5 L-CYSTINE 0.005 1.5 L-GLUTAMINE 0.14 1.5 L-HISTIDINE 0.01 0.5 L-ISOLEUCINE 0.1 0.75 L-LEUCINE 0.01 0.75 L-LYSINE 0.01 1 L-METHIONINE 0.05 0.5 L-PHENYLALANINE 0.05 0.5 L-PROLINE 0.1 1 L-TRYPTOPHAN 0.01 0.5 L-TYROSINE 0.01 0.5 L-VALINE 0.1 0.75 D-GLUCOSE 1 12 NIACIN (Vit B3) 1.00E−06 5.00E−02 RIBOFLAVIN 0.0001 0.005 ERGOCALCIFEROL (VitD2) 1.00E−06 5.00E−05 ASCORBIC ACID (Vit C) 0.0001 0.5 COPPER SULFATE 2.50E−06 0.0025 SODIUM SELENITE 1.00E−06 1.00E−04 FERRIC AMMONIUM CITRATE 0.001 1 MAGNESIUM CHLORIDE 0.0005 0.1 MAGNESIUM SULFATE 0.0005 0.1 ZINC SULFATE 0.00005 0.01
[0130] Salts, solvates, hydrates, polymorphs, anhydrates, esters, isomers, metabolites, precursors, derivatives and prodrugs of any of the cell culture medium ingredients disclosed in the present disclosure may be utilized.
Growth Factors
[0131] In some embodiments the cell culture media comprise one or more growth factors. The growth factors may be produced by a variety of methods known in the art. The growth factors may comprise a sequence that is either naturally occurring or non-naturally occurring. For example, a growth factor comprising a non-naturally occurring sequence may be a variant of a naturally existing sequence. Alternatively, a growth factor comprising a non-naturally occurring sequence may not resemble the naturally occurring counterpart with much sequence similarity but retain similar function. The growth factors may be produced by a variety of methods known in the art, for example the growth factor may be recombinantly produced, isolated and purified or chemically synthesized. The growth factors of the present disclosure encompass homologs, orthologs and paralogs. Examples of growth factors that may be included in the media provided herein include Fibroblast Growth Factor, Fibroblast Growth Factor 1 (FGF-1), Fibroblast Growth 2 Factor (FGF-2), Platelet-derived Growth Factor, Platelet-derived Growth Factor subunit A (PDGF-A), Platelet-derived Growth Factor subunit B (PDGF-B), Platelet-derived Growth Factor-AA (PDGF-AA), Platelet-derived Growth Factor-BB (PDGF-BB), Insulin like Growth Factor 1 (IGF-1), Long arginine 3-IGF-1 (LR3-IGF1), Insulin, Transferrin, Serotransferrin, Ovotransferrin, Connective Tissue Growth Factor (CTGF), Epidermal growth factor (EGF), Transforming Growth Factor (TGF), Transforming growth factor Beta (TGF-β), Bone morphogenetic proteins (BMP), Hepatocyte Growth Factor (HGF), WNT proteins, WNT 1, WNT 11, WNT 11B, Myogenic regulatory factors, Myogenic factor 6, Interleukins, IL2, IL2 isoform X1, IL6, IL6 precursor, Leukemia inhibitory factor (LIF), LIF isoform X1 IL3, vascular endothelial growth factor (VEGF), variants, thermostable variants, precursors, isoforms, homologs, paralogs, orthologs, and biologically active fragments thereof. Exemplary growth factors and proteins are shown in Table 10 below.
TABLE-US-00010 TABLE 10 Exemplary growth factors and proteins Exemplary Growth Factors and Proteins Species Accession No. FGF-2 Gallus gallus P48800 FGF-2 Homo sapiens P09038 FGF-2 Bos Taurus P03969 FGF-2 Sus Scrofa A0A287BGK8 Ovotransferrin precursor Gallus gallus NP_990635 Serotransferrin precursor Bos taurus NP_803450 Serotransferrin isoform 1 Homo sapiens NP_001054 precursor Serotransferrin Ovis aries XP_027816111 Serotransferrin precursor Mus musculus NP_598738 Serotransferrin precursor Rattus norvegicus NP_001013128 Serotransferrin precursor Sus scrofa NP_001231582 IGF1 isoform 1 preprotein Homo sapiens NP_001104753 IGF1 preprotein Gallus gallus NP_001004384 IGF1 precursor Sus scrofa NP_999421 IGF1 precursor Ovis aries NP_001009774 IGF1 isoform a preprotein Rattus norvegicus NP_001075946 IGF 1 isoform 1 Mus musculus NP_034642 IGF1 preprotein bovine Bos Taurus NP_001071296 PDGF subunit B isoform 1 Homo sapiens NP_002599 preprotein PDGF subunit B precursor Gallus gallus NP_989601 PDGF subunit B precursor Rattus norvegicus NP_113712 PDGF subunit B precursor Mus musculus NP_035187 PDGF subunit B precursor Bos taurus NP_001017953 Myogenic factor 6 (MYF6) Homo sapiens NM_002469 Interleukin-6 precursor Bos Taurus NP_776348 Interleukin 6 Sus scrofa CAM58482 Interleukin 6 Gallus gallus ADL14564 Interleukin-2 Bos Taurus ABK41607 Interleukin-2 isoform X1 Sus scrofa XP_020956095 Interleukin 2 Gallus gallus AAV35056 Interleukin-3 Bos Taurus AAA99502 Interleukin-3 Gallus gallus CAF18429 Wnt-11 Bos Taurus XP_868944 Wnt-11 Sus scrofa XP_020918191 Wnt-11 Gallus gallus BAA06699 Wnt-1 Bos indicus × XP_027399431 Bos taurus Wnt-1 Sus scrofa XP_003126148 Wnt-1 Gallus gallus XP_015128668 Leukemia Inhibitory Factor Bos Taurus BAA19511 Leukemia Inhibitory Factor Sus scrofa CAC14463 Leukemia Inhibitory Factor Gallus gallus XP_425293 isoform X1
[0132] In some embodiments the cell culture media comprises Long arginine 3-IGF-1 (LR3-IGF1). The LR3 peptide chain provides higher stability to the protein. In some embodiments a Gallus gallus LR3-IGF1 comprises the amino acid sequence set forth in SEQ ID NO: 1 or a sequence having at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% sequence identity thereto. Exemplary LR3-IGF1 proteins are shown in Table 11 below.
TABLE-US-00011 TABLE 11 LR3-IGF1 sequences SEQ ID No. LR3-IGF1 Protein Sequence 1 Gallus gallus MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFSKPTGYG SSSRRLHHKGIVDECCFQSCDLRRLEMYCAPIKPPKSA 2 Homo MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYG sapiens SSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
[0133] In some embodiments the cell culture media comprise one or more growth factors in the concentration range shown in Table 12 below.
TABLE-US-00012 TABLE 12 Exemplary growth factors and proteins Lowest Highest Concentration Concentration Exemplary Growth Factors (g/L) (g/L) Insulin 8.00E−04 0.008 LR3-IGF1 0.009 0.04 Transferrin (Holo) 0.01 0.5 FGF-2 1.00E−06 1.00E−03 FGF-1 1.00E−06 1.00E−03 PDGF 1.00E−06 1.00E−03 CTGF 1.00E−06 1.00E−03 EGF 1.00E−06 1.00E−03 TGFB 1.00E−06 1.00E−03 BMP 1.00E−06 1.00E−03 HGF 1.00E−06 1.00E−03 KGF 1.00E−06 1.00E−03
Species-Specific Growth Factors Provided in Cis
[0134] In some embodiments, it may be desirable for cell-based meat of a particular genus/species to be cultured with cell media comprising growth factors derived from the same genus/species. Currently, only mouse and human-origin growth factors are widely available commercially and could be unfavorable or incompatible for growing agriculturally or nutritionally important animal cell lines, such as, but not limited to, chicken, beef, livestock, poultry, avian, game, or aquatic species. The unavailability, especially at industrial scale, of cell culture media for growing cell-based meat comprising high-fidelity species-matched growth factors is a challenge.
[0135] The present disclosure addresses this challenge by providing cell culture media comprising growth factors that match, or are cis, to the genus and/or species of the cell-based meat being cultured. As used herein, a cis growth factor is one that matches the genus and/or species of the cells in culture. This allows the cell culture medium to be customized to the cell-based meat being cultured, by using only species and/or genus-matched cells and growth factors. For instance, in such cis embodiments of the disclosure, if the cell culture medium is used to culture Gallus cells, the corresponding cis growth factors used in the cell media would be of Gallus origin, such as FGF-2 from Gallus gallus. The cis growth factor may comprise a sequence that is either naturally occurring, such as a wild-type sequence or a spontaneous mutation, or may comprise a sequence that is non-naturally occurring. For example, a cis growth factor comprising a non-naturally occurring sequence may be an engineered-variant of a naturally existing sequence. It is noted that, a cis growth factor comprising a non-naturally occurring sequence may not resemble the naturally occurring counterpart with much sequence similarity but retain similar function. The cis growth factors may be produced by a variety of methods known in the art, for example the growth factor may be recombinantly produced, isolated and purified or chemically synthesized. The cis growth factors of the present disclosure encompass naturally occurring homologs, paralogs and orthologs. Any growth factor may be provided in cis; exemplary growth factors that may be used as cis growth factors are shown in Table 10 above. In some embodiments the cis growth factor is a recombinant cis growth factor.
[0136] In some embodiments the variant cis growth factor is cis Gallus LR3-IGF1 (SEQ ID NO: 1, Table 11); the appended LR3 peptide chain provides higher stability to the protein.
[0137] The use of cis growth factors is one of the many advantages of the cell culture media compositions of the present disclosure. Growth factors derived from agriculturally or nutritionally-relevant animal sources, such as chicken FGF or bovine IGF, are currently unavailable, especially at the industrial scale required for formulating cell culture media for growing cell-based meat economically. Cis recombinant growth factors may be produced as shown in Example 5 below.
[0138] In some embodiments the use of a cis growth factor provides enhanced cellular response, growth, efficacy, and/or activity compared to when using a non-cis growth factor. For example, culturing of cell-based meat in media comprising a cis growth factor may result in an increased growth rate of the cells compared to media comprising non-cis growth factors. As shown in
Universal Growth Factors
[0139] The present disclosure provides novel growth factors that support the growth of cell-based meat of a plurality of genus and/or species and referred to herein as universal growth factors. In some embodiments, the universal growth factors support the growth of cell-based meat of any genus and/or species. By way of a non-limiting example, a universal FGF-2, universal PDGF-BB, universal IGF-1, or universal VEGF-A may be used in a cell culture medium to grow cell-based chicken, beef, livestock, poultry, avian, game, or aquatic species. Cell media containing universal growth factors provide multiple advantages, such as applicability independent of the cells being cultured, off-the-shelf availability, and reduced costs.
[0140] In some embodiments the universal growth factor is selected from the group consisting of universal FGF-2 (SEQ ID NO: 3), universal PDGF-BB (SEQ ID NO: 5), universal IGF-1 (SEQ ID NO: 6), and universal VEGF-A (SEQ ID NO: 7) or a sequence having at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% sequence identity thereto.
[0141] In some embodiments, the universal growth factor may be universal across kingdom, phylum, class, order, family, genus and/or species. In some embodiments, the universal growth factor may be universal across the metazoan division of the animal kingdom.
[0142] In some embodiments, the universal growth factor is universal only across certain kingdom, phylum, class, order, family, genus and/or species. For example, a universal growth factor may be universal across any one of mammals, birds, fish, reptiles, amphibians, and arthropods. In some embodiments a universal mammalian growth factor may be used across the board to culture mammalian cell-based meat.
[0143] The universal growth factors of the disclosure may be recombinantly produced, isolated/purified, and/or chemically synthesized. In some embodiments, universal growth factors are designed in silico and produced recombinantly as described in Example 4. Exemplary recombinant universal growth factors are shown in Table 13.
TABLE-US-00013 TABLE 13 Exemplary recombinant universal growth factors Exemplary Seq Recombinant ID Universal Growth No. Factors Sequences 3 universal FGF-2 MAAGSITTLPALPEDGGSGAPPPGHFKDPKRLYCKNGGFFLRIBPDGRV DGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCV TDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKA ILFLPMSAKS 4 universal FGF-2 ATG GCA GCA GGT AGT ATT ACT ACG CTT CCC GCC CTT CCC GAA GAC GGG GGT TCA GGT GCC TTC CCG CCG GGG CAT TTT AAA GACCCG AAG CGC CTT TAC TGT AAG AAT GGG GGC TTT TTC TTG CGT ATC CAC CCA GAC GGC CGC GTG GAC GGT GTG CGT GAA AAA TCCGAT CCA CAT ATT AAA CTT CAG CTT CAA GCA GAA GAG CGT GGT GTG GTT TCC ATC AAG GGG GTG TGT GCC AAC CGC TAT CTT GCGATG AAG GAG GAC GGT CGT CTG CTG GCT TCG AAA TGT GTT ACC GAC GAG TGT TTT TTC TTC GAG CGC CTG GAA TCA AAT AAT TACAAC ACC TAC CGC AGC CGC AAA TAT TCT TCA TGG TAC GTG GCT TTG AAG CGC ACA GGT CAG TAT AAA TTG GGC AGT AAA ACG GGTCCA GGA CAG AAG GCG ATT CTT TTC TTA CCG ATG TCA GCT AAA AGC TAA TGA 5 universal PDGF-BB SLGSLAAAEPAVIAECKTRTEVFEISRRLEDRTNANFLVWPPCVEVQRCS GCCNNRNVQCRPTQVQDRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC ETVVARAVT 6 universal IGF-1 MGKISSLPTQLFKCCFCDFLKVKMEIVTSSSHLFYLALCLLTFTSSATAGP ETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRS CDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKAQKEVHLKNTSRGSA GNKNYRM 7 universal VEGF-A MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGQKPHEVVKFMDVY QRSFCRPIETLVDIFQEYPDEIEFIFKPSCVPLMRCGGCCNDEsLECVPTEE fNITMQIMREKPHQsQHIGEMSFLQHNKCECRPKKDKARQENPCGPCSER RKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCdkpRR
Adhesion Proteins
[0144] In some embodiments the cell culture media comprise one or more adhesion proteins. Examples of adhesion proteins include collagen, collagen IV alpha 1, fibronectin, TPA:Fibronectin, partial Fibronectin vitronectin, fibrinogen variants, precursors, isoforms, homologs, paralogs, orthologs, and biologically active fragments thereof. Exemplary adhesion proteins are shown in Table 14 below.
TABLE-US-00014 TABLE 14 Exemplary adhesion proteins Exemplary Adhesion Proteins Species Accession No. Vitronectin Bos Taurus AAI03133 Vitronectin Sus scrofa BAA09616 Vitronectin Gallus Gallus CAA71914 Collagen alpha-3(IV) Bos Taurus Q28084 Collagen, type IV, alpha 1 Sus scrofa JAA74162 Collagen type VI subunit alpha-1, Gallus Gallus CAA41053 partial TPA: fibronectin Bos Taurus DAA32456 Fibronectin, partial Sus scrofa AAW02948 Fibronectin Gallus Gallus P11722
Other Cis and Universal Media Components
[0145] In some embodiments any protein included in the cell media of the disclosure may be used provided in cis. For instance, when culturing Gallus cells, the adhesion protein fibronectin used may be a Gallus fibronectin. The cis adhesion protein may be recombinantly produced, isolated/purified, or chemically synthesized.
[0146] In some embodiments any protein included in the cell media of the disclosure may be universal. For instance, the adhesion protein fibronectin may be used to develop a universal fibronectin by methods described in the present disclosure.
Methods for Formulating a Cell Culture Medium
[0147] Provided herein are methods of formulating the cell culture medium (nutrient medium) of the present disclosure, useful for culturing slaughter-free meat.
[0148] In some embodiments provided herein is a method for formulating a nutrient medium for the production of slaughter-free meat comprising: (a) providing a plurality of ingredients; and (b) one or more of: (i) replacing one or more ingredients currently not approved for use in food with an ingredient approved for use in food; (ii) removing one or more ingredients currently not approved for use in food; and (iii) formulating one or more ingredients currently not approved for use in food at or below ADI value. In some embodiments the cell culture medium produced by the method is chemically defined.
[0149] Methods for formulating the cell culture media of the present disclosure for production of cell-based meat is a highly challenging and unpredictable process. Unlike conventional cell culture media (e.g. Ham's F-12, DMEM, Medium 199) used in pharmaceutical and biotechnological applications, several challenges were overcome in the development of safe and effective cell culture media of the present disclosure for production of cell-based meat. The cell culture media of the present disclosure were developed by balancing safety on one hand, while maintaining, if not exceeding, the media performance for culturing cells and tissues. Replacement, removal and/or reduction of ingredients to confer edibility on the media in most instances led to a drop in performance of the cell culture medium, for example as assessed by cell viability and cell growth. After much experimentation and novel approaches, cell media compositions and methods for formulating the cell culture media were identified. Specific examples of replacing, removing, and/or reducing media ingredients below ADI values are discussed below without compromising performance. Further, an exemplary safety assessment framework and a 3-tier categorization system is detailed below, along with specific examples of ingredients in Table 16.
[0150] By way of example, poloxamers, such as Poloxamer 188, are surfactants used in cell culture bioprocesses as shear protectants, and thus are commonly provided in conventional cell culture media. Poloxamers are not approved for use in food. To find a suitable food-safe replacement, several compounds with GRAS approval notifications and potential shear protectant properties were identified and screened, such as polyvinyl alcohol (PVA), polyvinylpyrrolidone (PVP), and several versions of methylcellulose. As shown in
[0151] Cobalt is an essential cofactor nutrient for many enzymatic pathways that contribute to metabolic and cellular function. Cobalt chloride is a commonly used source of cobalt in culture media. Cobalt chloride is strictly prohibited by the FDA for use in food. In order to find a suitable replacement, many cobalt compounds were screened. Eventually, Vitamin B12 in the form of cyanocobalamin, which contains bioavailable cobalt at its chiral center, was found. The replacement of cobalt chloride with cyanocobalamin sufficiently supplied cobalt as a food-safe cofactor to promote cellular function. In some embodiments the method comprises removing cobalt chloride. In some embodiments the method comprises replacing cobalt chloride with cyanocobalamin (Vit B12).
[0152] Several trace elements are essential to cell metabolism and growth. Such elements may either be vastly reduced or removed completely from the media formulation in order to meet safety standards. Table 15 shows several different components that were either adjusted to be at levels below the ADI level or that were removed completely from the media formulation. As a novel alternative to formulating trace elements directly, the present disclosure discloses the identification and testing of food-safe complexes that innately contain trace elements. For example, ferric ammonium citrate (FAC) is a complex of ammonia, citrate and iron that is commonly used as a food additive/ingredient. FAC is known to have small amounts of many trace element nutrients due to the process by which it is harvested and produced. Cell studies showed that by adding FAC into the media of the present disclosure, the cells were supplied with the trace amounts of these minerals required for robust cell growth. As shown in
TABLE-US-00015 TABLE 15 Exemplary trace elements and other components ADI Name CAS# (mg/kg bw-day) RUBIDIUM 7791-11-9 0.051 CHLORIDE STRONTIUM 10025-70-4 1.87 CHLORIDE HEXAHYDRATE SODIUM 13718-26-8 0.274 METAVANADATE SODIUM 10102-40-6 1.41 MOLYBDATE-2H.sub.2O HYPOXANTHINE-NA 45738-97-4 0.3 PUTRESCINE-2HCl 333-93-7 0.018 THYMIDINE SYNTHETIC 50-89-5 83.1 DL-ALPHA-LIPOIC ACID 1077-28-7 5.14
[0153] In some embodiments the method comprises removing one or more of ammonium molybdate, sodium molybdate, ammonium metavanadate, sodium metavanadate, rubidium chloride, strontium chloride hexahydrate, hypoxanthine, putrescine, thymidine, and DL-alpha lipoic acid. In other embodiments the method comprises replacing one or more of ammonium molybdate, sodium molybdate, ammonium metavanadate, sodium metavanadate, rubidium chloride, and strontium chloride hexahydrate with ferric ammonium citrate. In other embodiments the method comprises replacing one or more of hypoxanthine, putrescine, and thymidine with optimized amino acid blends within the concentration ranges shown in Table 1. In other embodiments the method comprises replacing DL-alpha lipoic acid with plant derived oils or yeast hydrolysates. In some embodiments the method comprises reducing formulation of one or more of ammonium molybdate, sodium molybdate, ammonium metavanadate, sodium metavanadate, rubidium chloride, strontium chloride hexahydrate, hypoxanthine, putrescine, thymidine, and DL-alpha lipoic acid to or below their respective ADI values.
[0154] In some embodiments the method comprises removing an anti-foaming agent currently not approved for use in food. In some embodiments the method comprises replacing the anti-foaming agent currently not approved for use in food with simethicone. In some embodiments the method comprises reducing the formulation of the anti-foaming agent currently not approved for use in food in the cell culture medium to or below its ADI value.
[0155] In some embodiments the cell culture medium produced by the method contains no more than 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1% or no more than 0.01%% animal-derived serum. In some embodiments the cell culture medium produced by the method is substantially free of animal-derived serum or free of animal-derived serum.
[0156] In some embodiments the cell culture medium produced by the method is does not comprise any components associated with blood.
[0157] In some embodiments the cell culture medium produced by the method contains no more than 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1% or no more than 0.01%% animal-derived components. In some embodiments the cell culture medium produced by the method is substantially free of animal-derived components or free of animal-derived components.
[0158] In some embodiments the cell culture medium produced by the method may be used in batch, fed-batch, chemostat, perfusion, and/or intensified bioreactor tissue cultivator processes.
[0159] In some embodiments the cell culture medium produced by the method comprises any one or more of growth factors, universal growth factors, and/or cis growth factors described in the present disclosure. In some embodiments the cell culture medium produced by the method comprises any one or more of the growth factors set forth in SEQ ID NOs: 1-7. In some embodiments the cell culture medium produced by the method comprises any one or more of the ingredients described in the present disclosure.
[0160] The present disclosure also provides a safety assessment framework for evaluating the use of media formulations in cell-based meat production, and for safety evaluation. A safety assessment was conducted on each component of a given cell culture media under the procedure outlined below. Most media components are nutrients and have existing regulatory status for various specified food uses; therefore, the evaluation begins with a consideration of the regulatory status of each compound. Further overview of the categorical framework for ensuring that culture media components are safe and suitable for their intended use in meat production are outlined below according to their category designation. A list of media components used during meat production along with worst-case exposure estimates and relevant authoritative limits or published toxicological/safety data supporting their use is presented in Table 16.
[0161] Category 1: These cell culture media components are food ingredients/additives that are GRAS or permitted by federal regulation without limitation on use. Exemplary compounds in this category include innocuous ingredients such as sugars, pH buffers, water soluble vitamins, and common antioxidants such as tocopherols.
[0162] Category 2. These cell culture media components are common dietary nutrients and are anticipated to have GRAS status for food use or be permitted by regulation for addition to food. Examples of such compounds include most of the inorganic salts and macronutrients that are present within the cell culture media. Where these compounds are permitted for direct addition to food at use levels comparable to anticipated concentrations that might reasonably be expected in the cell-based meat product, no safety concerns are anticipated. Majority of nutrients present within the poultry cell-based meat may be readily measured using common validated methods for food composition testing. Batch analyses of multiple lots of the finished product may be obtained to validate the above assumptions. In some instances, consideration of established safe levels (e.g., ADI, UL) derived from a relevant authoritative body (e.g., U.S. FDA, EFSA, JECFA, FSANZ, U.S. EPA) may be leveraged to support safety. If comparisons of anticipated dietary intakes relative to an authoritative reference intake value is used, consideration of additive intakes from all dietary sources may be considered. In the absence of an authoritative reference intake value, published NOAELs from animal toxicology studies may be used to evaluate safety using standard scientific procedures for food safety evaluation. A margin of exposure (MoE) of 100-fold or greater between the NOAEL and estimated dietary intakes from food exposures is typically considered adequate to support safety. In situations where the MoE is <100-fold, additional measures for further reduction of the media component may be necessary, or further characterization of intraspecies/interspecies differences in metabolism may be necessary. These situations also require careful consideration of the regulatory status on a case-by-case basis (e.g., premarket approval as a food additive or GRAS evaluation required).
[0163] Category 3. These cell culture media components have not been previously used in food production (e.g., no federal regulations or previous GRAS status) but with sufficient information to conclude that the compounds do not present risk for intended use in food production. For example, situations where the compound is not detectable in finished product or is present at equivalent levels in comparator foods, compounds that are thermo-labile and will be digested during cooking, and/or compounds that are expected to be digested to innocuous compounds following ingestion. Examples of compounds meeting the aforementioned conditions would include recombinant growth factors and serum components. For Category 3 substances a final consideration in the safety assessment process may involve hazard characterization of the potential for a substance to produce toxic biological effects outside of the endpoints measured in a sub-chronic rat toxicity study. Substances with biological activity may require additional hazard characterization related to reproductive and developmental toxicity, or immunotoxicity. Considerations for allergenicity, biological effects in humans (e.g., effects on blood pressure), and synergistic effects with other media components also may be evaluated. Such investigations may preferably be evidence-based (i.e., availability of a clinical trial demonstrating that a substance affects blood pressure), rather than theoretical (i.e., based on presumptive mechanisms of action). Similar to category 2 substances, the regulatory status of ingredients in category 3 will require case-by-case evaluation of the regulatory status of the compound (e.g., need for premarket approval or GRAS evaluation). Examples of category 3 components include recombinant proteins and animal serum.
TABLE-US-00016 TABLE 16 Exemplary List of Cell Culture Media Ingredients Used During Meat Production, Risk Categorization, and Safety Information Maximum Risk Estimated Safe Reference Level Assessment Exposure per for Human Dietary Class Compound CAS# Category 100 g serving** Intake (e.g., UL, OSL) Amino Acids L-ALANINE 56-41-7 2 N/A* UL = N/A* L-ARGININE-HCL 1119-34-2 2 N/A* UL = N/A* L-ASPARAGINE-H20 5794-13-8 2 N/A* UL = N/A* L-ASPARTIC ACID 56-84-8 2 N/A* UL = N/A* L-CYSTEINE HCL 7048-04-06 2 N/A* UL = N/A* H20 L-CYSTINE 2HCL 56-89-3 2 N/A* UL = N/A* L-GLUTAMIC ACID 6106-04-03 2 N/A* UL = N/A* MONOSODIUM H2O L-GLUTAMINE 56-85-9 2 N/A* UL = N/A* GLYCINE 56-40-6 2 N/A* UL = N/A* L-HISTIDINE-HCL- 5934-29-2 2 N/A* UL = N/A* H20 L-ISOLEUCINE 73-32-5 2 N/A* UL = N/A* L-LEUCINE 61-90-5 2 N/A* UL = N/A* L-LYSINE-HCL 657-27-2 2 N/A* UL = N/A* L-METHIONINE 63-68-3 2 N/A* UL = N/A* L-PHENYLALANINE 63-91-2 2 N/A* UL = N/A* L-PROLINE 147-85-3 2 N/A* UL = N/A* L-SERINE 56-45-1 2 N/A* UL = N/A* L-THREONINE 72-19-5 2 N/A* UL = N/A* L-TRYPTOPHAN 73-22-3 2 N/A* UL = N/A* L-TYROSINE-2NA- 122666-87-9 2 N/A* UL = N/A* 2H20 L-VALINE 72-18-4 2 N/A* UL = N/A* Carbon D-GLUCOSE 50-99-7 1 N/A NS substrates SUCCINIC ACID 110-15-6 2 200 mg Intakes for a 65 kg adult are 257-fold below NOAEL from 2 year rat study SODIUM 6106-21-4 2 40 mg Intakes for 65 kg adults SUCCINATE-2Na are >1000 fold below 6H20 NOAEL from 2 year rat study. SODIUM PYRUVATE 113-24-6 3 1 g Dietary intakes within the range of OSL valued reported in human investigations Vitamins FOLIC ACID 59-30-3 1 60 mg UL = 300 to 1000 ug/d (upper limit not established based on toxicity, but to prevent people who don't know they have a vitamin B deficiency from consuming too much folic acid) DL-ALPHA- 7695-91-2 1 8 mg UL = 1000 mg/d TOCOPHEROL ACETATE VITAMIN D2 50-14-6 1 24 ug UL = 100 ug/d (ERGOCALCIFEROL) D-ALPHA- 59-02-9 1 1.6 mg UL = 1000 mg/d TOCOPHEROL D-BIOTIN 58-85-5 1 4 mg UL = N/A MYO-INOSITOL 87-89-8 1 430 mg OSL = 4 g/d NIACINAMIDE 98-92-0 1 25 mg UL = 10 to 35 mg (NICOTINAMIDE) (supplements) PYRIDOXINE-HCL 58-56-0 1 25 mg UL = 30 to 100 mg PYRIDOXAL-HCL 1 UL = 30 to 100 mg RIBOFLAVIN 83-88-5 1 3.7 mg UL = NS THIAMINE-HCL 67-03-8 1 18 mg UL = NS VITAMIN B12 68-19-9 1 2 mg UL = NS (CYANCOCOBALAMIN) CALCIUM D- 0137-08-06 1 100 mg UL = NS PANTOTHENATE CHOLINE CHLORIDE 67-48-1 1 52 mg UL = 3.5 g/d ASCORBIC ACID 1 2 g UL = 400 to 2000 mg (theoretical ascorbic acid concentrations represent gross over estimates and likely exceed concentrations by an order of magnitude and are expected to be present at levels well below the UL). Trace Metals SODIUM CHLORIDE 7647-14-5 1 2.3 g/d CALCIUM 1 760 mg 1 to 3 g/d CHLORIDE (ANHY) MANGANESE 10034-96-5 1 3 ug 2 to 11 mg/d SULFATE H2O POTASSIUM 7447-40-7 1 4 g UL = NS CHLORIDE MAGNESIUM 1 170 mg 65 to 350 mg CHLORIDE (ANHY) COPPER SULFATE- 7758-99-8 1 3 mg 1 to 10 mg PENTAHYDRATE SODIUM 13517-24-3 1 1.6 mg Intakes for a 65 kg METASILICATE- adult are 31,000 fold 9H2O below rat NOAEL SODIUM SELENITE 10102-18-8 2 190 ug Intakes for 65 kg adult (ANHY) are 133-fold below 13 week rat NOAEL ZINC SULFATE-7H20 7446-20-0 1 15 mg UL = 5 to 40 mg/day MAGNESIUM 7487-88-9 1 493 mg No UL for food sources; SULFATE (ANHY) UL = 65 to 350 mg (dietary supplements) FERRIC NITRATE- 7782-61-8 3 0.3 mg Iron UL = 40 to 45 mg; 9H2O Nitrate ADI = 3.7 mg/kg bw/day (levels of iron and nitrate are orders of magnitude below the UL and ADI) FERROUS SULFATE- 7782-63-0 2 2.5 mg Iron UL = 40 to 45 mg 7H2O FERRIC CITRATE 3522-50-7 2 (Present as a Iron UL = 40 to 45 mg residue of seed- train scale-up and not used as nutrient source of iron) FERRIC 1185-57-5 2 (Present as a Iron UL = 40 to 45 mg AMMONIUM residue of seed- CITRATE train scale-up and not used as a nutrient source of iron) Iron Carrier Bovine Transferrin 11096-37-0 3 150 mg NR SODIUM 10049-21-5 1 1.5 g NR PHOSPHATE MONOBASIC H20 SODIUM 7558-79-4 1 4.3 g NR PHOSPHATE DIBASIC-ANHY Supplemen- LINOLEIC ACID 60-33-3 2 1 mg AI = 7 to 12 g/d tary Lipids Emulsifier MONOETHANOLAMINE 141-43-5 2 160 mg Dietary intakes for 65 kg adult are 128 fold below rat NOAEL Surfactant/ TWEEN 80 9005-65-6 2 4 mg ADI = 10 mg/kg bw/d Emulsifier Antioxidant L-GLUTATHIONE 70-18-8 2 36 mg NR Animal CHICKEN SERUM www.thermofisher.com/us/en/home/ 3 NR components life-science/cell-culture/ mammalian-cell-culture/ fbs/other-sera/chicken-serum.html BOVINE SERUM www.thermofisher.com/order/catalog/product/ 3 NR 16170060?SID=srch-srp-16170060#/ 16170060?SID=srch-srp-16170060 BOVINE SERUM www.thermofisher.com/order/catalog/product/ 3 NR ALBUMIN 11020021#/11020021 Hydrolysate HYPEP 2 YEAST 8013-01-02 2 2 g NR EXTRACT Growth FGF2 (FIBROBLAST N/A 3 NR Factors GROWTH FACTOR- BASIC) PDGF-BB (PLATELET N/A 3 NR DERIVED GROWTH FACTOR-BB) IGF-1 (INSULIN-LIKE N/A 3 — NR GROWTH FACTOR 1) Peptides RGD 99896-85-2 0.3 ug (Present as N/A a residue of seed- train scale-up and is not directly added to meat production media) YIGSR 110590-64-2 0.3 ug (Present as a residue of seed- train scale-up, not directly added to meat production media) AI = Adequate Intake ADI = Acceptable Daily Intake FNB-IOM = Food and Nutrition Board of the Institute of Medicine HDT = Highest Dose Tested N/A = Not applicable NR = Not reported NS = not specified as no evidence of toxicity from excess intake known NOAEL = No Observed Adverse Effect Level UL = Tolerable Upper Limit OSL = Observed Safe Level *No upper limit when provided as dietary protein **Maximum dietary exposures estimated using conservative assumption of complete transfer of media components to the finished product on a wt/wt basis.
EXEMPLARY EMBODIMENTS
[0164] Embodiment I-1. A cell culture medium comprising a plurality of ingredients, wherein each ingredient is approved for use in food and/or is at or below its ADI value.
[0165] Embodiment I-2. The medium of embodiment I-1, wherein the medium is edible.
[0166] Embodiment I-3. The medium of embodiment I-1 or I-2, wherein the ingredient approved for use in food is Generally Recognized As Safe (GRAS).
[0167] Embodiment I-4. The medium as in one of embodiments I-1 to I-3, wherein the ingredient is approved for use in food by the FDA.
[0168] Embodiment I-5. The medium as in one of embodiments I-1 to I-4, wherein the ingredient is approved for use in food by the USDA.
[0169] Embodiment I-6. The medium as in one of embodiments I-1 to I-5, wherein the ingredient is approved for use in food by the Codex Alimentarius.
[0170] Embodiment I-7. The medium as in one of embodiments I-1 to I-6, wherein the ingredient is approved for use in food by the European Food Safety Authority.
[0171] Embodiment I-8. The medium as in one of embodiments I-1 to I-7, wherein the ingredient is approved for use in food by the Food Chemicals Codex.
[0172] Embodiment I-9. The medium as in one of embodiments I-1 to I-8, wherein the medium contains no more than 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05% or no more than 0.01%% animal-derived serum.
[0173] Embodiment I-10. The medium as in one of embodiments I-1 to I-9, wherein the medium is substantially free of animal-derived serum.
[0174] Embodiment I-11. The medium as in one of embodiments I-1 to I-10, wherein the medium is free of animal-derived serum.
[0175] Embodiment I-12. The medium as in one of embodiments I-1 to I-11, wherein the medium contains no more than 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05% or no more than 0.01%% animal-derived components.
[0176] Embodiment I-13. The medium as in one of embodiments I-1 to I-12, wherein the medium is substantially free of animal-derived components.
[0177] Embodiment I-14. The medium as in one of embodiments I-1 to I-13, wherein the medium is free of animal-derived components.
[0178] Embodiment I-15. The medium as in one of embodiments I-1 to I-14, wherein the medium is chemically defined.
[0179] Embodiment I-16. The medium as in one of embodiments I-1 to I-15, further comprising a growth factor.
[0180] Embodiment I-17. The medium of embodiment I-16, wherein the growth factor is a universal growth factor.
[0181] Embodiment I-18. The medium of embodiment I-17, wherein the universal growth factor is FGF-2.
[0182] Embodiment I-19. The medium of embodiment I-18, wherein the FGF-2 comprises an amino acid sequence set forth in SEQ ID NO: 3.
[0183] Embodiment I-20. The medium of embodiment I-18, wherein the FGF-2 is encoded by a nucleic acid sequence set forth in SEQ ID NO: 4.
[0184] Embodiment I-21. The medium of embodiment I-17, wherein the universal growth factor is a PDGF-BB.
[0185] Embodiment I-22. The medium of embodiment I-21, wherein the PDGF-BB comprises an amino acid sequence set forth in SEQ ID NO: 5.
[0186] Embodiment I-23. The medium of embodiment I-17, wherein the universal growth factor is IGF-1.
[0187] Embodiment I-24. The medium of embodiment I-23, wherein the IGF-1 comprises an amino acid sequence set forth in SEQ ID NO: 6.
[0188] Embodiment I-25. The medium of embodiment I-17, wherein the universal growth factor is VEGF-A.
[0189] Embodiment I-26. The medium of embodiment I-25, wherein the VEGF-A comprises an amino acid sequence set forth in SEQ ID NO: 7.
[0190] Embodiment I-27. The medium of embodiment I-16, wherein the medium is used for culturing cell-based meat and the growth factor is a cis growth factor, wherein the cis growth factor matches the genus of the cells in culture.
[0191] Embodiment I-28. The medium of embodiment I-27, wherein the use of the cis growth factor allows for enhanced cell growth compared to a non-cis growth factor.
[0192] Embodiment I-29. The medium of embodiment I-28, where the cis growth factor is cis Gallus transferrin.
[0193] Embodiment I-30. The medium of embodiment I-27, wherein the cis growth factor is a variant of the corresponding naturally existing growth factor of the genus of the cells in culture.
[0194] Embodiment I-31. The medium of embodiment I-30, wherein the cis growth factor variant is Gallus LR3-IGF1.
[0195] Embodiment I-32. The medium of embodiment I-31, wherein the Gallus LR3-IGF1 comprises an amino acid sequence set forth in SEQ ID NO: 1.
[0196] Embodiment I-33. The medium of embodiment I-16, wherein the growth factor is selected from the group consisting of IGF-1, LR3-IGF1, FGF-1, FGF-2, PDGF, CTGF, EGF, TGFB, BMP, HGF, transferrin, insulin, WNT, interleukins, albumin, VEGF, homologs, paralogs, orthologs, variants, precursors, isoforms, and combinations thereof.
[0197] Embodiment I-34. The medium of embodiment I-16 or I-33, wherein the growth factor is selected from Table 10.
[0198] Embodiment I-35. The medium of embodiment I-16 or I-33, wherein the growth factor is a chicken growth factor, duck growth factor, bovine growth factor, sheep growth factor, fish growth factor, porcine growth factor, mammalian growth factor, avian growth factor, reptile growth factor, amphibian growth factor, arachnid growth factor or teleost growth factor.
[0199] Embodiment I-36. The medium as in one of embodiments I-1 to I-35, further comprising an adhesion protein.
[0200] Embodiment I-37. The medium as in embodiment I-36 wherein the adhesion protein is selected from Table 14.
[0201] Embodiment I-38. The medium as in one of embodiments I-1 to I-37, wherein the plurality of ingredients comprises one or more amino acids at the concentration range shown below:
TABLE-US-00017 Lowest Highest Concentration Concentration Amino Acids (g/L) (g/L) L-ALANINE 0.0001 0.5 L-ARGININE 0.01 2.5 L-ARGININE HYDROCHLORIDE 0.01 1 L-ASPARAGINE ANHYDROUS 0.1 1.5 L-ASPARAGINE MONOHYDRATE 0.01 0.9 L-CYSTEINE HYDROCHLORIDE 0.001 0.5 L-CYSTINE DIHYDROCHLORIDE 0.005 1.5 L-GLUTAMIC ACID 0.01 1.5 L-GLUTAMIC ACID MONOSODIUM 0.01 1.5 SALT MONOHYDRATE L-GLUTAMINE 0.14 1.5 L-GLYCINE 0.01 0.5 L-HISTIDINE FREE BASE 0.01 0.5 L-HISTIDINE HYDROCHLORIDE 0.01 0.5 HYDROXY-L-PROLINE 0.01 0.25 L-ISOLEUCINE 0.1 0.75 L-LEUCINE 0.01 0.75 L-LYSINE 0.01 1 L-METHIONINE 0.05 0.5 L-PHENYLALANINE 0.05 0.5 L-PROLINE 0.1 1 L-SERINE 0.1 1 L-THREONINE 0.05 0.5 L-TRYPTOPHAN 0.01 0.5 L-TYROSINE DISODIUM SALT 0.01 0.5 DIHYDRATE L-VALINE 0.1 0.75 L-ORNITHINE 0.001 0.05 L-ASPARTIC ACID 0.1 0.8 L-ALPHA-AMINOBUTYRIC ACID 0.001 0.025 GABA 0.01 0.2 L-CARNOSINE 0.01 1
[0202] Embodiment I-39. The medium as in one of embodiments I-1 to I-38, wherein the plurality of ingredients comprises one or more carbohydrates at the concentration range shown below:
TABLE-US-00018 Lowest Highest Concentration Concentration Carbohydrates (g/L) (g/L) D-GLUCOSE 1 12 GALACTOSE 0.1 2 MANNOSE 0.1 2 MALTOSE 0.1 2 FUCOSE 0.1 2 SUCROSE 0.1 12 FRUCTOSE 0.1 2 ALLOSE 0.1 2 ALTROSE 0.1 2 GULOSE 0.1 2 IDOSE 0.1 2 TALOSE 0.1 2 PSICOSE 0.1 2 SORBOSE 0.1 2 TAGATOSE 0.1 2 LACTOSE 0.1 2 MYO-INOSITOL 0.01 0.25 RIBOSE 0.1 2
[0203] Embodiment I-40. The medium as in one of embodiments I-1 to I-39, wherein the plurality of ingredients comprises one or more vitamins at the concentration range shown below:
TABLE-US-00019 Lowest Highest Concentration Concentration Vitamins (g/L) (g/L) ASCORBIC ACID (Vit C) 0.0001 0.5 D-BIOTIN (Vit B7) 1.00E−06 0.005 ERGOCALCIFEROL (VitD2) 1.00E−06 5.00E−05 FOLIC ACID (Vit B9) 0.0015 0.02 MENADIONE (Vit K3) 0.00001 0.0005 NIACINAMIDE(NICOTINAMIDE) 0.001 0.01 (Vit B3) NIACIN (Vit B3) 1.00E−06 5.00E−02 CALCIUM D-PANTOTHENATE 0.0005 0.01 (Vit B5) PYRIDOXINE HYDROCHLORIDE 1.00E−05 0.01 (Vit B6) RIBOFLAVIN (Vit B2) 0.0001 0.005 THIAMINE HCL (Vit B1) 0.0025 0.05 CYANOCOBALAMIN (Vit B12) 1.00E−05 0.005 DL-ALPHA-TOCOPHEROL (Vit E) 1.00E−07 0.002 D-ALPHA-TOCOPHEROL (Vit E) 1.00E−07 0.002 PARA-AMINOBENZOIC ACID 0.001 0.01 (PABA) PYRIDOXAL HYDROCHLORIDE 0.0005 0.01 (Vit B6)
[0204] Embodiment I-41. The medium as in one of embodiments I-1 to I-40, wherein the plurality of ingredients comprises one or more inorganic salts at the concentration range shown below:
TABLE-US-00020 Lowest Highest Concentration Concentration Inorganic Salts (g/L) (g/L) CALCIUM CHLORIDE 0.0005 0.2 SODIUM CHLORIDE 0.1 10 SODIUM PHOSPHATE MONOBASIC 0.01 5 SODIUM PHOSPHATE DIBASIC 0.01 5 MAGNESIUM CHLORIDE 0.0005 0.1 MAGNESIUM SULFATE 0.0005 0.1 POTASSIUM CHLORIDE 0.001 1.5
[0205] Embodiment I-42. The medium as in one of embodiments I-1 to I-41, wherein the plurality of ingredients comprises one or more trace metals at the concentration range shown below:
TABLE-US-00021 Lowest Highest Concentration Concentration Trace Metals (g/L) (g/L) CADMIUM HEMIPENTAHYDRATE 0.00000001 0.000001 COBALT CHLORIDE 0.0000001 0.00001 AMMONIUM MOLYBDATE 0.0000001 0.0001 SODIUM MOLYBDATE 0.0000001 0.0001 AMMONIUM METAVANADATE 0.00000001 0.000005 SODIUM METAVANADATE 0.000000001 0.000005 STRONTIUM CHLORIDE 0.00001 0.01 HEXAHYDRATE COPPER SULFATE 2.50E−06 0.0025 SODIUM SELENITE 1.00E−06 1.00E−04 SODIUM METASILICATE 0.00001 0.001 CUPRIC CHLORIDE 1.00E−07 0.001 FERRIC AMMONIUM CITRATE 0.001 1 FERROUS SULFATE 1.00E−05 0.001 FERRIC NITRATE 1.00E−05 0.001 NICKLE SULFATE HEXAHYDRATE 1.00E−07 2.00E−06 STANNOUS CHLORIDE 1.00E−07 1.00E−06 DIHYDRATE FERRIC CITRATE 0.01 1 RUBIDIUM CHLORIDE 1.00E+07 5.00E+05
[0206] Embodiment I-43. The medium as in one of embodiments I-1 to I-42, wherein the plurality of ingredients comprises one or more lipids at the concentration range shown below:
TABLE-US-00022 Lowest Highest Concentration Concentration Lipids (g/L) (g/L) DL-ALPHA-LIPOIC-ACID 0.00001 0.005 OLEIC ACID 1.00E−06 0.001 CHOLESTEROL 0.00005 0.005 LECITHIN 1.00E−05 0.01 LINOLEIC ACID 1.00E−05 0.005 ARACHIDONIC ACID 1.00E−08 5.00E−05 LINOLENIC ACID 1.00E−06 1.00E−03 MYRISTIC ACID 1.00E−06 1.00E−03 PALMITIC ACID 1.00E−06 1.00E−03 PALMITOLEIC ACID 1.00E−06 1.00E−03 STEARIC ACID 1.00E−06 1.00E−03
[0207] Embodiment I-44. The medium as in one of embodiments I-1 to I-43, wherein the plurality of ingredients comprises one or more food oils at the concentration range shown below:
TABLE-US-00023 Lowest Highest Concentration Concentration Food oils (g/L) (g/L) FLAXSEED OIL 1.00E−06 5.00E−03 CANOLA OIL 1.00E−06 5.00E−03 ALGAL OIL 1.00E−06 5.00E−03 OTHER FOOD OILS 1.00E−06 5.00E−03
[0208] Embodiment I-45. The medium as in one of embodiments I-1 to I-44, wherein the plurality of ingredients comprises one or more growth factors at the concentration range shown below:
TABLE-US-00024 Lowest Highest Concentration Concentration Growth Factors (g/L) (g/L) Insulin 8.00E−04 0.008 LR3-IGF1 0.009 0.04 Transferrin (Holo) 0.01 0.5 FGF-2 1.00E−06 1.00E−03 FGF-1 1.00E−06 1.00E−03 PDGF 1.00E−06 1.00E−03 CTGF 1.00E−06 1.00E−03 EGF 1.00E−06 1.00E−03 TGFB 1.00E−06 1.00E−03 BMP 1.00E−06 1.00E−03 HGF 1.00E−06 1.00E−03 KGF 1.00E−06 1.00E−03
[0209] Embodiment I-46. The medium as in one of embodiments I-1 to I-45, wherein the plurality of ingredients comprises one or more supplementary ingredients at the concentration range shown below:
TABLE-US-00025 Lowest Highest Concentration Concentration Supplementary Ingredients (g/L) (g/L) HYPOXANTHINE 0.0001 0.01 THYMIDINE 1.50E−04 0.001 TWEEN 80 (POLYSORBATE) 1.00E−04 0.005 PUTRESCINE 1.00E−04 0.0009 DIHYDROCHLORIDE SPERMINE 1.00E−02 0.05 TETRAHYDROCHLORIDE SPERMIDINE 1.00E−04 0.05 CADAVERINE 1.00E−04 0.05 ETHANOLAMINE 2.00E−03 0.08 ETHANOL (ETHYL ALCOHOL) 6.00E−05 1 SODIUM CITRATE 0.5 0.5 SODIUM GLUCONATE 0.5 1.5 METHYL BETA CYCLODEXTRIN 0.05 0.075 L-TAURINE 0.01 0.1 CHOLINE CHLORIDE 0.001 0.5
[0210] Embodiment I-47. The medium as in one of embodiments I-1 to I-46, wherein the plurality of ingredients comprises one or more TCA cycle intermediates at the concentration range shown below:
TABLE-US-00026 Lowest Highest Concentration Concentration TCA Cycle Intermediates (g/L) (g/L) SODIUM PYRUVATE 0.01 0.5 SUCCINIC ACID 0.005 1.5 SODIUM SUCCINATE 0.005 0.1
[0211] Embodiment I-48. The medium as in one of embodiments I-1 to I-47, wherein the plurality of ingredients comprises one or more glycolysis intermediates, iron carriers, ferric maltol, ferrous gluconate, shear protectants, polyethylene glycol, methylcellulose, and hydrolysates.
[0212] Embodiment I-49. The medium as in one of embodiments I-1 to I-48, wherein the medium is admixed with water to form a solution.
[0213] Embodiment I-50. The medium as in one of embodiments I-1 to I-49, wherein the medium comprises methylcellulose.
[0214] Embodiment I-51. The medium as in one of embodiments I-1 to I-50, wherein the medium comprises cyanocobalamin, optionally at a concentration range of 1.00E+05 g/L to 0.0026 g/L.
[0215] Embodiment I-52. The medium as in one of embodiments I-1 to I-51, wherein the medium comprises simethicone.
[0216] Embodiment I-53. The medium as in one of embodiments I-1 to I-52, wherein the medium comprises ferric ammonium citrate, optionally at a concentration range of 0.01 g/L to 0.5 g/L.
[0217] Embodiment I-54. The medium as in one of embodiments I-1 to I-53, wherein the medium comprises food-grade plant oils.
[0218] Embodiment I-55. A composition comprising the medium as in one of embodiments I-1 to I-54, further comprising non-human cells in culture.
[0219] Embodiment I-56. The composition of embodiment I-55, wherein the cells are from poultry, seafood, game or livestock.
[0220] Embodiment I-57. The medium as in one of embodiments I-1 to I-56, wherein the plurality of ingredients comprises one or more amino acids, magnesium salts, sodium salts, copper salts, zinc salts, iron salts, and vitamins.
[0221] Embodiment I-58. The medium of embodiment I-57 wherein the ingredients are at the concentration range shown below:
TABLE-US-00027 Lowest Highest Concentration Concentration Ingredients (g/L) (g/L) L-ARGININE 0.01 2.5 L-CYSTEINE 0.001 0.5 L-CYSTINE 0.005 1.5 L-GLUTAMINE 0.14 1.5 L-HISTIDINE 0.01 0.5 L-ISOLEUCINE 0.1 0.75 L-LEUCINE 0.01 0.75 L-LYSINE 0.01 1 L-METHIONINE 0.05 0.5 L-PHENYLALANINE 0.05 0.5 L-PROLINE 0.1 1 L-TRYPTOPHAN 0.01 0.5 L-TYROSINE 0.01 0.5 L-VALINE 0.1 0.75 D-GLUCOSE 1 12 NIACIN (Vit B3) 1.00E−06 5.00E−02 RIBOFLAVIN 0.0001 0.005 ERGOCALCIFEROL (VitD2) 1.00E−06 5.00E−05 ASCORBIC ACID (Vit C) 0.0001 0.5 COPPER SULFATE 2.50E−06 0.0025 SODIUM SELENITE 1.00E−06 1.00E−04 FERRIC AMMONIUM CITRATE 0.001 1 MAGNESIUM CHLORIDE 0.0005 0.1 MAGNESIUM SULFATE 0.0005 0.1 ZINC SULFATE 0.00005 0.01
[0222] Embodiment I-59. A universal FGF-2 comprising the amino acid sequence set forth in SEQ ID NO: 3.
[0223] Embodiment I-60. A universal FGF-2 encoded by the nucleic acid sequence set forth in SEQ ID NO: 4.
[0224] Embodiment I-61. A universal PDGF-BB comprising the amino acid sequence set forth in SEQ ID NO: 5.
[0225] Embodiment I-62. A universal IGF-1 comprising the amino acid sequence set forth in SEQ ID NO: 6.
[0226] Embodiment I-63. A universal VEGF-A comprising the amino acid sequence as in SEQ ID NO: 7.
[0227] Embodiment I-64. A Gallus LR3-IGF1 comprising the amino acid sequence set forth in SEQ ID NO: 1.
[0228] Embodiment I-65. A method for formulating a medium for culturing cell-based meat comprising:
[0229] (a) providing a plurality of ingredients; and
[0230] (b) one or more of: [0231] (i) replacing one or more ingredients currently not approved for use in food with an ingredient approved for use in food; [0232] (ii) removing one or more ingredients currently not approved for use in food; and [0233] (iii) formulating one or more ingredients currently not approved for use in food at or below ADI value.
[0234] Embodiment I-66. The method of embodiment I-65, wherein the medium is edible.
[0235] Embodiment I-67. The method of embodiment I-65 or I-66, wherein the medium contains no more than 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05% or no more than 0.01% animal-derived serum.
[0236] Embodiment I-68. The method as in one of embodiments I-65 to I-67, wherein the medium is substantially free of animal-derived serum.
[0237] Embodiment I-69. The method as in one of embodiments I-65 to I-68, wherein the medium is free of animal-derived serum.
[0238] Embodiment I-70. The method as in one of embodiments I-65 to I-69, wherein the medium contains no more than 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05% or no more than 0.01%% animal-derived components.
[0239] Embodiment I-71. The method as in one of embodiments I-65 to I-70, wherein the medium is substantially free of animal-derived components.
[0240] Embodiment I-72. The method as in one of embodiments I-65 to I-71, wherein the medium is free of animal-derived components.
[0241] Embodiment I-73. The method as in one of embodiments I-65 to I-72, wherein the medium is chemically defined.
[0242] Embodiment I-74. The method as in one of embodiments I-65 to I-73, wherein poloxamer is replaced with methylcellulose.
[0243] Embodiment I-75. The method as in one of embodiments I-65 to I-74, wherein cobalt chloride is replaced with cyanocobalamin.
[0244] Embodiment I-76. The method as in one of embodiments I-65 to I-75, wherein an anti-foaming agent currently not approved for use in food is replaced with simethicone.
[0245] Embodiment I-77. The method as in one of embodiments I-65 to I-76, wherein one or more of ammonium molybdate, sodium molybdate, ammonium metavanadate, sodium metavanadate, rubidium chloride and strontium chloride hexahydrate is replaced with ferric ammonium citrate.
[0246] Embodiment I-78. The method as in one of embodiments I-65 to I-77, further comprising adding a growth factor of any one of embodiments I-59 to I-64.
[0247] Embodiment II-1. An edible nutrient medium for the production of slaughter-free meat, the medium comprising a plurality of ingredients, wherein each ingredient is approved for use in food and/or is at or below its ADI value.
[0248] Embodiment II-2. The medium of embodiment II-1, wherein the ingredient approved for use in food is Generally Recognized As Safe (GRAS).
[0249] Embodiment II-3. The medium of embodiment II-1, wherein the medium is substantially free of animal-derived components.
[0250] Embodiment II-4. The medium of embodiment II-1, wherein the medium is substantially free of animal-derived serum.
[0251] Embodiment II-5. The medium of embodiment II-1, further comprising a growth factor.
[0252] Embodiment II-6. The medium of embodiment II-5, wherein the growth factor is a universal growth factor selected from the group consisting of universal FGF-2 (SEQ ID NO: 3), universal PDGF-BB (SEQ ID NO: 5), universal IGF-1 (SEQ ID NO: 6), and universal VEGF-A (SEQ ID NO: 7) or a sequence having at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% sequence identity thereto.
[0253] Embodiment II-7. The medium of embodiment II-6, wherein the medium comprises a cis growth factor, wherein the cis growth factor matches the genus of origin of the meat being produced.
[0254] Embodiment II-8. The medium of embodiment II-7, wherein the use of the cis growth factor allows for enhanced meat production compared to a non-cis growth factor.
[0255] Embodiment II-9. The medium of embodiment II-8, where the cis growth factor is cis Gallus transferrin.
[0256] Embodiment II-10. The medium of embodiment II-7, wherein the cis growth factor is a variant of the corresponding naturally existing growth factor of the genus of the meat being produced.
[0257] Embodiment II-11. The medium of embodiment II-10, wherein the cis growth factor variant is Gallus LR3-IGF1, optionally comprising an amino acid sequence set forth in SEQ ID NO: 1.
[0258] Embodiment II-12. The medium of embodiment II-5, wherein the growth factor is selected from the group consisting of IGF-1, LR3-IGF1, FGF-1, FGF-2, PDGF, CTGF, EGF, TGFB, BMP, HGF, transferrin, insulin, WNT, interleukins, albumin, VEGF, homologs, paralogs, orthologs, variants, precursors, isoforms, and combinations thereof.
[0259] Embodiment II-13. The medium of embodiment II-5, wherein the growth factor is selected from Table 10.
[0260] Embodiment II-14. The medium of embodiment II-5, wherein the growth factor is a chicken growth factor, duck growth factor, bovine growth factor, sheep growth factor, fish growth factor, porcine growth factor, mammalian growth factor, avian growth factor, reptile growth factor, amphibian growth factor, arachnid growth factor or teleost growth factor.
[0261] Embodiment II-15. The medium of embodiment II-1, further comprising an adhesion protein selected from Table 14.
[0262] Embodiment II-16. The medium of embodiment II-1, wherein the plurality of ingredients comprises one or more amino acids at the concentration range shown below:
TABLE-US-00028 Lowest Highest Concentration Concentration Amino Acids (g/L) (g/L) L-ALANINE 0.0001 0.5 L-ARGININE 0.01 2.5 L-ARGININE HYDROCHLORIDE 0.01 1 L-ASPARAGINE ANHYDROUS 0.1 1.5 L-ASPARAGINE MONOHYDRATE 0.01 0.9 L-CYSTEINE HYDROCHLORIDE 0.001 0.5 L-CYSTINE DIHYDROCHLORIDE 0.005 1.5 L-GLUTAMIC ACID 0.01 1.5 L-GLUTAMIC ACID MONOSODIUM 0.01 1.5 SALT MONOHYDRATE L-GLUTAMINE 0.14 1.5 L-GLYCINE 0.01 0.5 L-HISTIDINE FREE BASE 0.01 0.5 L-HISTIDINE HYDROCHLORIDE 0.01 0.5 HYDROXY-L-PROLINE 0.01 0.25 L-ISOLEUCINE 0.1 0.75 L-LEUCINE 0.01 0.75 L-LYSINE 0.01 1 L-METHIONINE 0.05 0.5 L-PHENYLALANINE 0.05 0.5 L-PROLINE 0.1 1 L-SERINE 0.1 1 L-THREONINE 0.05 0.5 L-TRYPTOPHAN 0.01 0.5 L-TYROSINE DISODIUM SALT 0.01 0.5 DIHYDRATE L-VALINE 0.1 0.75 L-ORNITHINE 0.001 0.05 L-ASPARTIC ACID 0.1 0.8 L-ALPHA-AMINOBUTYRIC ACID 0.001 0.025 GABA 0.01 0.2 L-CARNOSINE 0.01 1
[0263] Embodiment II-17. The medium of embodiment II-1, wherein the plurality of ingredients comprises one or more carbohydrates at the concentration range shown below:
TABLE-US-00029 Lowest Highest Concentration Concentration Carbohydrates (g/L) (g/L) D-GLUCOSE 1 12 GALACTOSE 0.1 2 MANNOSE 0.1 2 MALTOSE 0.1 2 FUCOSE 0.1 2 SUCROSE 0.1 12 FRUCTOSE 0.1 2 ALLOSE 0.1 2 ALTROSE 0.1 2 GULOSE 0.1 2 IDOSE 0.1 2 TALOSE 0.1 2 PSICOSE 0.1 2 SORBOSE 0.1 2 TAGATOSE 0.1 2 LACTOSE 0.1 2 MYO-INOSITOL 0.01 0.25 RIBOSE 0.1 2
[0264] Embodiment II-18. The medium of embodiment II-1, wherein the plurality of ingredients comprises one or more vitamins at the concentration range shown below:
TABLE-US-00030 Lowest Highest Concentration Concentration Vitamins (g/L) (g/L) ASCORBIC ACID (Vit C) 0.0001 0.5 D-BIOTIN (Vit B7) 1.00E−06 0.005 ERGOCALCIFEROL (VitD2) 1.00E−06 5.00E−05 FOLIC ACID (Vit B9) 0.0015 0.02 MENADIONE (Vit K3) 0.00001 0.0005 NIACINAMIDE(NICOTINAMIDE) 0.001 0.01 (Vit B3) NIACIN (Vit B3) 1.00E−06 5.00E−02 CALCIUM D-PANTOTHENATE 0.0005 0.01 (Vit B5) PYRIDOXINE HYDROCHLORIDE 1.00E−05 0.01 (Vit B6) RIBOFLAVIN (Vit B2) 0.0001 0.005 THIAMINE HCL (Vit B1) 0.0025 0.05 CYANOCOBALAMIN (Vit B12) 1.00E−05 0.005 DL-ALPHA-TOCOPHEROL (Vit E) 1.00E−07 0.002 D-ALPHA-TOCOPHEROL (Vit E) 1.00E−07 0.002 PARA-AMINOBENZOIC ACID 0.001 0.01 (PABA) PYRIDOXAL HYDROCHLORIDE 0.0005 0.01 (Vit B6)
[0265] Embodiment II-19. The medium of embodiment II-1, wherein the plurality of ingredients comprises one or more inorganic salts at the concentration range shown below:
TABLE-US-00031 Lowest Highest Concentration Concentration Inorganic Salts (g/L) (g/L) CALCIUM CHLORIDE 0.0005 0.2 SODIUM CHLORIDE 0.1 10 SODIUM PHOSPHATE MONOBASIC 0.01 5 SODIUM PHOSPHATE DIBASIC 0.01 5 MAGNESIUM CHLORIDE 0.0005 0.1 MAGNESIUM SULFATE 0.0005 0.1 POTASSIUM CHLORIDE 0.001 1.5
[0266] Embodiment II-20. The medium of embodiment II-1, wherein the plurality of ingredients comprises one or more trace metals at the concentration range shown below:
TABLE-US-00032 Lowest Highest Concentration Concentration Trace Metals (g/L) (g/L) CADMIUM HEMIPENTAHYDRATE 0.00000001 0.000001 COBALT CHLORIDE 0.0000001 0.00001 AMMONIUM MOLYBDATE 0.0000001 0.0001 SODIUM MOLYBDATE 0.0000001 0.0001 AMMONIUM METAVANADATE 0.00000001 0.000005 SODIUM METAVANADATE 0.000000001 0.000005 STRONTIUM CHLORIDE 0.00001 0.01 HEXAHYDRATE COPPER SULFATE 2.50E−06 0.0025 SODIUM SELENITE 1.00E−06 1.00E−04 SODIUM METASILICATE 0.00001 0.001 CUPRIC CHLORIDE 1.00E−07 0.001 FERRIC AMMONIUM CITRATE 0.001 1 FERROUS SULFATE 1.00E−05 0.001 FERRIC NITRATE 1.00E−05 0.001 NICKLE SULFATE HEXAHYDRATE 1.00E−07 2.00E−06 STANNOUS CHLORIDE 1.00E−07 1.00E−06 DIHYDRATE FERRIC CITRATE 0.01 1 RUBIDIUM CHLORIDE 1.00E+07 5.00E+05
[0267] Embodiment II-21. The medium of embodiment II-1, wherein the plurality of ingredients comprises one or more lipids at the concentration range shown below:
TABLE-US-00033 Lowest Highest Concentration Concentration Lipids (g/L) (g/L) DL-ALPHA-LIPOIC-ACID 0.00001 0.005 OLEIC ACID 1.00E−06 0.001 CHOLESTEROL 0.00005 0.005 LECITHIN 1.00E−05 0.01 LINOLEIC ACID 1.00E−05 0.005 ARACHIDONIC ACID 1.00E−08 5.00E−05 LINOLENIC ACID 1.00E−06 1.00E−03 MYRISTIC ACID 1.00E−06 1.00E−03 PALMITIC ACID 1.00E−06 1.00E−03 PALMITOLEIC ACID 1.00E−06 1.00E−03 STEARIC ACID 1.00E−06 1.00E−03
[0268] Embodiment II-22. The medium of embodiment II-1, wherein the plurality of ingredients comprises one or more food oils at the concentration range shown below:
TABLE-US-00034 Lowest Highest Concentration Concentration Food oils (g/L) (g/L) FLAXSEED OIL 1.00E−06 5.00E−03 CANOLA OIL 1.00E−06 5.00E−03 ALGAL OIL 1.00E−06 5.00E−03 OTHER FOOD OILS 1.00E−06 5.00E−03
[0269] Embodiment II-23. The medium of embodiment II-1, wherein the plurality of ingredients comprises one or more growth factors at the concentration range shown below:
TABLE-US-00035 Lowest Highest Concentration Concentration Growth Factors (g/L) (g/L) Insulin 8.00E−04 0.008 LR3-IGF1 0.009 0.04 Transferrin (Holo) 0.01 0.5 FGF-2 1.00E−06 1.00E−03 FGF-1 1.00E−06 1.00E−03 PDGF 1.00E−06 1.00E−03 CTGF 1.00E−06 1.00E−03 EGF 1.00E−06 1.00E−03 TGFB 1.00E−06 1.00E−03 BMP 1.00E−06 1.00E−03 HGF 1.00E−06 1.00E−03 KGF 1.00E−06 1.00E−03
[0270] Embodiment II-24. The medium of embodiment II-1, wherein the plurality of ingredients comprises one or more supplementary ingredients at the concentration range shown below:
TABLE-US-00036 Lowest Highest Concentration Concentration Supplementary Ingredients (g/L) (g/L) HYPOXANTHINE 0.0001 0.01 THYMIDINE 1.50E−04 0.001 TWEEN 80 (POLYSORBATE) 1.00E−04 0.005 PUTRESCINE DIHYDROCHLORIDE 1.00E−04 0.0009 SPERMINE 1.00E−02 0.05 TETRAHYDROCHLORIDE SPERMIDINE 1.00E−04 0.05 CADAVERINE 1.00E−04 0.05 ETHANOLAMINE 2.00E−03 0.08 ETHANOL (ETHYL ALCOHOL) 6.00E−05 1 SODIUM CITRATE 0.5 0.5 SODIUM GLUCONATE 0.5 1.5 METHYL BETA CYCLODEXTRIN 0.05 0.075 L-TAURINE 0.01 0.1 CHOLINE CHLORIDE 0.001 0.5
[0271] Embodiment II-25. The medium of embodiment II-1, wherein the plurality of ingredients comprises one or more TCA cycle intermediates at the concentration range shown below:
TABLE-US-00037 Lowest Highest Concentration Concentration TCA Cycle Intermediates (g/L) (g/L) SODIUM PYRUVATE 0.01 0.5 SUCCINIC ACID 0.005 1.5 SODIUM SUCCINATE 0.005 0.1
[0272] Embodiment II-26. The medium of embodiment II-1, wherein the plurality of ingredients comprises one or more glycolysis intermediates, iron carriers, ferric maltol, ferrous gluconate, shear protectants, polyethylene glycol, methylcellulose, simethicone, food-grade plant oils and hydrolysates.
[0273] Embodiment II-27. The medium of embodiment II-1 wherein the ingredients are at the concentration range shown below:
TABLE-US-00038 Lowest Highest Concentration Concentration Ingredients (g/L) (g/L) L-ARGININE 0.01 2.5 L-CYSTEINE 0.001 0.5 L-CYSTINE 0.005 1.5 L-GLUTAMINE 0.14 1.5 L-HISTIDINE 0.01 0.5 L-ISOLEUCINE 0.1 0.75 L-LEUCINE 0.01 0.75 L-LYSINE 0.01 1 L-METHIONINE 0.05 0.5 L-PHENYLALANINE 0.05 0.5 L-PROLINE 0.1 1 L-TRYPTOPHAN 0.01 0.5 L-TYROSINE 0.01 0.5 L-VALINE 0.1 0.75 D-GLUCOSE 1 12 NIACIN (Vit B3) 1.00E−06 5.00E−02 RIBOFLAVIN 0.0001 0.005 ERGOCALCIFEROL (VitD2) 1.00E−06 5.00E−05 ASCORBIC ACID (Vit C) 0.0001 0.5 COPPER SULFATE 2.50E−06 0.0025 SODIUM SELENITE 1.00E−06 1.00E−04 FERRIC AMMONIUM CITRATE 0.001 1 MAGNESIUM CHLORIDE 0.0005 0.1 MAGNESIUM SULFATE 0.0005 0.1 ZINC SULFATE 0.00005 0.01
[0274] Embodiment II-28. A universal growth factor selected from the group consisting of universal FGF-2 (SEQ ID NO: 3), universal PDGF-BB (SEQ ID NO: 5), universal IGF-1 (SEQ ID NO: 6), and universal VEGF-A (SEQ ID NO: 7) or a sequence having at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% sequence identity thereto.
[0275] Embodiment II-29. A Gallus LR3-IGF1 comprising the amino acid sequence set forth in SEQ ID NO: 1 or a sequence having at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% sequence identity thereto.
[0276] Embodiment II-30. A method for formulating a nutrient medium for the production of slaughter-free meat comprising:
[0277] (a) providing a plurality of ingredients; and
[0278] (b) one or more of: [0279] (i) replacing one or more ingredients currently not approved for use in food with an ingredient approved for use in food; [0280] (ii) removing one or more ingredients currently not approved for use in food; and [0281] (iii) formulating one or more ingredients currently not approved for use in food at or below ADI value.
[0282] Embodiment II-31. The method of embodiment II-30 wherein the replacing one or more ingredients currently not approved for use in food with an ingredient approved for use in food, comprises one or more of:
[0283] a. wherein poloxamer is replaced with methylcellulose;
[0284] b. wherein cobalt chloride is replaced with cyanocobalamin;
[0285] b. wherein an anti-foaming agent currently not approved for use in food is replaced with simethicone; and
[0286] c. wherein one or more ammonium molybdate, sodium molybdate, ammonium metavanadate, sodium metavanadate, rubidium chloride and strontium chloride hexahydrate is replaced with ferric ammonium citrate.
[0287] Embodiment II-32. The method of embodiment II-30, wherein poloxamer is replaced with methylcellulose.
[0288] Embodiment II-33. The method of embodiment II-30, wherein cobalt chloride is replaced with cyanocobalamin.
[0289] Embodiment II-34. The method of embodiment II-30, wherein an anti-foaming agent currently not approved for use in food is replaced with simethicone.
[0290] Embodiment II-35. The method of embodiment II-30, wherein one or more of ammonium molybdate, sodium molybdate, ammonium metavanadate, and sodium metavanadate is replaced with ferric ammonium citrate.
EXAMPLES
Example 1. Growth of Adherent Gallus Cells in Cell Culture Medium Containing GRAS Vs Non-GRAS Ingredients
[0291] Adherent Gallus cells were thawed and seeded at a density of 5000 cells/cm.sup.2 in a T25-flask. Three media were prepared according to standard media hydration protocols. Dry powder media was added to DI water in clean vessels and allowed to stir until all components were dissolved. The pH and osmolality of the media were adjusted to 7.4 and 300 mOsm/kg respectively. Media were then filtered using 0.22 μm PES filtration units and stored at 4° C. until use. Prior to use, the media were allowed to come up to room temperature. Three different media conditions were prepared, (1) an exemplary animal component free cell-medium of the present disclosure media hydrated without chemical components which lack a GRAS designation for food applications, or which do not have a GRAS designation (GRAS-ACF), (2) a serum free cell culture medium containing Non-GRAS certified ingredients (Non-GRAS SF), and (3) negative control. Test conditions were seeded in triplicate in 6-well plates at a density of 5000 cells/cm.sup.2. Cells were incubated at 39° C. in 5% CO.sub.2 in a Biotek BioSpa Live Cell Analysis System (BioSpa) for over five days. Cells were imaged every 12 hours using the BioSpa. Images were processed using BioTeck Gen5 Data Analysis software. Data was then exported and analyzed using Microsoft Excel and SAS JMP.
[0292]
Example 2. Growth of Suspension Gallus Cells in Cell Culture Medium Containing GRAS Vs Non-GRAS Ingredients
[0293] Suspension Gallus cells were thawed and seeded at a density of 0.25×10.sup.6 cells/mL in 125 mL erlenmeyer cell culture flasks. Cells were placed in a 39° C. shaking incubator with 5% CO.sub.2 with a rotation speed of 125 RPM. Two media were prepared according to standard media hydration protocols. Dry powder media was added to DI water in clean vessels and allowed to stir until all components were dissolved. The pH and osmolality of the media were adjusted to 7.4 and 300 mOsm/kg respectively. Media were then filtered using 0.22 μm PES filtration units and stored at 4° C. until use. Prior to use, the media were allowed to come up to room temperature. Two different media conditions were prepared, (1) an exemplary animal component free cell-medium of the present disclosure media hydrated without chemical components which lack a GRAS designation for food applications, or which do not have a GRAS designation (GRAS-ACF) and (2) a serum free cell culture medium containing Non-GRAS certified ingredients (Non-GRAS SF). Test conditions were seeded in duplicate in 125 mL erlenmeyer cell culture flasks at a density of 0.25×10.sup.6 cells/mL. Cells were incubated for 4 days. Samples were taken daily using aseptic technique and then counted using a Beckman-Coulter Vi-CELL XR. Data was exported and analyzed using Microsoft Excel and SAS JMP.
[0294]
[0295] Examples 1 and 2 demonstrate the ability of exemplary animal component free cell culture media of the present disclosure containing GRAS certified ingredients to support growth of both adherent and suspensions cells compared to cell media containing potentially hazardous Non-GRAS certified ingredients.
Example 3. Comparison of Suspension Cell Growth in Commercially Available Media Vs an Optimized Media
[0296] Suspension Gallus cells were thawed and seeded at a density of 0.25×10.sup.6 cells/mL in 125 mL erlenmeyer cell culture flasks. Cells were placed in a 39° C. shaking incubator with 5% CO.sub.2 with a rotation speed of 125 RPM. Cells were incubated using two different media conditions (1) a commercially available medium (commercial media) and (2) an exemplary animal component free cell-medium of the present disclosure (optimized media). Media was prepared according to standard media hydration protocols. Dry powder media was added to DI water in a clean vessel and allowed to stir until all components were dissolved. The pH and osmolality of the medium was adjusted to 7.4 and 300 mOsm/kg respectively. The medium was then filtered using a 0.22 μm PES filtration unit and stored at 4° C. until use. Test conditions were seeded in duplicate. Cells were incubated for 5 days. Samples were taken daily using aseptic technique and then counted using a Beckman-Coulter Vi-CELL XR. Data was exported and analyzed using Microsoft Excel and SAS JMP.
[0297]
Example 4. Generation of Universal Recombinant Growth Factors
[0298] By way of example, the production of universal recombinant FGF-2, PDGF-BB, VEGF-A, and IGF-1 are described below.
[0299] Universal FGF-2
[0300] A universal FGF-2 was constructed using the most common amino acid residues at each site according to Uniprot alignment program https://www.uniprot.org/. FGF-2 sequences were chosen from several common mammalian, amphibian and avian species including mouse, rat, chicken, bovine, human, chimpanzee, sheep, xenopus, dog, ferret, cat and horse. The canonical amino acids that reflect the most common choice of amino acid at each position is shown in the amino acid sequence shown in SEQ ID NO:3 (Table 13).
[0301] Cloning of universal FGF-2 into the E. coli expression vector pET32a (+) was done following Soleyman et al. High-level Expression and Purification of Active Human FGF-2 in Escherichia coli by Codon and Culture Condition Optimization Iran Red Crescent Med J. 2016 February; 18(2): e21615. The amino acid sequence was codon optimized for E. coli BL21 (DE3) expression. The DNA sequence for the universal FGF-2 (SEQ ID NO:4, Table 13) was submitted for total gene synthesis and included PCR nucleotide sequences designed by NEB Builder to insert the sequence into PET32a(+) using NEBuilder® HiFi DNA Assembly Master Mix/NEBuilder HiFi DNA Assembly Cloning Kit per manufacturer's instructions.
[0302] Universal PDGF-BB
[0303] A universal PDGF-BB was constructed using the same method as described above for universal FGF-2. The amino acid sequence for universal PDGF-BB is shown in SEQ ID NO: 5 (Table 13).
[0304] Universal IGF-1 and Universal VEGF-A
[0305] Universal IGF-1 and Universal VEGF-A were constructed using a similar method as described above for universal FGF-2 with some variations. The amino acid sequence for universal IGF-1 and universal VEGF-A are shown in SEQ ID NO. 6 and SEQ ID NO. 7, respectively (Table 13). Clustal Omega multiple sequence alignment program was used, https://www.ebi.ac.uk/Tools/msa/clustalo/. IGF-1 and VEGF-A sequences were chosen from species including human, bovine, pig, sheep, goat and chicken. The universal growth factors sequences were determined from EMBOSS Cons tool, to determine the consensus amino acid residue at each location, https://www.ebi.ac.uk/Tools/msa/emboss_cons/.
Example 5. Production of Species-Specific Cis Recombinant Growth Factors
[0306] Species-specific cis growth factors for the purpose of growing cultured-meat of the same genus/species were recombinantly produced in E. coli or mammalian cells. By way of example, recombinant production of Gallus FGF-2 for use in culture of cell-based chicken is described below.
[0307] DNA encoding for Gallus FGF-2 was codon optimized for bacterial expression. The DNA was then inserted into a bacterial expression vector, such as PET32a. The vector carrying the gene coding for the cis growth factor was expressed in E. coli and optimized for protein production and purification. Bioactivity of the purified protein was determined by proliferation assay in growth factor sensitive cells, such as NIH3T3 fibroblasts. The purified growth factor was then used in cell cultures to facilitate the production of cell-based meat.
Example 6. Cellular Response to Cis Recombinant Gallus FGF-2 Compared to Commercial Human Recombinant FGF-2
[0308] Adherent Gallus cells were thawed and seeded at a density of 5000 cells/cm.sup.2 in a T25-flask. One medium was prepared according to standard media hydration protocols. Dry powder media was added to DI water in a clean vessel and allowed to stir until all components were dissolved. The pH and osmolality of the medium were adjusted to 7.4 and 300 mOsm/kg respectively. The medium was then filtered using a 0.22 μm PES filtration unit and stored at 4° C. until use. Prior to use, the medium was allowed to come up to room temperature. Cells were seeded in the inner wells of a 96-well cell culture plate. Wells were either seeded with one of two different FGF-2 growth factors, a recombinant Gallus FGF-2 produced as described in Example 5, or a commercially available recombinant human FGF-2, or without any growth factors. Each growth factor was seeded at two different concentrations, 10 μg/L or 100 μg/L. Test conditions were all seeded in triplicate at a density of 5000 cells/cm.sup.2. Cells were incubated at 39° C. in 5% CO.sub.2 in a Biotek BioSpa Live Cell Analysis System (BioSpa) for five days. Cells were imaged every 12 hours using the BioSpa. Images were processed using BioTeck Gen5 Data Analysis software. Data was then exported and analyzed using Microsoft Excel and SAS JMP.
[0309]
Example 7. Growth of Adherent Gallus Cells in Cell Culture Medium Comprising Cis Gallus Transferrin Vs. Human Recombinant Transferrin
[0310] Adherent Gallus cells were thawed and seeded at a density of 5000 cells/cm.sup.2 in a T25-flask. Three media were prepared according to standard media hydration protocols. Dry powder media was added to DI water in clean vessels and allowed to stir until all components were dissolved. The pH and osmolality of the media were adjusted to 7.4 and 300 mOsm/kg respectively. Media were then filtered using 0.22 μm PES filtration units and stored at 4° C. until use. Prior to use, the media were allowed to come up to room temperature. Three different media conditions were prepared, (1) an exemplary serum free cell-medium of the present disclosure media hydrated with human recombinant transferrin, (2) a serum free cell culture medium hydrated with Gallus (chicken) transferrin, and (3) a positive control media hydrated with human recombinant transferrin and a commercial serum replacement product. Test conditions were seeded in 96-well plates at a density of 5000 cells/cm.sup.2. Cells were incubated at 39° C. in 5% CO.sub.2 in a Biotek BioSpa Live Cell Analysis System (BioSpa) for five days. Cells were imaged after 7 days using the BioSpa. Images were processed using BioTeck Gen5 Data Analysis software. Data was then exported and analyzed using Microsoft Excel and SAS JMP.
[0311]