SINGLE DOMAIN ANTIBODIES TARGETING SARS CORONAVIRUS SPIKE PROTEIN AND USES THEREOF

20230391852 · 2023-12-07

Assignee

Inventors

Cpc classification

International classification

Abstract

Polypeptides that specifically bind the spike (S) protein of human coronavirus, selected from six camel V.sub.HH single domain antibody phage display libraries, are described. The S protein-specific polypeptides disrupt binding of the SARS-CoV-2 and/or SARS-CoV S protein to the cellular receptor ACE2, which is important for neutralization of the virus. Use of the S protein-specific polypeptides for the diagnosis and treatment of SARS-CoV-2 and/or SARS-CoV is described.

Claims

1. A polypeptide that specifically binds a severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) spike (S) protein, a SARS-CoV S protein, or both SARS-CoV-2 S protein and SARS-CoV S protein, wherein the polypeptide comprises the complementarity determining region 1 (CDR1), CDR2 and CDR3 sequences of any one of SEQ ID NOs: 2, 26, 3, 1, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 27, 28 and 29.

2. The polypeptide of claim 1, wherein the CDR sequences are defined using the Kabat, IMGT or Paratome numbering schemes, or a combination of the Kabat, IMGT and Paratome numbering schemes.

3-8. (canceled)

9. The polypeptide of claim 1, wherein the CDR1, CDR2 and CDR3 sequences respectively comprise: residues 26-33, 51-58 and 07-111 of SEQ ID NO: 2; residues 31-35, 50-66 and 99-111 of SEQ ID NO: 2; or residues 27-35, 47-60 and 98-111 of SEQ ID NO: 2; residues 26-33, 51-58 and 97-117 of SEQ ID NO: 26; residues 31-35, 50-66 and 99-117 of SEQ ID NO: 26; or residues 27-35, 47-61 and 98-117 of SEQ ID NO: 26; residues 26-35, 53-60 and 99-116 of SEQ ID NO: 3; residues 33-37, 52-68 and 101-116 of SEQ ID NO: 3; or residues 26-37, 49-63 and 99-116 of SEQ ID NO: 3; residues 26-33, 51-58 and 100-115 of SEQ ID NO: 1; residues 31-35, 50-66 and 99-115 of SEQ ID NO: 1; or residues 26-35, 44-61 and 97-115 of SEQ ID NO: 1; residues 26-33, 51-58 and 97-104 of SEQ ID NO: 4; residues 31-35, 50-66 and 99-104 of SEQ ID NO: 4; or residues 27-35, 47-60 and 97-105 of SEQ ID NO: 4; residues 26-33, 51-58 and 97-112 of SEQ ID NO: 5; residues 31-35, 50-66 and 99-112 of SEQ ID NO: 5; or residues 27-35, 47-60 and 98-112 of SEQ ID NO: 5; residues 26-33, 51-58 and 97-110 of SEQ ID NO: 6; residues 31-35, 50-66 and 99-110 of SEQ ID NO: 6; or residues 27-35, 47-61 and 98-110 of SEQ ID NO: 6; residues 26-33, 51-58 and 97-116 of SEQ ID NO: 7; residues 31-35, 50-66 and 99-116 of SEQ ID NO: 7; or residues 27-35, 47-64 and 98-116 of SEQ ID NO: 7; residues 26-33, 51-58 and 97-113 of SEQ ID NO: 8; residues 31-35, 50-66 and 99-113 of SEQ ID NO: 8; or residues 27-35, 47-60 and 98-113 of SEQ ID NO: 8; residues 26-34, 52-59 and 98-117 of SEQ ID NO: 9; residues 31-36, 51-67 and 100-117 of SEQ ID NO: 9; or residues 27-36, 48-61 and 99-117 of SEQ ID NO: 9; residues 26-33, 51-58 and 97-116 of SEQ ID NO: 10; residues 31-35, 50-66 and 99-116 of SEQ ID NO: 10; or residues 27-35, 47-60 and 98-116 of SEQ ID NO: 10; residues 26-34, 52-59 and 98-117 of SEQ ID NO: 11; residues 31-36, 51-67 and 100-117 of SEQ ID NO: 11; or residues 27-36, 48-61 and 99-117 of SEQ ID NO: 11; residues 26-33, 51-58 and 97-116 of SEQ ID NO: 12; residues 31-35, 50-66 and 99-116 of SEQ ID NO: 12; or residues 27-33, 45-59 and 97-114 of SEQ ID NO: 12; residues 26-33, 51-57 and 96-116 of SEQ ID NO: 13; residues 31-35, 50-65 and 98-117 of SEQ ID NO: 13; or residues 26-35, 47-60 and 96-117 of SEQ ID NO: 13; residues 26-33, 51-58 and 97-114 of SEQ ID NO: 14; residues 31-35, 50-66 and 99-114 of SEQ ID NO: 14; or residues 27-34, 47-60 and 98-114 of SEQ ID NO: 14; residues 26-33, 51-59 and 98-109 of SEQ ID NO: 15; residues 31-35, 50-67 and 100-109 of SEQ ID NO: 15; or residues 27-33, 45-61 and 98-101 of SEQ ID NO: 15; residues 26-33, 51-57 and 96-112 of SEQ ID NO: 16; residues 31-35, 50-65 and 98-112 of SEQ ID NO: 16; or residues 27-33, 45-58 and 94-107 of SEQ ID NO: 16; residues 26-33, 51-58 and 97-106 of SEQ ID NO: 17; residues 31-35, 50-66 and 99-106 of SEQ ID NO: 17; or residues 27-35, 47-61 and 97-106 of SEQ ID NO: 17; residues 26-33, 51-58 and 97-105 of SEQ ID NO: 18; residues 32-35, 50-66 and 99-105 of SEQ ID NO: 18; or residues 27-35, 47-61 and 97-105 of SEQ ID NO: 18; residues 26-33, 51-58 and 97-104 of SEQ ID NO: 19; residues 31-35, 50-66 and 99-104 of SEQ ID NO: 19; or residues 27-35, 47-61 and 96-104 of SEQ ID NO: 19; residues 26-33, 51-58 and 97-104 of SEQ ID NO: 20; residues 31-35, 50-66 and 99-104 of SEQ ID NO: 20; or residues 27-35, 47-61 and 96-104 of SEQ ID NO: 20; residues 26-33, 51-58 and 97-104 of SEQ ID NO: 21; residues 31-35, 50-66 and 99-104 of SEQ ID NO: 21; or residues 27-35, 47-60 and 98-105 of SEQ ID NO: 21; residues 26-33, 51-58 and 97-104 of SEQ ID NO: 22; residues 31-35, 50-66 and 99-104 of SEQ ID NO: 22; or residues 27-35, 47-60 and 98-105 of SEQ ID NO: 22; residues 26-33, 51-57 and 96-110 of SEQ ID NO: 23; residues 31-35, 51-57 and 98-110 of SEQ ID NO: 23; or residues 27-35, 47-60 and 97-110 of SEQ ID NO: 23; residues 26-33, 51-58 and 97-111 of SEQ ID NO: 24; residues 31-35, 50-66 and 99-111 of SEQ ID NO: 24; or residues 27-35, 47-60 and 98-111 of SEQ ID NO: 24; residues 26-33, 51-58 and 97-109 of SEQ ID NO: 25; residues 31-35, 50-66 and 99-109 of SEQ ID NO: 25; or residues 27-35, 47-60 and 97-109 of SEQ ID NO: 25; residues 26-33, 51-58 and 97-111 of SEQ ID NO: 27; residues 31-35, 50-66 and 99-111 of SEQ ID NO: 27; or residues 27-35, 47-60 and 98-111 of SEQ ID NO: 27; residues 26-32, 51-57 and 96-103 of SEQ ID NO: 28; residues 31-35, 50-65 and 98-103 of SEQ ID NO: 28; or residues 27-35, 47-60 and 96-104 of SEQ ID NO: 28; or residues 26-33, 51-57 and 96-106 of SEQ ID NO: 29; residues 31-35, 50-65 and 98-106 of SEQ ID NO: 29; or residues 27-35, 47-60 and 97-106 of SEQ ID NO: 29.

10. The polypeptide of claim 1, wherein the amino acid sequence of the polypeptide is at least 90% identical to any one of SEQ ID NOs: 1-29, or the amino acid sequence of the polypeptide comprises or consists of any one of SEQ ID NOs: 1-29.

11. (canceled)

12. The polypeptide of claim 1, wherein the polypeptide is a single-domain monoclonal antibody.

13. The polypeptide of claim 12, wherein the single-domain monoclonal antibody is a humanized single-domain monoclonal antibody or a chimeric single-domain monoclonal antibody.

14. A composition comprising at least two different polypeptides of claim 1.

15. The composition of claim 14, wherein the composition comprises: a first polypeptide selected from the polypeptides having the amino acid sequences of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 26, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5; and a second polypeptide selected from the polypeptides having the amino acid sequences of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 26, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5, wherein the first and second polypeptides are different.

16. (canceled)

17. The composition of claim 14, further comprising a pharmaceutically acceptable carrier.

18. The composition of claim 14, formulated for administration by inhalation.

19. A fusion protein comprising the polypeptide of claim 1 and a heterologous protein.

20. The fusion protein of claim 19, wherein the heterologous protein is an Fc protein.

21. (canceled)

22. A chimeric antigen receptor (CAR) comprising the polypeptide of claim 1.

23. An isolated cell expressing the CAR of claim 22.

24. (canceled)

25. An immunoconjugate comprising the polypeptide of claim 1 and an effector molecule.

26. The immunoconjugate of claim 25, wherein the effector molecule is a toxin, a detectable label, or a photon absorber.

27-28. (canceled)

29. An antibody-drug conjugate (ADC) comprising a drug conjugated to the polypeptide of claim 1.

30. A multi-specific antibody comprising the polypeptide of claim 1 and at least one additional monoclonal antibody or antigen-binding fragment thereof.

31. The multi-specific antibody of claim 30, which is a bispecific antibody or a trispecific antibody.

32. (canceled)

33. An antibody-nanoparticle conjugate, comprising a nanoparticle conjugated to the polypeptide of claim 1.

34. (canceled)

35. An isolated nucleic acid molecule encoding the polypeptide of claim 1.

36. The isolated nucleic acid molecule of claim 35, operably linked to a promoter.

37. The isolated nucleic acid molecule of claim 35, comprising any one of SEQ ID NOs: 60-88.

38. A vector comprising the nucleic acid molecule of claim 35.

39. An isolated host cell comprising the vector of claim 38.

40. A composition comprising a pharmaceutically acceptable carrier and the polypeptide of claim 1.

41. A method of detecting a coronavirus in a sample, comprising: contacting the sample with the polypeptide of claim 1; and detecting binding of the polypeptide to the sample, thereby detecting the coronavirus in the sample.

42-43. (canceled)

44. The method of claim 41, further comprising: contacting the polypeptide with a detection antibody, and detecting the binding of the detection antibody to the polypeptide, thereby detecting the coronavirus in the sample or diagnosing the subject as having a coronavirus infection.

45. The method of claim 41, wherein the sample is obtained from a subject suspected of having a coronavirus infection.

46. A method of treating a coronavirus infection in a subject, comprising administering to the subject a therapeutically effective amount of the polypeptide of claim 1, thereby treating the coronavirus infection.

47. The method of claim 46, wherein the polypeptide is administered by inhalation.

48. The method of claim 46, wherein the coronavirus is SARS-CoV-2 or SARS-CoV.

49. The method of wherein claim 46, wherein the subject is a human subject.

50-51. (canceled)

52. A solid support comprising one or more polypeptides of claim 1.

53. (canceled)

54. A method of detecting a coronavirus in a sample, comprising: contacting the sample with the solid support of claim 52 and detecting binding of the coronavirus to the one or more polypeptides attached to the solid support, thereby detecting coronavirus in the sample.

55. (canceled)

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0014] FIGS. 1A-1B: Isolation of camel V.sub.HH single domain antibodies that bind the RBD of the SARS-CoV-2 S protein. (FIG. 1A) Phage panning was carried out using two sets of camel single domain libraries. The camel V.sub.HH single domain phage libraries were constructed from six individual camels, 3 male and 3 female, with ages ranging from 3 months to 20 years. (FIG. 1B) For the first set of camel V.sub.HH phage libraries (from a 12-year old female, a 9-year old female and a 4-year old male), an immunotube was coated with 5 μg/ml SARS-CoV-2 RBD for the first and second round of panning and 5 μg/ml SARS-CoV-2 S trimer for the 3.sup.rd and 4.sup.th rounds of panning. After each of the second, third, and fourth rounds of panning, 192 monoclonal V.sub.HH phage clones were isolated for analysis. For the second set of 3 camel V.sub.HH libraries (from a 20-year old female, a 20-year old male and a 3-month old male), an immunotube was coated with 5 μg/ml SARS-CoV-2 RBD for the first, second, and third rounds of panning, and 5 μg/ml SARS-CoV-2 S trimer for the 4.sup.th round of panning. After the 4.sup.th round, 192 monoclonal phages were isolated. In total, 768 V.sub.HH phage clones were isolated for analysis.

[0015] FIG. 2: Enrichment of phage V.sub.HH single domain antibodies against SARS-CoV-2 RBD and S protein. An ELISA Plate was coated with 1 μg/ml SARS-CoV-2 RBD, SARS-CoV-2 S1, SARS-CoV-2 S trimer, or BSA as negative control. From the first set of 3 camel V.sub.HH phage libraries, signals increased from the 1.sup.st to 2.sup.nd rounds when panned on RBD. On the third round, when S trimer was used for panning, the signal dropped back down, but was enriched in the 4.sup.th round of panning when S trimer was used again. From the second set of 3 camel V.sub.HH phage libraries, enrichment was shown in the 3.sup.rd round of panning using SARS-CoV-2 RBD, and further enriched in the 4.sup.th round when SARS-CoV-2 S trimer was used.

[0016] FIG. 3A: Camel V.sub.HH single domain antibodies against the S protein of SARS-CoV-2 or SARS-CoV. After isolating 768 monoclonal phages, 127 clones with the highest binding signal for the RBD were picked for sequencing and further analysis. Out of the 127 clones, there were 29 unique sequences. Group 1 clone (1B5) binds both SARS-CoV-2 S protein and SARS-CoV 51 Oprotein. Group 2 clones (7A3, 2F7, 1A10, 1A7, 1G11, 1H6, 2D4, 7A5, 7C4, 7E5, 7E7, 8A1, 8A2, 8A4, 8B6, 8E1 and 8G12) bind the RBD and S protein of SARS-CoV-2. Group 3 clones (1D7, 1H8, 2A10, 2A3, 2B3, 2C7, 2C9, 2F5, 3E5, 3E8 and 4C6) bind the RBD but have modest or no binding to the SARS-CoV-2S protein.

[0017] FIG. 3B: Camel V.sub.HH single domain antibodies against the S protein of SARS-CoV-2 and SARS-CoV. Human A431 cells were engineered to express SARS-CoV or SARS-CoV-2 S protein trimer. Binding of 8A2, 1H6, 1B5, 8A4, 7A3 and 2F7 V.sub.HH-hFc antibodies was determined by flow cytometry. Antibody CR3022 was used as a positive control. All nanobodies bound to SARS-CoV-2 S protein. In addition, 1B5-hFc exhibited strong binding, and 7A3-hFc exhibited modest binding, to the S protein of SARS-CoV. 8A2, 2F7, 8A4 and 1H6 did not bind the S protein of SARS-CoV.

[0018] FIGS. 4A-4B: Phylogenetic tree of the isolated SARS-CoV-2 binding V.sub.HHs based on the neighbor joining method (EMBL-EBI Clustal Omega Program) and Types of V.sub.HHs based on the location and number of cysteines. (FIG. 4A) Twenty-nine V.sub.HHs that bind the RBD were sequenced and multiple sequence alignment and phylogenetic analysis were performed using the neighbor-joining method. Some of the anti-SARS-CoV-2 nanobodies (e.g., 1B5 and 2F7) were found at proximal nodes in the phylogenetic tree, whereas some nanobodies (e.g., 7A3) were found at distal nodes, indicating high divergence from their corresponding germline and intermediate counterparts. (FIG. 4B) Type IV V.sub.HHs contain only two canonical cysteines, one before (N-terminal to) CDR1 and the other before CDR3. Type II V.sub.HHs have a total of 4 cysteines, the two canonical cysteines found in Type IV, plus two additional, non-canonical cysteines, one in CDR1 and the other in CDR3. The V.sub.HHs in which the number or location of non-canonical cystines do not fit Type II are grouped as “Others.”

[0019] FIGS. 5A-5B: Protein binding of V.sub.HH-hFc antibodies. (FIG. 5A) A plate was coated with 1 μg/ml SARS-CoV-2 RBD, SARS-CoV-2 S trimer, SARS-CoV S1 or BSA as a control. One μg/ml of each V.sub.HH-hFc antibody was used. 1B5 and 7A3 bound strongly to all SARS-CoV-2 proteins. The rest of the antibodies bound to the RBD and S trimer strongly, but bound weakly to SARS-CoV S1. 7A5 was nonspecific as it also bound the control protein at similar intensity. Overall, the majority of V.sub.HH binders (out of 10 clones) exhibited specific binding to both RBD and S trimer of SARS-CoV-2. (FIG. 5B) A plate was coated with 5 μg/ml B.1.617.2 RBD and 5 μg/ml of each V.sub.HH-hFc antibody was used. 1B5, 7A3, 1A10, 3E8 and 2C7 bound to the B.1.617.2 variant strongly, and 1A7 exhibited slight binding.

[0020] FIG. 6: Epitope mapping of individual anti-SARS-CoV-2 RBD VHHs. Sequence alignment of the RBD region of SARS-CoV-2 (SEQ ID NO: 55), SARS-CoV (SEQ ID NO: 56) and three identified variant strains of SARS-CoV-2 (B.1.1.7 EPI_ISL_601443 (SEQ ID NO: 57), B.1.351 EPI_ISL_700428 (SEQ ID NO: 58), and P.1 EPI_ISL_792680 (SEQ ID NO: 59)). The conserved residues are marked with an asterisk (*), the residues with similar properties between variants are marked with a colon (:) and the residues with marginally similar properties are marked with a period (.). The main residues of the RBD region of both SARS-CoV-2 and SARS-CoV that interact with ACE2 are shaded. Arrows represent predicted positions of contact with the RBD.

[0021] FIGS. 7A-7C: Inhibition effect of V.sub.HH-hFc against the interaction of the RBD and the human ACE2 protein. (FIG. 7A) An ELISA plate was coated with 2 μg/ml ACE2-His. Five μg/ml V.sub.HH-hFc was incubated with varying concentrations of RBD-mFc starting from 1 μg/ml with 1:3 dilutions. The V.sub.HH-hFc and RBD-mFc mixture was then added to the ACE2-His coated plate and binding was detected using a goat anti-mouse Fc HRP conjugate. 1B5 showed the best inhibitory effect along with 7A3 and 2F7. Together, three V.sub.HHs (1B5, 7A3 and 2F7) were identified as the best ACE2 blockers among all V.sub.HHs tested. (FIG. 7B) An ELISA plate was coated with 2 μg/ml ACE2-His. V.sub.HH-hFc (5 μg/ml) was incubated with varying concentrations of RBD-mFc starting from 1 μg/ml with 1:3 dilutions. The V.sub.HH-hFc and RBD-mFc mixture was then added to the ACE2-His coated plate and binding was detected using goat anti-mouse Fc HRP conjugate. 1B5 showed the best inhibitory effect, along with 8A2 and 2F7. (FIG. 7C) An ELISA plate was coated with 2 μg/ml ACE2-His and 0.1 μg/ml RBD-mFc was incubated with varying concentrations of VHH-hFc starting from 50 μg/ml with 1:2 dilutions. The V.sub.HH-hFc and RBD-mFc mixture was then added to the ACE2-His coated plate and detected using goat anti-mouse Fc HRP conjugate. 1B5 (IC50=<0.001) was the most potent ACE2 inhibitor followed by 2F7 (IC50=0.3 μg/m or 3.5 nM) and 7A3 (IC50=0.2 μg/ml or 2.3 nM), 8A4 (IC50=1.1 μg/ml or 13 nM) and 1H6 (IC50=3 μg/ml or 35 nM).

[0022] FIGS. 8A-8J: Neutralizing effect of V.sub.HH-hFc against SARS-CoV-2 pseudovirus. To perform the neutralization assay, 5000 HEK 293T-hACE2 cells were seeded. Ten μl of SARS-CoV-2 spike pseudovirus supernatant per well was used. Nanobody (V.sub.HH)-hFcs 7A3 (FIG. 8A), 1B5 (FIG. 8B), 2F7 (FIG. 8C), 8A4 (FIG. 8D), 1H6 (FIG. 8E), 1A7 (FIG. 8F), 2C7 (FIG. 8G), 7C4 (FIG. 8H), 7A5 (FIG. 8I) and 3E8 (FIG. 8J) were prepared in 12 point 2-fold serial dilutions starting with 50 μg/ml. Nanobodies and virus were mixed for 45 minutes before adding to HEK 293T-hACE2 cells. After incubation for 72 hours, the reading was performed. Neutralizing nanobodies (IC50): 7A3 (6.3 nM; 0.52 μg/ml), 1B5 (6.6 nM; 0.55 μg/ml), 2F7 (14 nM; 1.18 μg/ml), 8A4 (47 nM; 3.95 μg/ml), and 1H6 (90 nM; 7.56 μg/ml).

[0023] FIGS. 9A-9H: Neutralizing effect of V.sub.HH-hFc against SARS-CoV-2 pseudovirus. To perform the neutralization assay, 5000 HEK 293T-hACE2 cells were seeded. Ten μl of SARS-CoV-2 spike pseudovirus supernatant per well was used. (FIGS. 9A-9F) Nanobody (V.sub.HH)-hFcs 7A3, 1B5, 2F7, 8A4, 1H6, 1A7, 2C7, 7C4, 7A5 and 3E8 were prepared in 12 point 2-fold serial dilutions starting with 50 μg/ml. Nanobodies and virus were mixed for 45 minutes before adding to HEK 293T-hACE2 cells. After incubation for 72 hours, the reading was performed. Neutralizing nanobodies (IC50): 7A3 (6.6 nM), 1B5 (7.6 nM), 2F7 (8.6 nM), 8A4 (27.5 nM), 1H6 (111 nM), 1A7 (428nM), 2C7 (5792 nM), 7C4 (4288 nM), 7A5 (3430 nM), and 3E8 (1169 nM). (FIG. 9G) Neutralization effect of individual nanobodies 8A2, 7A3, 1B5, 2F7, 8A4 and 1H6. 8A2 exhibited the greatest neutralization with an IC50 of 5 nM. (FIG. 9H) Neutralization effect of nanobody combinations 7A3+8A2, 7A3+2F7, 1B5+8A2, 1B5+2F7, 2F7+8A2, and 7A3+8A4. The combination of 7A3+8A2 exhibited the greatest neutralization with an IC50 of 1.6 nM.

[0024] FIGS. 10A-10J: Neutralizing effect of V.sub.HH-hFc cocktail combinations against SARS-CoV-2 pseudovirus. To perform the neutralization assay, 5000 HEK 293T-hACE2 cells were seeded. Ten μl of SARS-CoV-2 spike pseudovirus supernatant per well was used. Two nanobody (V.sub.HH)-hFcs were mixed in 12 point 2-fold serial dilutions starting with total 50 μg/ml (each V.sub.HH-hFc is 25 μg/ml). Nanobodies and virus were mixed for 45 minutes before adding to HEK 293T-hACE2 cells. After incubation for 72 hours, the reading was performed. Shown are the combinations of 7A3+2F7 (FIG. 10A), 7A3+8A4 (FIG. 10B), 1B5+2F7 (FIG. 10C), 7A3+1H6: (FIG. 10D), 1B5+1H6 (FIG. 10E), 8A4+2F7 (FIG. 10F), 1B5+8A4 (FIG. 10G), 1H6+2F7 (FIG. 10H), 7A3+1B5 (FIG. 10I), and 8A4+1H6 (FIG. 10J). The nanobody combinations of 7A3+2F7 and 7A3+8A4 were the most potent with IC50 values of about 2 nM. Neutralizing antibody cocktails (IC50): 7A3+2F7 (1.9 nM), 7A3+8A4 (2.2 nM), 1B5+2F7 (3.5 nM), 7A3+1H6: (4.5 nM), 1B5+1H6 (6.0 nM), 8A4+2F7 (12.1 nM), 1B5+8A4 (19.9 nM), 1H6+2F7 (72.2 nM), 7A3+1B5 (82.9 nM), and 8A4+1H6 (104.9 nM).

[0025] FIG. 11: Competition assay of V.sub.HH-hFc on SARS-CoV-2 RBD. SARS-CoV-2 RBD-His was immobilized onto NTA sensor tips. The RBD-coated tips were then dipped into either PBS or 500 nM of a first nanobody. After loading, the sensor tips were incubated in PBS briefly before being dipped into wells containing 500 nM of the competing nanobody, followed by dissociation in PBS. Percent of residual binding was calculated as follows: (response signal from the second ligand in presence of first ligand/esponse signal from the second ligand in absence of first ligand)×100. 7A3 and 1B5 bind to one epitope and 2F7, 8A4, 1H6, 8A2 bind to another epitope. All inhibited ACE2.

[0026] FIG. 12: Affinity binding of V.sub.HH-hFc antibodies. SARS-CoV-2 or SARS-CoV-2 mutant variants were immobilized onto NTA sensor tips. The antigen-coated tips were then dipped into PBS to stabilize the curve and then dipped into 25 nM V.sub.HH-hFc for association then dipped into PBS for dissociation. 1B5 and 7A3 both bind to all variants.

SEQUENCE LISTING

[0027] The nucleic and amino acid sequences listed in the accompanying sequence listing are shown using standard letter abbreviations for nucleotide bases, and three letter code for amino acids, as defined in 37 C.F.R. 1.822. Only one strand of each nucleic acid sequence is shown, but the complementary strand is understood as included by any reference to the displayed strand. The Sequence Listing is submitted as an

[0028] ASCII text file, created on Oct. 25, 2021, 76.6 KB, which is incorporated by reference herein. In the accompanying sequence listing:

[0029] SEQ ID NO: 1 is the amino acid sequence of nanobody NCI-CoV-1B5.

[0030] SEQ ID NO: 2 is the amino acid sequence of nanobody NCI-CoV-7A3.

[0031] SEQ ID NO: 3 is the amino acid sequence of nanobody NCI-CoV-2F7.

[0032] SEQ ID NO: 4 is the amino acid sequence of nanobody NCI-CoV-8A4.

[0033] SEQ ID NO: 5 is the amino acid sequence of nanobody NCI-CoV-1H6.

[0034] SEQ ID NO: 6 is the amino acid sequence of nanobody NCI-CoV-1A10.

[0035] SEQ ID NO: 7 is the amino acid sequence of nanobody NCI-CoV-2C7.

[0036] SEQ ID NO: 8 is the amino acid sequence of nanobody NCI-CoV-2B3.

[0037] SEQ ID NO: 9 is the amino acid sequence of nanobody NCI-CoV-2A3.

[0038] SEQ ID NO: 10 is the amino acid sequence of nanobody NCI-CoV-1G11.

[0039] SEQ ID NO: 11 is the amino acid sequence of nanobody NCI-CoV-2C9.

[0040] SEQ ID NO: 12 is the amino acid sequence of nanobody NCI-CoV-4C6.

[0041] SEQ ID NO: 13 is the amino acid sequence of nanobody NCI-CoV-2D4.

[0042] SEQ ID NO: 14 is the amino acid sequence of nanobody NCI-CoV-2A10.

[0043] SEQ ID NO: 15 is the amino acid sequence of nanobody NCI-CoV-3E5.

[0044] SEQ ID NO: 16 is the amino acid sequence of nanobody NCI-CoV-3E8.

[0045] SEQ ID NO: 17 is the amino acid sequence of nanobody NCI-CoV-1H8.

[0046] SEQ ID NO: 18 is the amino acid sequence of nanobody NCI-CoV-1A7.

[0047] SEQ ID NO: 19 is the amino acid sequence of nanobody NCI-CoV-2F5.

[0048] SEQ ID NO: 20 is the amino acid sequence of nanobody NCI-CoV-1D7.

[0049] SEQ ID NO: 21 is the amino acid sequence of nanobody NCI-CoV-7A5.

[0050] SEQ ID NO: 22 is the amino acid sequence of nanobody NCI-CoV-7C4.

[0051] SEQ ID NO: 23 is the amino acid sequence of nanobody NCI-CoV-7E5.

[0052] SEQ ID NO: 24 is the amino acid sequence of nanobody NCI-CoV-7E7.

[0053] SEQ ID NO: 25 is the amino acid sequence of nanobody NCI-CoV-8A1.

[0054] SEQ ID NO: 26 is the amino acid sequence of nanobody NCI-CoV-8A2.

[0055] SEQ ID NO: 27 is the amino acid sequence of nanobody NCI-CoV-8B6.

[0056] SEQ ID NO: 28 is the amino acid sequence of nanobody NCI-CoV-8E1.

[0057] SEQ ID NO: 29 is the amino acid sequence of nanobody NCI-CoV-8G12.

[0058] SEQ ID NO: 30 is the amino acid sequence of the SARS-CoV-2 spike protein.

[0059] SEQ ID NOs: 31-54 are overlapping peptides of the SARS-CoV-2 spike protein.

[0060] SEQ ID NO: 55 is the amino acid sequence of the SARS-CoV-2 RBD.

[0061] SEQ ID NO: 56 is the amino acid sequence of the SARS-CoV RBD.

[0062] SEQ ID NO: 57 is the amino acid sequence of the SARS-CoV-2 B.1.1.7 RBD.

[0063] SEQ ID NO: 58 is the amino acid sequence of the SARS-CoV-2 B.1.351 RBD.

[0064] SEQ ID NO: 59 is the amino acid sequence of the SARS-CoV-2 P.1 RBD.

[0065] SEQ ID NO: 60 is a nucleic acid sequence encoding nanobody NCI-CoV-7A3.

[0066] SEQ ID NO: 61 is a nucleic acid sequence encoding nanobody NCI-CoV-8A2.

[0067] SEQ ID NO: 62 is a nucleic acid sequence encoding nanobody NCI-CoV-2F7.

[0068] SEQ ID NO: 63 is a nucleic acid sequence encoding nanobody NCI-CoV-1B5.

[0069] SEQ ID NO: 64 is a nucleic acid sequence encoding nanobody NCI-CoV-8A4.

[0070] SEQ ID NO: 65 is a nucleic acid sequence encoding nanobody NCI-CoV-1H6.

[0071] SEQ ID NO: 66 is a nucleic acid sequence encoding nanobody NCI-CoV-1A10.

[0072] SEQ ID NO: 67 is a nucleic acid sequence encoding nanobody NCI-CoV-2C7.

[0073] SEQ ID NO: 68 is a nucleic acid sequence encoding nanobody NCI-CoV-2B3.

[0074] SEQ ID NO: 69 is a nucleic acid sequence encoding nanobody NCI-CoV-2A3.

[0075] SEQ ID NO: 70 is a nucleic acid sequence encoding nanobody NCI-CoV-1G11.

[0076] SEQ ID NO: 71 is a nucleic acid sequence encoding nanobody NCI-CoV-2C9.

[0077] SEQ ID NO: 72 is a nucleic acid sequence encoding nanobody NCI-CoV-4C6.

[0078] SEQ ID NO: 73 is a nucleic acid sequence encoding nanobody NCI-CoV-2D4.

[0079] SEQ ID NO: 74 is a nucleic acid sequence encoding nanobody NCI-CoV-2A10.

[0080] SEQ ID NO: 75 is a nucleic acid sequence encoding nanobody NCI-CoV-3E5.

[0081] SEQ ID NO: 76 is a nucleic acid sequence encoding nanobody NCI-CoV-3E8.

[0082] SEQ ID NO: 77 is a nucleic acid sequence encoding nanobody NCI-CoV-1H8.

[0083] SEQ ID NO: 78 is a nucleic acid sequence encoding nanobody NCI-CoV-1A7.

[0084] SEQ ID NO: 79 is a nucleic acid sequence encoding nanobody NCI-CoV-2F5.

[0085] SEQ ID NO: 80 is a nucleic acid sequence encoding nanobody NCI-CoV-1D7.

[0086] SEQ ID NO: 81 is a nucleic acid sequence encoding nanobody NCI-CoV-7A5.

[0087] SEQ ID NO: 82 is a nucleic acid sequence encoding nanobody NCI-CoV-7C4.

[0088] SEQ ID NO: 83 is a nucleic acid sequence encoding nanobody NCI-CoV-7E5.

[0089] SEQ ID NO: 84 is a nucleic acid sequence encoding nanobody NCI-CoV-7E7.

[0090] SEQ ID NO: 85 is a nucleic acid sequence encoding nanobody NCI-CoV-8A1.

[0091] SEQ ID NO: 86 is a nucleic acid sequence encoding nanobody NCI-CoV-8B6.

[0092] SEQ ID NO: 87 is a nucleic acid sequence encoding nanobody NCI-CoV-8E1.

[0093] SEQ ID NO: 88 is a nucleic acid sequence encoding nanobody NCI-CoV-8G12.

DETAILED DESCRIPTION

I. Abbreviations

[0094] ACE2 angiotensin converting enzyme 2 [0095] ADC antibody-drug conjugate [0096] CAR chimeric antigen receptor [0097] CDR complementarity determining region [0098] CoV coronavirus [0099] COVID-19 coronavirus disease 2019 [0100] ELISA enzyme-linked immunosorbent assay [0101] hFc human Fc [0102] NK natural killer [0103] PET positron emission tomography [0104] RBD receptor binding domain [0105] S spike protein [0106] SARS severe acute respiratory syndrome

II. Terms and Methods

[0107] Unless otherwise noted, technical terms are used according to conventional usage. Definitions of common terms in molecular biology may be found in Benjamin Lewin, Genes X, published by Jones & Bartlett Publishers, 2009; and Meyers et al. (eds.), The Encyclopedia of Cell Biology and Molecular Medicine, published by Wiley-VCH in 16 volumes, 2008; and other similar references.

[0108] As used herein, the singular forms “a,” “an,” and “the,” refer to both the singular as well as plural, unless the context clearly indicates otherwise. For example, the term “an antigen” includes single or plural antigens and can be considered equivalent to the phrase “at least one antigen.” As used herein, the term “comprises” means “includes.” It is further to be understood that any and all base sizes or amino acid sizes, and all molecular weight or molecular mass values, given for nucleic acids or polypeptides are approximate, and are provided for descriptive purposes, unless otherwise indicated. Although many methods and materials similar or equivalent to those described herein can be used, particular suitable methods and materials are described herein. In case of conflict, the present specification, including explanations of terms, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting. To facilitate review of the various embodiments, the following explanations of terms are provided:

[0109] Administration: To provide or give a subject an agent, such as a polypeptide (e.g., single domain monoclonal antibody) provided herein, by any effective route. Exemplary routes of administration include, but are not limited to, oral, injection (such as subcutaneous, intramuscular, intradermal, intraperitoneal, intravenous, and intratumoral), sublingual, rectal, transdermal, intranasal, vaginal and inhalation routes.

[0110] Antibody: A polypeptide ligand comprising at least one variable region that recognizes and binds (such as specifically recognizes and specifically binds) an epitope of an antigen. Mammalian immunoglobulin molecules are composed of a heavy (H) chain and a light (L) chain, each of which has a variable region, termed the variable heavy (V.sub.H) region and the variable light (V.sub.L) region, respectively. Together, the V.sub.H region and the V.sub.L region are responsible for binding the antigen recognized by the antibody. There are five main heavy chain classes (or isotypes) of mammalian immunoglobulin, which determine the functional activity of an antibody molecule: IgM, IgD, IgG, IgA and IgE. Antibody isotypes not found in mammals include IgX, IgY, IgW and IgNAR. IgY is the primary antibody produced by birds and reptiles and is functionally similar to mammalian IgG and IgE. IgW and IgNAR antibodies are produced by cartilaginous fish, while IgX antibodies are found in amphibians.

[0111] Antibody variable regions contain “framework” regions and hypervariable regions, known as “complementarity determining regions” or “CDRs.” The CDRs are primarily responsible for binding to an epitope of an antigen. The framework regions of an antibody serve to position and align the CDRs in three-dimensional space. The amino acid sequence boundaries of a given CDR can be readily determined using any of a number of well-known numbering schemes, including those described by Kabat et al. (Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 1991; the “Kabat” numbering scheme), Chothia et al. (see Chothia and Lesk, J Mol Biol 196:901-917, 1987; Chothia et al., Nature 342:877, 1989; and Al-Lazikani et al., JMB 273,927-948, 1997; the “Chothia” numbering scheme), Kunik et al. (see Kunik et al., PLoS Comput Biol 8:e1002388, 2012; and Kunik et al., Nucleic Acids Res 40(Web Server issue):W521-524, 2012; “Paratome CDRs”) and the ImMunoGeneTics (IMGT) database (see, Lefranc, Nucleic Acids Res 29:207-9, 2001; the “IMGT” numbering scheme). The Kabat, Paratome and IMGT databases are maintained online.

[0112] A “single-domain antibody” refers to an antibody having a single domain (a variable domain) that is capable of specifically binding an antigen, or an epitope of an antigen, in the absence of an additional antibody domain. Single-domain antibodies include, for example, V.sub.H domain antibodies, V.sub.NAR antibodies, camelid V.sub.HH antibodies, and V.sub.L domain antibodies. V.sub.NAR antibodies are produced by cartilaginous fish, such as nurse sharks, wobbegong sharks, spiny dogfish and bamboo sharks. Camelid V.sub.HH antibodies are produced by several species including camel, llama, alpaca, dromedary, and guanaco, which produce heavy chain antibodies that are naturally devoid of light chains. Camel V.sub.HH are comprised of the following regions (N-terminal to C-terminal): FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4. Camel VHH CDR residues can be determined, for example, according to IMGT, Kabat or Paratome. A “monoclonal antibody” is an antibody produced by a single clone of lymphocytes or by a cell into which the coding sequence of a single antibody has been transfected. Monoclonal antibodies are produced by methods known to those of skill in the art. Monoclonal antibodies include humanized monoclonal antibodies.

[0113] A “chimeric antibody” has framework residues from one species, such as human, and CDRs (which generally confer antigen binding) from another species.

[0114] A “humanized” antibody is an immunoglobulin including a human framework region and one or more CDRs from a non-human (for example a mouse, rabbit, rat, shark or synthetic) immunoglobulin. The non-human immunoglobulin providing the CDRs is termed a “donor,” and the human immunoglobulin providing the framework is termed an “acceptor.” In one embodiment, all CDRs are from the donor immunoglobulin in a humanized immunoglobulin. Constant regions need not be present, but if they are, they must be substantially identical to human immunoglobulin constant regions, i.e., at least about 85-90%, such as about 95% or more identical. Hence, all parts of a humanized immunoglobulin, except possibly the

[0115] CDRs, are substantially identical to corresponding parts of natural human immunoglobulin sequences. A humanized antibody binds to the same antigen as the donor antibody that provides the CDRs. Humanized or other monoclonal antibodies can have additional conservative amino acid substitutions which have substantially no effect on antigen binding or other immunoglobulin functions.

[0116] Antibody-drug conjugate (ADC): A molecule that includes an antibody (or antigen-binding fragment of an antibody) conjugated to a drug, such as an anti-viral agent or a cytotoxic agent. ADCs can be used to specifically target a drug to particular cells through specific binding of the antibody to a target antigen expressed on the cell surface. Exemplary drugs for use with ADCs include anti-viral agents (such as remdesivir, galidesivir, arbidol, favipiravir, baricitinib, or lopinavir/ritonavir), anti-microtubule agents (such as maytansinoids, auristatin E and auristatin F) and interstrand crosslinking agents (for example, pyrrolobenzodiazepines; PBDs). In some cases, the ADC is a bi-specific ADC, which is comprised of two monoclonal antibodies or antigen-fragments thereof, each directed to a different antigen or epitope, conjugated to a drug. In one example, the agent attached to the antibody is IRDye® 700 DX (IR700, Li-cor, Lincoln, NE), which can then be used with near infrared light NIR light to kill target cells to which the antibody binds (photoimmunotherapy; see for example U.S. Pat. Nos. 8,524,239 and 10,538,590). For example, amino-reactive IR700 can be covalently conjugated to an antibody using the NHS ester of IR700.

[0117] Binding affinity: Affinity of an antibody for an antigen. In one embodiment, affinity is calculated by a modification of the Scatchard method described by Frankel et al., Mol. Immunol., 16:101-106, 1979. In another embodiment, binding affinity is measured by an antigen/antibody dissociation rate. In another embodiment, a high binding affinity is measured by a competition radioimmunoassay. In another embodiment, binding affinity is measured by ELISA. In some embodiments, binding affinity is measured using the Octet system (Creative Biolabs), which is based on bio-layer interferometry (BLI) technology. In other embodiments, Kd is measured using surface plasmon resonance assays using a BIACORES-2000 or a BIACORES-3000 (BlAcore, Inc., Piscataway, N.J.). In other embodiments, antibody affinity is measured by flow cytometry or by surface plasmon reference. An antibody that “specifically binds” an antigen (such as CoV spike protein) is an antibody that binds the antigen with high affinity and does not significantly bind other unrelated antigens.

[0118] In some examples, a monoclonal antibody (such as an anti-S protein single-domain antibody provided herein) specifically binds to a target (for example, a CoV spike protein, such as a SARS-CoV S protein, SARS-CoV-2 S protein, or to both SARS-CoV-2 S protein and SARS-CoV S protein) with a binding constant that is at least 10.sup.3 M.sup.−1 greater, 10.sup.4 M.sup.−1 greater or 10.sup.5 M.sup.−1 greater than a binding constant for other molecules in a sample or subject. In some examples, an antibody (e.g., monoclonal antibody) has an equilibrium constant (Kd) of 10 nM or less, such as 9 nM or less, 8 nM or less, 7 nM or less, 6 nM or less, 5.7 nM or less, 5.5 nM or less, 5.3 nM or less, 5 nM or less, 4.3 nM or less, 4 nM or less, 3 nM or less, 2 nM or less, 1.5 nM or less, 1.5 nM or less, 1.4 nM or less, 1.3 nM or less, or 1.2 nM or less. For example, a monoclonal antibody binds to a target, such as a CoV S protein (such as an SARS-CoV S protein, SARS-CoV-2 S protein, or to both SARS-CoV-2 S protein and SARS-CoV S protein) with a binding affinity of at least about 0.1×10.sup.−8 M, at least about 0.3×10.sup.−8 M, at least about 0.5×10.sup.−8 M, at least about 0.75×10.sup.−8 M, at least about 1.0×10.sup.−8 M, at least about 1.3×10.sup.−8 M at least about 1.5×10.sup.−8 M, or at least about 2.0×10.sup.−8 M, at least about 2.5×10.sup.−8, at least about 3.0×10.sup.−8, at least about 3.5×10.sup.−8, at least about 4.0×10.sup.−8, at least about 4.5×10.sup.−8, at least about 5.0×10.sup.−8 M, at least about 1×10.sup.−9 M, at least about 1.3×10.sup.−9 M, at least about 1.5×10.sup.−9 M, at least about 2×10.sup.−9 M, at least about 3×10.sup.−9 M, at least about 4×10.sup.−9 M, at least about 4.3×10.sup.−9 M, at least about 5×10.sup.−9 M, at least about 6×10.sup.−9 M, at least about 6.3×10.sup.−9 M, at least about 6.9×10.sup.−9 M, at least about 7×10.sup.−9 M, at least about 8×10.sup.−9 M, at least about 8.1×10.sup.−9 M, or at least about 10×10.sup.−9 M. In certain embodiments, a specific binding agent that binds to its target has a dissociation constant (Kd) of ≤100 nM, ≤10 nM, ≤9 nM, ≤8 nM, ≤7 nM, ≤6.9 nM, ≤6.5 nM, ≤6.3 nM, ≤5 nM, ≤4 nM, ≤4.5 nM, ≤3 nM, ≤2 nM, ≤1.5 nM, ≤1 nM, ≤0.1 nM, ≤0.01 nM, or ≤0.001 nM (e.g., 10.sup.−8 M or less, e.g., from 10.sup.−8 M to 10.sup.−13 M, e.g., from 10.sup.−9 M to 10.sup.−13 M).

[0119] Bispecific antibody: A recombinant protein that includes antigen-binding fragments of two different monoclonal antibodies and is thereby capable of binding two different antigens. Similarly, a multi-specific antibody is a recombinant protein that includes antigen-binding fragments of at least two different monoclonal antibodies, such as two, three or four different monoclonal antibodies.

[0120] Chimeric antigen receptor (CAR): A chimeric molecule that includes an antigen-binding portion (such as single-domain antibody) and a signaling domain, such as a signaling domain from a T cell receptor (for example, CD3ζ). Typically, CARs are comprised of an antigen-binding moiety, a transmembrane domain and an endodomain. The endodomain typically includes a signaling chain having an immunoreceptor tyrosine-based activation motif (ITAM), such as CD3ζ or FcERIγ. In some instances, the endodomain further includes the intracellular portion of at least one additional co-stimulatory domain, such as CD28, 4-1BB (CD137), ICOS, 0X40 (CD134), CD27, MYD88-CD40, KIR2DS2 and/or DAP10. In some examples, the CAR is multispecific (such as bispecific) or bicistronic. A multispecific CAR is a single CAR molecule comprised of at least two antigen-binding domains (such as scFvs and/or single-domain antibodies) that each bind a different antigen or a different epitope on the same antigen (see, for example, US 2018/0230225). For example, a bispecific CAR refers to a single CAR molecule having two antigen-binding domains that each bind a different antigen. A bicistronic CAR refers to two complete CAR molecules, each containing an antigen-binding moiety that binds a different antigen. In some cases, a bicistronic CAR construct expresses two complete CAR molecules that are linked by a cleavage linker T cells or NK cells (or other immune cells, such as macrophages) expressing a bispecific or bicistronic CAR can bind cells that express both of the antigens to which the binding moieties are directed (see, for example, Qin et al., Blood 130:810, 2017; and WO/2018/213337). In some embodiments, the CAR is a two-chained antibody-T cell receptor (AbTCR) as described in Xu et al. (Cell Discovery 4:62, 2018) or a synthetic T cell receptor and antigen receptor (STAR) as described by Liu et al. (Sci Transl Med 13(586):eabb5191, 2021).

[0121] Complementarity determining region (CDR): A region of hypervariable amino acid sequence that defines the binding affinity and specificity of an antibody. The light and heavy chains of a mammalian immunoglobulin each have three CDRs, designated L-CDR1, L-CDR2, L-CDR3 and H-CDR1, H-CDR2, H-CDR3, respectively. A single-domain antibody (such as a camel VHH) contains three CDRs, referred to as CDR1, CDR2 and CDR3.

[0122] Conjugate: In the context of the present disclosure, a “conjugate” is a polypeptide (such as a single-domain antibody) covalently linked to an effector molecule or a second protein (such as a second antibody). The effector molecule can be, for example, a drug, toxin, therapeutic agent, detectable label, protein, nucleic acid, lipid, nanoparticle, photon absorber, carbohydrate or recombinant virus. An antibody conjugate is often referred to as an “immunoconjugate.” When the conjugate comprises an antibody linked to a drug (such as a cytotoxic agent), the conjugate is often referred to as an “antibody-drug conjugate” or “ADC.” Other antibody conjugates include, for example, multi-specific (such as bispecific or trispecific) antibodies and chimeric antigen receptors (CARs).

[0123] Conservative variant: A protein containing conservative amino acid substitutions that do not substantially affect or decrease the affinity of a protein, such as an antibody to an S protein (such as a SARS-CoVS protein, SARS-CoV-2 S protein, or to both SARS-CoV-2 S protein and SARS-CoV S protein). For example, a monoclonal antibody that specifically binds S protein can include at most about 1, at most about 2, at most about 5, and most about 10, or at most about 15 conservative substitutions and specifically bind the S protein. The term “conservative variant” also includes the use of a substituted amino acid in place of an unsubstituted parent amino acid, provided that antibody specifically binds S protein. Non-conservative substitutions are those that reduce an activity or binding to S protein.

[0124] Conservative amino acid substitution tables providing functionally similar amino acids are well known to one of ordinary skill in the art. The following six groups are examples of amino acids that are considered to be conservative substitutions for one another: [0125] 1) Alanine (A), Serine (S), Threonine (T); [0126] 2) Aspartic acid (D), Glutamic acid (E); [0127] 3) Asparagine (N), Glutamine (Q); [0128] 4) Arginine (R), Lysine (K); [0129] 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); and [0130] 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W).

[0131] Contacting: Placement in direct physical association; includes both in solid and liquid form.

[0132] Coronavirus: A large family of positive-sense, single-stranded RNA viruses that can infect humans and non-human animals. Coronaviruses get their name from the crown-like spikes on their surface. The viral envelope is comprised of a lipid bilayer containing the viral membrane (M), envelope (E) and spike (S) proteins. Most coronaviruses cause mild to moderate upper respiratory tract illness, such as the common cold. However, three coronaviruses have emerged that can cause more serious illness and death: severe acute respiratory syndrome coronavirus (SARS-CoV), SARS-CoV-2 (including variants thereof, such as: alpha (B.1.1.7 and Q lineages); beta (B.1.351 and descendent lineages); delta (B.1.617.2 and AY lineages); gamma (P.1 and descendent lineages); epsilon (B.1.427 and B.1.429); eta (B.1.525); iota (B.1.526); kappa (B.1.617.1); 1.617.3; mu (B.1.621, B.1.621.1) and zeta (P.2)), and Middle East respiratory syndrome coronavirus (MERS-CoV). Other coronaviruses that infect humans include human coronavirus HKU1 (HKU1-CoV), human coronavirus OC43 (OC43-CoV), human coronavirus 229E (229E-CoV), human coronavirus NL63 (NL63-CoV).

[0133] COVID-19: The disease caused by the coronavirus SARS-CoV-2.

[0134] Cytotoxic agent: Any drug or compound that kills cells.

[0135] Cytotoxicity: The toxicity of a molecule, such as an immunotoxin, to the cells intended to be targeted, as opposed to the cells of the rest of an organism. In contrast, the term “toxicity” refers to toxicity of an immunotoxin to cells other than those that are the cells intended to be targeted by the targeting moiety of the immunotoxin, and the term “animal toxicity” refers to toxicity of the immunotoxin to an animal by toxicity of the immunotoxin to cells other than those intended to be targeted by the immunotoxin.

[0136] Degenerate variant: A polynucleotide encoding a polypeptide that includes a sequence that is degenerate as a result of the genetic code. There are 20 natural amino acids, most of which are specified by more than one codon. Therefore, all degenerate nucleotide sequences are included as long as the amino acid sequence of the polypeptide is unchanged.

[0137] Detect: To determine if a particular agent is present or absent, and in some examples further includes quantification of the agent if detected. In some examples, the agent detected is a coronavirus, such as SARS-CoV and/or SARS-CoV-2.

[0138] Diagnostic: Identifying the presence or nature of a pathologic condition, such as a coronavirus infection. Diagnostic methods differ in their sensitivity and specificity. The “sensitivity” of a diagnostic assay is the percentage of diseased individuals who test positive (percent of true positives). The “specificity” of a diagnostic assay is one minus the false positive rate, where the false positive rate is defined as the proportion of those without the disease who test positive. While a particular diagnostic method may not provide a definitive diagnosis of a condition, it suffices if the method provides a positive indication that aids in diagnosis. “Prognostic” is the probability of development (such as severity) of a pathologic condition, such as COVID-19.

[0139] Diagnostic imaging: Coupling antibodies and their derivatives with positron emitting radionuclides for positron emission tomography (PET) is a process often referred to as immunoPET. While full length antibodies can make good immunoPET agents, their biological half-life necessitates waiting several days prior to imaging, resulting in an increase in non-target radiation doses. Smaller, single domain antibodies, or nanobodies (such as camel VHH), have biological half-lives amenable to same day imaging.

[0140] Drug: Any compound used to treat, ameliorate or prevent a disease or condition in a subject. In some embodiments herein, the drug is an anti-viral agent, such as an anti-SARS-CoV-2 agent.

[0141] Effector molecule: The portion of a chimeric molecule that is intended to have a desired effect on a cell to which the chimeric molecule is targeted. Effector molecule is also known as an effector moiety (EM), therapeutic agent, diagnostic agent, or similar terms. Therapeutic agents (or drugs) include such compounds as nucleic acids, proteins, peptides, amino acids or derivatives, glycoproteins, radioisotopes, photon absorbers, lipids, carbohydrates, or recombinant viruses. Nucleic acid therapeutic and diagnostic moieties include antisense nucleic acids, derivatized oligonucleotides for covalent cross-linking with single or duplex DNA, and triplex forming oligonucleotides. Alternatively, the molecule linked to a targeting moiety, such as an anti-S protein antibody, may be an encapsulation system, such as a liposome or micelle that contains a therapeutic composition such as a drug, a nucleic acid (such as an antisense nucleic acid), or another therapeutic moiety that can be shielded from direct exposure to the circulatory system. Means of preparing liposomes attached to antibodies are known (see, for example, U.S. Pat. No. 4,957,735; and Connor et al., Pharm Ther 28:341-365, 1985). Diagnostic agents or moieties include radioisotopes and other detectable labels. Detectable labels useful for such purposes include radioactive isotopes such as .sup.35S, .sup.11C, .sup.13N, .sup.15O, .sup.18F, .sup.19F, .sup.99mTc, .sup.131I, .sup.3H, .sup.14C, .sup.15N, .sup.90Y, .sup.99Tc, .sup.111In and .sup.125I, fluorophores, chemiluminescent agents, and enzymes.

[0142] Epitope: An antigenic determinant. These are particular chemical groups or peptide sequences on a molecule that are antigenic (that elicit a specific immune response). An antibody specifically binds a particular antigenic epitope on a polypeptide, such as the CoV S protein.

[0143] Framework region: Amino acid sequences interposed between CDRs. Framework regions of an immunoglobulin molecule include variable light and variable heavy framework regions.

[0144] Fusion protein: A protein comprising at least a portion of two different (heterologous) proteins. In some embodiments, a fusion protein includes a single-domain monoclonal antibody fused to an Fc region.

[0145] Heterologous: Originating from a separate genetic source or species.

[0146] Host cell: Cells in which a vector can be propagated and its DNA expressed. The cell may be prokaryotic or eukaryotic. In some examples, the prokaryotic cell is an E. coli cell. In some examples, the eukaryotic cell is a human cell, such as a human embryonic kidney (HEK) cell. The term also includes any progeny of the subject host cell. It is understood that all progeny may not be identical to the parental cell since there may be mutations that occur during replication. However, such progeny are included when the term “host cell” is used.

[0147] Immobilized: Bound to a surface, such as a solid support. In one embodiment, the solid surface is in the form of a bead, multiwell plate, paper, or nitrocellulose. The surface can include one or more polypeptides (e.g., single-domain monoclonal antibodies) provided herein.

[0148] Immune response: A response of a cell of the immune system, such as a B cell, T cell, or monocyte, to a stimulus. In one embodiment, the response is specific for a particular antigen (an “antigen-specific response”). In one embodiment, an immune response is a T cell response, such as a CD4.sup.+ response or a CD8.sup.+ response. In another embodiment, the response is a B cell response, and results in the production of specific antibodies.

[0149] Immunoconjugate: A covalent linkage of an effector molecule to an antibody (such as a single-domain antibody) or functional fragment thereof. The effector molecule can be, for example, a detectable label, a photon absorber (such as IR700), or a toxin (to form an immunotoxin, such as an immunotoxin comprising Pseudomonas exotoxin or a variant thereof). Specific, non-limiting examples of toxins include, but are not limited to, abrin, ricin, Pseudomonas exotoxin (PE, such as PE35, PE37, PE38, and PE40), diphtheria toxin (DT), botulinum toxin, or modified toxins thereof, or other toxic agents that directly or indirectly inhibit cell growth or kill cells. For example, PE and DT are highly toxic compounds that typically bring about death through liver toxicity. PE and DT, however, can be modified into a form for use as an immunotoxin by removing the native targeting component of the toxin (such as the domain Ia of PE and the B chain of DT) and replacing it with a different targeting moiety, such as an antibody. In one embodiment, an antibody is joined to an effector molecule. In another embodiment, an antibody joined to an effector molecule is further joined to a lipid or other molecule, such as to increase its half-life in the body. The linkage can be either by chemical or recombinant means. In one embodiment, the linkage is chemical, wherein a reaction between the antibody moiety and the effector molecule has produced a covalent bond formed between the two molecules to form one molecule. A peptide linker (short peptide sequence) can optionally be included between the antibody and the effector molecule. Because immunoconjugates were originally prepared from two molecules with separate functionalities, such as an antibody and an effector molecule, they are also sometimes referred to as “chimeric molecules.” The term “chimeric molecule,” as used herein, therefore refers to a targeting moiety, such as a ligand or an antibody, conjugated (coupled) to an effector molecule. The term “conjugated” or “linked” refers to making two polypeptides into one contiguous polypeptide molecule.

[0150] Immunoliposome: A liposome with antigen-binding polypeptides (such as antibodies or antibody fragments) conjugated to its surface. Immunoliposomes can carry cytotoxic agents or other drugs to antibody-targeted cells, such as virus-infected cells.

[0151] Isolated: An “isolated” biological component, such as a nucleic acid, protein (including antibodies) or organelle, has been substantially separated or purified away from other biological components in the environment (such as a cell) in which the component naturally occurs, for example other chromosomal and extra-chromosomal DNA and RNA, proteins and organelles. Nucleic acids and proteins that have been “isolated” include nucleic acids and proteins purified by standard purification methods. The term also embraces nucleic acids and proteins prepared by recombinant expression in a host cell as well as chemically synthesized nucleic acids.

[0152] Label: A detectable compound or composition that is conjugated directly or indirectly to another molecule, such as an antibody or a protein, to facilitate detection of that molecule. Specific, non-limiting examples of labels include fluorescent tags, enzymatic linkages, and radioactive isotopes. In one example, a “labeled antibody” refers to incorporation of another molecule in the antibody. For example, the label is a detectable marker, such as the incorporation of a radiolabeled amino acid or attachment to a polypeptide of biotinyl moieties that can be detected by marked avidin (for example, streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or colorimetric methods). Various methods of labeling polypeptides and glycoproteins are known and may be used. Examples of labels for polypeptides include, but are not limited to, the following: radioisotopes or radionucleotides (such as .sup.35S, .sup.11C, .sup.13N, .sup.15O, .sup.18F , .sup.19F, .sup.99mTc, .sup.131I, .sup.3H, .sup.14C, .sup.15N, .sup.90Y, .sup.99Tc, .sup.111In and .sup.125I), fluorescent labels (such as fluorescein isothiocyanate (FITC), rhodamine, lanthanide phosphors), enzymatic labels (such as horseradish peroxidase, beta-galactosidase, luciferase, alkaline phosphatase), chemiluminescent markers, biotinyl groups, predetermined polypeptide epitopes recognized by a secondary reporter (such as a leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags), or magnetic agents, such as gadolinium chelates. In some embodiments, labels are attached by spacer arms of various lengths to reduce potential steric hindrance.

[0153] Linker: In some cases, a linker is a peptide within an antibody binding fragment (such as an Fv fragment) which serves to indirectly bond the variable heavy chain to the variable light chain. “Linker” can also refer to a peptide serving to link a targeting moiety, such as an antibody, to an effector molecule, such as a cytotoxin or a detectable label. The terms “conjugating,” “joining,” “bonding” or “linking” refer to making two polypeptides into one contiguous polypeptide molecule, or to covalently attaching a radionuclide or other molecule to a polypeptide, such as an antibody. The linkage can be either by chemical or recombinant means. “Chemical means” refers to a reaction between the antibody moiety and the effector molecule such that there is a covalent bond formed between the two molecules to form one molecule.

[0154] Neutralizing antibody: An antibody that reduces the infectious titer of an infectious agent by binding to a specific antigen on the infectious agent, such as a virus (e.g., a coronavirus). In some embodiments, an antibody that is specific for a coronavirus spike protein neutralizes the infectious titer of SARS-CoV and/or SARS-CoV-2. For example, an antibody that neutralizes SARS-CoV-2 may interfere with the virus by binding it directly and limiting entry into cells. Alternately, a neutralizing antibody may interfere with one or more post-attachment interactions of the pathogen with a receptor, for example, by interfering with viral entry using the receptor. In some embodiments, an antibody that specifically binds to SARS-CoV-2 and neutralizes SARS-CoV-2 inhibits infection of cells, for example, by at least 50%, by at least 60%, by at least 70%, by at least 80% or by at least 90%, compared to a control antibody. Similarly, an antibody can neutralize SARS-CoV by specifically binding to a SARS-CoV antigen (such as the spike protein) in such a way as to inhibit a biological function associated with SARS-CoV that inhibits infection.

[0155] Operably linked: A first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence. For instance, a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence. Generally, operably linked DNA sequences are contiguous and, where necessary to join two protein-coding regions, in the same reading frame.

[0156] Pharmaceutically acceptable carriers: The pharmaceutically acceptable carriers of use are conventional. Remington: The Science and Practice of Pharmacy, 22.sup.nd ed., London, UK: Pharmaceutical Press, 2013,), describes compositions and formulations suitable for pharmaceutical delivery of the polypeptides, antibodies and other compositions disclosed herein. In general, the nature of the carrier will depend on the particular mode of administration being employed. For instance, parenteral formulations usually comprise injectable fluids that include pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle. For solid compositions (such as powder, pill, tablet, or capsule forms), conventional non-toxic solid carriers can include, for example, pharmaceutical grades of mannitol, lactose, starch, or magnesium stearate. In addition to biologically neutral carriers, pharmaceutical compositions to be administered can contain minor amounts of non-toxic auxiliary substances, such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate.

[0157] Photoimmunotherapy: A targeted therapy that utilizes an antigen-specific antibody-photoabsorber conjugate that can be activated by near-infrared light to kill targeted cells. The photon absorber is typically based on phthalocyanine dye, such as a near infrared (NIR) phthalocyanine dye (for example, IRDye® 700DX, also know known as IR700). The antibody (for example, a S-specific antibody) binds to the appropriate cell surface antigen (e.g., S protein) and the photo-activatable dye induces lethal damage to cell membranes after NIR-light exposure. NIR-light exposure (e.g., 690 nm) induces highly selective, necrotic cell death within minutes without damage to adjoining cells (see, for example, U.S. Application No. 2018/0236076). Thus, such methods can be used to kill cells infected with a coronavirus (e.g., SARS-CoV and/or SARS-CoV-2), such as using the antibodies provided herein.

[0158] Polypeptide: A polymer in which the monomers are amino acid residues joined together through amide bonds. When the amino acids are alpha-amino acids, either the L-optical isomer or the D-optical isomer can be used. The terms “polypeptide” and “protein” are used herein interchangeably and include standard amino acid sequences as well as modified sequences, such as glycoproteins. The term “polypeptide” is specifically intended to cover naturally occurring proteins, as well as proteins that are recombinantly or synthetically produced. In the context of the present disclosure, a “polypeptide” is any protein or polypeptide (natural, recombinant or synthetic) that is capable of specific binding to a target antigen, such as a coronavirus S protein or portion thereof. Thus, the polypeptides disclosed herein include at least one, such as one, two or three, CDR sequences that mediate specific binding to the target antigen. In some embodiments, the polypeptide is a single-domain monoclonal antibody, such as a camel single-domain monoclonal antibody isolated from a phage display library, or a modified form thereof (such as a humanized or chimeric single-domain monoclonal antibody). In other embodiments, the polypeptide comprises fibronectin (adectin), albumin, protein A (affibody), a peptide aptamer, an affimer, an affitin, an anticalin, or another antibody mimetic (see, e.g., Yu et al., Annu Rev Anal Chem 10(1): 293-320, 2017; Ta and McNaughton, Future Med Chem 9(12): 1301-1304, 2017; Koutsoumpeli et al., Anal Chem 89(5): 3051-3058, 2017), or a similar protein in which one or more CDR sequences have been incorporated to confer specific binding to the target antigen.

[0159] Preventing, treating or ameliorating a disease: “Preventing” a disease refers to inhibiting the full development of a disease. “Treating” refers to a therapeutic intervention that ameliorates a sign or symptom of a disease or pathological condition after it has begun to develop, such as a reduction in viral load. “Ameliorating” refers to the reduction in the number or severity of signs or symptoms of a disease, such as a coronavirus infection.

[0160] Purified: The term purified does not require absolute purity; rather, it is intended as a relative term. Thus, for example, a purified peptide preparation is one in which the peptide or protein is more enriched than the peptide or protein is in its natural environment within a cell. In one embodiment, a preparation is purified such that the protein or peptide represents at least 50% of the total peptide or protein content of the preparation. Substantial purification denotes purification from other proteins or cellular components. A substantially purified protein is at least 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.9%, or 99.99% pure. Thus, in one specific, non-limiting example, a substantially purified protein is at least 90% free of other proteins or cellular components.

[0161] Recombinant: A recombinant nucleic acid or protein is one that has a sequence that is not naturally occurring or has a sequence that is made by an artificial combination of two otherwise separated segments of sequence. This artificial combination is often accomplished by chemical synthesis or by the artificial manipulation of isolated segments of nucleic acids, for example, by genetic engineering techniques.

[0162] Sample (or biological sample): A biological specimen containing genomic DNA, RNA (including mRNA), protein, or combinations thereof, which can be obtained from a subject or the environment. Examples include, but are not limited to, sputum, saliva, mucus, nasal wash, peripheral blood, tissue, cells, urine, tissue biopsy, fine needle aspirate, surgical specimen, feces, cerebral spinal fluid (CSF), bronchoalveolar lavage (BAL) fluid, nasopharyngeal samples, oropharyngeal samples, and autopsy material. Environmental samples include those obtained from an environmental media, such as water, air, soil, dust, wood, as well as samples obtained by wiping or swabbing a surface.

[0163] SARS-CoV-2: A coronavirus of the genus betacoronavirus that first emerged in humans in 2019. This virus is also known as Wuhan coronavirus, 2019-nCoV, or 2019 novel coronavirus. Symptoms of SARS-CoV-2 infection include fever, chills, dry cough, shortness of breath, fatigue, muscle/body aches, headache, new loss of taste or smell, sore throat, nausea or vomiting, and diarrhea. Patients with severe disease can develop pneumonia, multi-organ failure, and death. The time from exposure to onset of symptoms is approximately 2 to 14 days. The SARS-CoV-2 virion includes a viral envelope with large spike glycoproteins. The SARS-CoV-2 genome, like most coronaviruses, has a common genome organization with the replicase gene included in the 5′-two thirds of the genome, and structural genes included in the 3′-third of the genome. The SARS-CoV-2 genome encodes the canonical set of structural protein genes in the order 5′-spike (S)-envelope (E)-membrane (M) and nucleocapsid (N)-3′. The term “SARS-CoV-2” includes variants thereof, such as, but not limited to, alpha (B.1.1.7 and Q lineages); beta (B.1.351 and descendent lineages); delta (B.1.617.2 and AY lineages); gamma (P.1 and descendent lineages); epsilon (B.1.427 and B.1.429); eta (B.1.525); iota (B.1.526); kappa (B.1.617.1); 1.617.3; mu (B.1.621, B.1.621.1) and zeta (P.2)).

[0164] SARS Spike (S) protein: A class I fusion glycoprotein initially synthesized as a precursor protein of approximately 1256 amino acids for SARS-CoV, and 1273 amino acids for SARS-CoV-2. Individual precursor S polypeptides form a homotrimer and undergo glycosylation within the Golgi apparatus as well as processing to remove the signal peptide, and cleavage by a cellular protease between approximately position 679/680 for SARS-CoV, and 685/686 for SARS-CoV-2, to generate separate S1 and S2 polypeptide chains, which remain associated as S1/S2 protomers within the homotrimer, thereby forming a trimer of heterodimers. The S1 subunit is distal to the virus membrane and contains the receptor-binding domain (RBD) that is believed to mediate virus attachment to its host receptor. The S2 subunit is believed to contain the fusion protein machinery, such as the fusion peptide. S2 also includes two heptad-repeat sequences (HR1 and HR2) and a central helix typical of fusion glycoproteins, a transmembrane domain, and a cytosolic tail domain. An exemplary SARS-CoV-2 spike protein sequence is set forth herein as SEQ ID NO: 30 (GenBank Accession No. QHD43416.1 the sequence of which is incorporated by reference herein in its entirety).

[0165] Sequence identity: The similarity between amino acid or nucleic acid sequences is expressed in terms of the similarity between the sequences, otherwise referred to as sequence identity. Sequence identity is frequently measured in terms of percentage identity (or similarity or homology); the higher the percentage, the more similar the two sequences are. Homologs or variants of a polypeptide or nucleic acid molecule will possess a relatively high degree of sequence identity when aligned using standard methods.

[0166] Methods of alignment of sequences for comparison are well known in the art. Various programs and alignment algorithms are described in: Smith and Waterman, Adv. Appl. Math. 2:482, 1981; Needleman and Wunsch, J. Mol. Biol. 48:443, 1970; Pearson and Lipman, Proc. Natl. Acad. Sci. U.S.A. 85:2444, 1988; Higgins and Sharp, Gene 73:237, 1988; Higgins and Sharp, CABIOS 5:151, 1989; Corpet et al., Nucleic Acids Research 16:10881, 1988; and Pearson and Lipman, Proc. Natl. Acad. Sci. U.S.A. 85:2444, 1988. Altschul et al., Nature Genet. 6:119, 1994, presents a detailed consideration of sequence alignment methods and homology calculations.

[0167] The NCBI Basic Local Alignment Search Tool (BLAST) (Altschul et al., J. Mol. Biol. 215:403, 1990) is available from several sources, including the National Center for Biotechnology Information (NCBI, Bethesda, MD) and on the internet, for use in connection with the sequence analysis programs blastp, blastn, blastx, tblastn and tblastx. A description of how to determine sequence identity using this program is available on the NCBI website on the internet.

[0168] Homologs and variants of an antibody that specifically binds an S protein are typically characterized by possession of at least about 75%, for example at least about 80%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity counted over the full-length alignment with the amino acid sequence of the antibody using the NCBI Blast 2.0, gapped blastp set to default parameters. For comparisons of amino acid sequences of greater than about 30 amino acids, the Blast 2 sequences function is employed using the default BLOSUM62 matrix set to default parameters, (gap existence cost of 11, and a per residue gap cost of 1). When aligning short peptides (fewer than around 30 amino acids), the alignment should be performed using the Blast 2 sequences function, employing the PAM30 matrix set to default parameters (open gap 9, extension gap 1 penalties). Proteins with even greater similarity to the reference sequences will show increasing percentage identities when assessed by this method, such as at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% sequence identity. When less than the entire sequence is being compared for sequence identity, homologs and variants will typically possess at least 80% sequence identity over short windows of 10-20 amino acids, and may possess sequence identities of at least 85% or at least 90% or 95% depending on their similarity to the reference sequence. Methods for determining sequence identity over such short windows are available at the NCBI website on the internet.

[0169] Homologs and variants of a coding sequence for an antibody that specifically binds an S protein are typically characterized by possession of at least about 75%, for example at least about 80%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity counted over the full-length alignment with the coding sequence of the antibody using the NCBI Blast 2.0, gapped blastn set to default parameters.

[0170] One of skill in the art will appreciate that these sequence identity ranges are provided for guidance only; it is entirely possible that strongly significant homologs could be obtained that fall outside of the ranges provided.

[0171] Small molecule: A molecule, typically with a molecular weight less than about 1000 Daltons, or in some embodiments, less than about 500 Daltons, wherein the molecule is capable of modulating, to some measurable extent, an activity of a target molecule.

[0172] Subject: Living multi-cellular vertebrate organisms, a category that includes both human and non-human animals (such as veterinary subjects or wild animals), for example birds, pigs, mice, rats, rabbits, sheep, horses, cows, dogs, cats, ferrets, deer, otters, bank voles, racoon dogs, tree shrews, fruit bats, hamsters, mink, and non-human primates (e.g., rhesus macaques, cynomolgus macaques, baboons, grivets and common marmosets).

[0173] Synthetic: Produced by artificial means in a laboratory, for example a synthetic nucleic acid or protein (for example, an antibody) can be chemically synthesized in a laboratory.

[0174] Therapeutically effective amount: The amount of agent, such as a polypeptide (e.g., a single-domain monoclonal antibody), that is sufficient to prevent, treat (including prophylaxis), reduce and/or ameliorate the symptoms and/or underlying causes of a disease or disorder, for example to prevent, inhibit, and/or treat a coronavirus infection, such as a SARS-CoV and/or SARS-CoV-2 infection. In some embodiments, a therapeutically effective amount is sufficient to reduce or eliminate a symptom of a disease, such as a SARS-CoV and/or SARS-CoV-2 infection. For instance, this can be the amount necessary to inhibit or prevent viral replication or to measurably alter outward symptoms of the viral infection, such as fever, cough, or difficulty breathing. In general, this amount will be sufficient to measurably inhibit virus replication or infectivity.

[0175] In one example, a desired response is to inhibit or reduce or prevent a SARS-CoV and/or SARS-CoV-2 infection. The SARS-CoV and/or SARS-CoV-2 infection does not need to be completely eliminated or reduced or prevented for the method to be effective. For example, administration of a therapeutically effective amount of the agent can decrease the SARS-CoV and/or SARS-CoV-2 infection (for example, as measured by infection of cells, or by number or percentage of subjects infected by SARS-CoV and/or SARS-CoV-2) by a desired amount, for example by at least 10%, at least 20%, at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or even at least 100% (elimination or prevention of detectable coronavirus infection, as compared to a suitable control).

[0176] A therapeutically effective amount of an agent can be administered in a single dose, or in several doses, for example daily, during a course of treatment. However, the therapeutically effective amount can depend on the subject being treated, the severity and type of the condition being treated, and the manner of administration. A unit dosage form of the agent can be packaged in a therapeutic amount, or in multiples of the therapeutic amount, for example, in a vial (e.g., with a pierceable lid) or syringe having sterile components.

[0177] Toxin: A molecule that is cytotoxic for a cell. Toxins include abrin, ricin, Pseudomonas exotoxin (PE), diphtheria toxin (DT), botulinum toxin, saporin, restrictocin or gelonin, or modified toxins thereof. For example, PE and DT are highly toxic compounds that typically bring about death through liver toxicity. PE and DT, however, can be modified into a form for use as an immunotoxin by removing the native targeting component of the toxin (such as domain Ia of PE or the B chain of DT) and replacing it with a different targeting moiety, such as an antibody.

[0178] Vector: A nucleic acid molecule as introduced into a host cell, thereby producing a transformed host cell. A vector may include nucleic acid sequences that permit it to replicate in a host cell, such as an origin of replication. A vector may also include one or more selectable marker genes and other genetic elements known in the art. In some embodiments, the vector is a virus vector, such as a lentivirus vector, an adenovirus vector, or adeno-associated virus vector (AAV).

III. Polypeptides Specific for Coronavirus Spike Protein

[0179] Described herein is the construction of six large camel V.sub.HH single domain phage libraries from six naive camels (Camelus dromedaries), 3 male and 3 female, aged 3 months to 20 years (see FIGS. 1A-1B). The average size of the phage libraries was 5×10.sup.10 with a total diversity of over 10.sup.11. Both the SARS-CoV-2 RBD and the S homotrimer protein were used as the targeting antigens to conduct phage panning for isolating neutralizing nanobodies. Among 768 phage clones sequenced after phage panning, 29 were identified as strong binders to SARS-CoV-2 RBD. Among them, NCI-CoV-1B5 (1B5), NCI-CoV-7A3 (7A3), and NCI-CoV-2F7 (2F7) were the most potent at inhibiting binding of the S protein RBD to ACE2. Additionally, 1B5 was identified as a cross-reactive nanobody that binds the spike proteins from both SARS-CoV-2 and SARS-CoV. Nanobody 7A3 recognizes a region of the spike protein (P499-0525) that contains key residues, including N501, for direct interaction with ACE2. Several of the disclosed nanobodies are capable of binding multiple variants of SARS-CoV-2, including 1B5, 7A3 and 8A2. Neutralization assays using SARS-CoV-2 spike-expressing pseudovirus demonstrated that 7A3, 1B5, 8A2, 2F7, 8A4, and 1H6 V.sub.HH nanobodies protect host cells from virus infection with an IC.sub.50 value of 5-7nM for 7A3, 8A2 and 1B5. The neutralizing nanobodies can be used for preventing and treating COVID-19. The antibodies disclosed herein can also be used for in vitro and in vivo diagnostics for the detection of a coronavirus infection.

[0180] The amino acid sequences of 29 S protein-specific single-domain antibodies are provided below. CDR sequences determined using the methods of IMGT, Kabat and Paratome are indicated by bold, italics, and underline, respectively. The tables list the amino acid positions of CDR1, CDR2 and CDR3 of each antibody, as determined using either Kabat, IMGT or Paratome. One of skill in the art could readily determine the CDR boundaries using an alternative numbering scheme, such as the Chothia numbering scheme.

TABLE-US-00001 NCI-CoV-1B5 (SEQ ID NO: 1) DVQLVESGGGSVQAGGSLRLSCTGSRYTYSTYCMGWFRQAPGKEEEAVAIINSGGGEPYYGDSVKG RFTISQDRAKNTVYLQMDGLQPDDTAIYYCVAADSHNSRCYLGRSYVNYWGQGTQVTVSS 1B5 IMGT Kabat Paratome CDR1 26-33 31-35 26-35 CDR2 51-58 50-66 44-61 CDR3 100-115  99-115  97-115 NCI-CoV-7A3 (SEQ ID NO: 2) QVQLVESGGGSVQPGGSLRLSCVVSGYTSSSRYMGWFRQVPGKGLEWVSGIKRDGTNTYYADSVK GRFTISQDNAKNTVYLQMNSLKPEDTAMYYCAAGSWYNQWGYSMDYWGKGTQVTVSS 7A3 IMGT Kabat Paratome CDR1 26-33 31-35 27-35 CDR2 51-58 50-66 47-60 CDR3  97-111  99-111  98-111 NCI-CoV-2F7 (SEQ ID NO: 3) QVKLEESGGGSVQSGGSLRLSCTVSRDTNTNINRCMGWFRQAPGKGLETVATINRDGTNTYYTDAV KGRFTISQDNVKNTVYLQMNNLTPEDTGTYICNAMGRGSGSRCDNWDPNYWGQGTQVTVSS 2F7 IMGT Kabat Paratome CDR1 26-35 33-37 26-37 CDR2 53-60 52-68 49-63 CDR3  99-116 101-116  99-116 NCI-CoV-8A4 (SEQ ID NO: 4) EVQLVESGGGLVQPGESLRLSCEASGFTFSSVYMSWVRQAPGKGLEWISTIHPAGGSTYYADSMKDR FTISRDNAKNTLYLQMNSLKSEDTALYYCIIEALSGYRGPGTQVTVSS 8A4 IMGT Kabat Paratome CDR1 26-33 31-35 27-35 CDR2 51-58 50-66 47-60 CDR3  97-104  99-104  97-105 NCI-CoV-1H6 (SEQ ID NO: 5) AVQLVDSGGGSVQAGGSLNLSCVASGTTLRNGCMAWFRQVPGKEREVVAIIIRATSYTDYADSVKG RFTISQDNAKNTVYLQMKSLTPEDTATYYCAATLYRVNCAKREFDKWGQGTQVTVSS 1H6 IMGT Kabat Paratome CDR1 26-33 31-35 27-35 CDR2 51-58 50-66 47-60 CDR3  97-112  99-112  98-112 NCI-CoV-1A10 (SEQ ID NO: 6) AVQLVDSGGGSVQAGGSLRLSCAASGFTGSNYCLGWFRQAPGKEREGVAVIERDTGGTTYPNSLEG RFTIAQDNAKNMVYLHMRNLQPEDTGTYTCAAARNGDSFGGFTFWGQGTQVTVSS 1A10 IMGT Kabat Paratome CDR1 26-33 31-35 27-35 CDR2 51-58 50-66 47-61 CDR3  97-110  99-110  98-110 NCI-CoV-2C7 (SEQ ID NO: 7) EVQLVESGGGSVQTGGSLRLSCVVSGYDYSNYCVAWFRQAEGKNREGLAGINTHGAYTNYNTPAK GRFTISQDLTKNTFTLQMNSLTPEDTAIYYCAAYPEYCPRESSSSWNNSAVWGQGTQVTVSS 2C7 IMGT Kabat Paratome CDR1 26-33 31-35 27-35 CDR2 51-58 50-66 47-64 CDR3  97-116  99-116  98-116 NCI-CoV-2B3 (SEQ ID NO: 8) DVQLVESGGSSVQAGGSLRLSCAASGDSYRGNLMGWFRQAPGKAREGVAVIFTPNHINTYAADSVK GRFTISQDKAKNMVYLQMNSLKPEDTAMYYCATGWEGGLILSARAYRYWGQGTQVTVSS 2B3 IMGT Kabat Paratome CDR1 26-33 31-35 27-35 CDR2 51-58 50-66 47-60 CDR3  97-113  99-113  98-113 NCI-CoV-2A3 (SEQ ID NO: 9) QVQLVESGGDSVQAGESLRLSCQASGDTSGDYVYVAWFRQAPGKEREGVAVVHISNSGGTYVADSV KERFIISQDNTKNTVYLTMNSLKPEDTAIYYCAAKTRLIPHENVESAASYSYWGQGTQVTVSS 2A3 IMGT Kabat Paratome CDR1 26-34 31-36 27-36 CDR2 52-59 51-67 48-61 CDR3  98-117 100-117  99-117 NCI-CoV-1G11 (SEQ ID NO: 10) QVQLVESGGGSVQAGGSLRLSCVASGDTNTRQYMGWFRQAPGKEREGVAVVHISDSGGTYYADSVK ERFIIAQDNAKNTVYLTMNSLKVEDTAIYYCAAKTLEKPHESVESAASYDYWGQGTQVTVSS 1G11 IMGT Kabat Paratome CDR1 26-33 31-35 27-35 CDR2 51-58 50-66 47-60 CDR3  97-116  99-116  98-116 NCI-CoV-2C9 (SEQ ID NO: 11) QVQLVESGGDSVQAGESLRLSCQASGDTSSLYYYVAWFRQAPGKEREGVAVVHSDSGGTYYADSVK ERFIIAQDNAKNTVYLTMNSLKVEDTAIYYCAAKTLEKPHESVESAASYDYWGQGTQVTVSS 2C9 IMGT Kabat Paratome CDR1 26-34 31-36 27-36 CDR2 52-59 51-67 48-61 CDR3  98-117 100-117  99-117 NCI-CoV-4C6 (SEQ ID NO: 12) QVQLVESGGGSVQAGESLRLSCAVSGISSSTHYMAWFRQLPGKEREGLANIYTPAKVSLYANDVKGR FTISQDVTKNTVYLQMNSLKPEDTAMYYCAARRNAVCNAGSPLDFEFSYWGQGTQVTVSS 4C6 IMGT Kabat Paratome CDR1 26-33 31-35 27-33 CDR2 51-58 50-66 45-59 CDR3  97-116  99-116  97-114 NCI-CoV-2D4 (SEQ ID NO: 13) EVQLVESGGGSVQAGGSLRLSCAASAVTSNTNYVGWLRQVPGKEREGVAGIYYDGGVYYDESVKG RFTISRDNAQNTVFLQMNSLKPEDTAMYYCGAGRGYRYQYGSAWYKPGQYHYWGQGTQVTVSS 2D4 IMGT Kabat Paratome CDR1 26-33 31-35 26-35 CDR2 51-57 50-65 47-60 CDR3  96-116  98-117  96-117 NCI-CoV-2A10 (SEQ ID NO: 14) QVQLVESGGGSVQAGGSLRLSCAMSGLRVSNRCMGWFRQAPGKEREGVATICIGDGSTAYADSVK GRFTISQDNAKTTVFLEMNSLKPEDTAMYSCARAVRATAATLDPGNFFYWGQGTQVTVSS 2A10 IMGT Kabat Paratome CDR1 26-33 31-35 27-34 CDR2 51-58 50-66 47-60 CDR3  97-114  99-114  98-114 NCI-CoV-3E5 (SEQ ID NO: 15) EVQLVESGGGLVQPGGSLRLSCAASGFAFSSTRMHWVRQAPGVGLEWVSFIDRTDGGIISYADSVR GRFTISRDNAKNTVYLQMDRLNAEDTAVYYCLKEGPYLDYWDAWGQGTQVTVSS 3E5 IMGT Kabat Paratome CDR1 26-33 31-35 27-33 CDR2 51-59 50-67 45-61 CDR3  98-109 100-109  98-101 NCI-CoV-3E8 (SEQ ID NO: 16) QVQLVESGGGLVQAGGSLRLSCATSGFTFSGGYMAWVRQVPGKGLEWVANSIYDGSTYYSDAVKG RFTVSQDNAENTVYLEMNSLEPEDTAMYYCAAGWNGGPWSRTNAYIYWGQGTQVTVSS 3E8 IMGT Kabat Paratome CDR1 26-33 31-35 27-33 CDR2 51-57 50-65 45-58 CDR3  96-112  98-112  94-107 NCI-CoV-1H8 (SEQ ID NO: 17) QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMTWVRQAPGKGLEWVAAIYTADGSTYLDDSVK GRFTISQDNAKKTLYLQMTSLKVEDTAKYTCATGVGGSFSNWGRGTQVTVSS 1H8 IMGT Kabat Paratome CDR1 26-33 31-35 27-35 CDR2 51-58 50-66 47-61 CDR3  97-106  99-106  97-106 NCI-CoV-1A7 (SEQ ID NO: 18) QVQLVESGGGLVQPGGSLRLSCVASGFTFSSVDMSWVRQDPRKGLEWVSGINSGGGSTSYADSVKG QFTISRDNAKNTLYLEMNNLKPEDTAVYYCATGLAASGVWGQGTQVTVSS 1A7 IMGT Kabat Paratome CDR1 26-33 32-35 27-35 CDR2 51-58 50-66 47-61 CDR3  97-105  99-105  97-105 NCI-CoV-2F5 (SEQ ID NO: 19) QVQLVESGGGLVQPGGSLKLSCTASGFTFSSYNMSWVRQAPGKGLKWVSMIRSDGSNTYYLDSVK GRFTISRDNAKNTVYLQMNSLEPGDTAVYYCVAGRHATYWGQGTQVTVSS 2F5 IMGT Kabat Paratome CDR1 26-33 31-35 27-35 CDR2 51-58 50-66 47-61 CDR3  97-104  99-104  96-104 NCI-CoV-1D7 (SEQ ID NO: 20) QVKLEESGGGLVQPGGSLKLSCTASGFTFSSYNMSWVRQAPGKGLKWVSMIRSDGSNTYYLDSVKG RFTISRDNAKNTVYLQMNSLEPGDTAVYYCVAGRHATYWGQGTQVTVSS 1D7 IMGT Kabat Paratome CDR1 26-33 31-35 27-35 CDR2 51-58 50-66 47-61 CDR3  97-104  99-104  96-104 NCI-CoV-7A5 (SEQ ID NO: 21) AVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMSWVRQAPGKGLEWVSTINSRGSSTYYADSVKG RFTISRDNAKNTLYLQMSSLKSEDTALYYCAIGRLYSVKGQGTQVTVSS 7A5 IMGT Kabat Paratome CDR1 26-33 31-35 27-35 CDR2 51-58 50-66 47-60 CDR3  97-104  99-104  98-105 NCI-CoV-7C4 (SEQ ID NO: 22) EVQLVESGGGLVQPGGSLRLSCTASGFTFSSYDMSWVRQAPGKGLEWVSGINSGGNKIYYADSVKG RFTISRDNAKNTLYLQMSSLKSEDTALYYCAIGRLYSVKGQGTQVTVSS 7C4 IMGT Kabat Paratome CDR1 26-33 31-35 27-35 CDR2 51-58 50-66 47-60 CDR3  97-104  99-104  98-105 NCI-CoV-7E5 (SEQ ID NO: 23) AVQLVESGGGSVQAGGSLRLSCAASGYTYSSNYMGWFRQAPGKELEWVSGIYSDGRTYYGDSVKG RFTISRDNAKNTVYLQMNSLKPEDTAMYYCAAGSWYNQWGYSMDYWGKGTQVTVSS 7E5 IMGT Kabat Paratome CDR1 26-33 31-35 27-35 CDR2 51-57 51-57 47-60 CDR3  96-110  98-110  97-110 NCI-CoV-7E7 (SEQ ID NO: 24) AVQLVDSGGGSVQSGGSLRLSCVASGYTYSIYNMGWFRQAPGKGLEWVSGINSDGSNTYYADSVK GRFTISRDNAKNTLYLQMNSLKSEDTALYYCATLPICSGGYCPPGYWGQGTQVTVSS 7E7 IMGT Kabat Paratome CDR1 26-33 31-35 27-35 CDR2 51-58 50-66 47-60 CDR3  97-111  99-111  98-111 NCI-CoV-8A1 (SEQ ID NO: 25 QVQLVESGGGSVQAGGSLRLSCAASGFTFSSYFMTWVRQAPGKGLEWVSTINSDGSNTYYADSVKG RFTISRDNAKNTLYLQMNSLKPEDTAMYYCNFRRMIGTSNLNYWGQGTQVTVSS 8A1 IMGT Kabat Paratome CDR1 26-33 31-35 27-35 CDR2 51-58 50-66 47-60 CDR3  97-109  99-109  97-109 NCI-CoV-8A2 (SEQ ID NO: 26) AVQLVDSGGGSVQAGGSLRLSCAASGYTYSICTMGWYRQAPGEGLEWVSGINADGSNTHYTDSVK GRFTISRDNAKKTLYLQMNSLKPEDTAIYYCAAHGTYDKYAPCGGFAGTYTYWGQGTQVTVSS 8A2 IMGT Kabat Paratome CDR1 26-33 31-35 27-35 CDR2 51-58 50-66 47-61 CDR3  97-117  99-117  98-117 NCI-CoV-8B6 (SEQ ID NO: 27) AVQLVDSGGGSVQAGGSLRLSCAASGITYSTNCMGWFRQAPGKGLEWVSGINSDGRNTYYADSVK GRFTISQDNAKNTVYLQMNSLKPEDTAMYYCAAGSWYNQWGYSMDYWGQGTQVTVSS 8B6 IMGT Kabat Paratome CDR1 26-33 31-35 27-35 CDR2 51-58 50-66 47-60 CDR3  97-111  99-111  98-111 NCI-CoV-8E1 (SEQ ID NO: 28) EVQLVESGGGSVQAGGSLRLSCAASGFTFSSYYMSWVRQAPGKGLEWVSGIYSDGSTYYGDSVKGR FTISRDNAKNTLYLQMNSLKSEDTALYYCAIGTGTTRQGQGTQVTVSS 8E1 IMGT Kabat Paratome CDR1 26-32 31-35 27-35 CDR2 51-57 50-65 47-60 CDR3  96-103  98-103  96-104 NCI-CoV-8G12 (SEQ ID NO: 29) AVQLVDSGGGSVQAGGSLRLSCAASGYTSNMNHMGWFRQAPGKGLEWVSGIYSDGSTYYGDSVK GRFTISRDNAKNMLYLQMNNLKPEDTAVYYCSGDGGGIGYNYWGQGTQVTVSS 8G12 IMGT Kabat Paratome CDR1 26-33 31-35 27-35 CDR2 51-57 50-65 47-60 CDR3  96-106  98-106  97-106

[0181] Provided herein are polypeptides that bind (for example, specifically bind) coronavirus S protein, such as SARS-CoV-2 and/or SARS-CoV S protein. In some embodiments, the polypeptide is a monoclonal antibody, for example a single-domain antibody, such as a V.sub.HH single-domain antibody. Also provided are compositions that include one or more of such antibodies, for example a composition that includes a pharmaceutically acceptable carrier.

[0182] In some embodiments, the polypeptide (for example, single-domain monoclonal antibody) includes at least a portion of the amino acid sequence set forth herein as any one of SEQ ID NOs: 1-29, such as one or more (such as all three) CDR sequences from any one of antibodies 7A3, 1B5, 2F7, 8A4, 1H6, 1A10, 2C7, 2B3, 2A3, 1G11, 2C9, 4C6, 2D4, 2A10, 3E5, 3E8, 1H8, 1A7, 2F5, 1D7, 7A5, 7C4, 7E5, 7E7, 8A1, 8A2, 8B6, 8E1 or 8G12 (SEQ ID NOs: 1-29, respectively), as determined by any numbering scheme, such as IMGT, Kabat, Paratome or Chothia, or any combination thereof. In some examples, the polypeptide includes the CDR1, CDR2 and CDR3 sequences of any one of SEQ ID NOs: 1-29. In particular examples, the CDR sequences are determined using the Kabat, IMGT or Paratome numbering schemes, or a combination of the Kabat, IMGT and Paratome numbering schemes.

[0183] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-58 and 100-115 of SEQ ID NO: 1; residues 31-35, 50-66 and 99-115 of SEQ ID NO: 1; or residues 26-35, 44-61 and 97-115 of SEQ ID NO: 1. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 1. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 1.

[0184] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-58 and 97-111 of SEQ ID NO: 2; residues 31-35, 50-66 and 99-111 of SEQ ID NO: 2; or residues 27-35, 47-60 and 98-111 of SEQ ID NO: 2. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 2. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 2.

[0185] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-35, 53-60 and 99-116 of SEQ ID NO: 3; residues 33-37, 52-68 and 101-116 of SEQ ID NO: 3; or residues 26-37, 49-63 and 99-116 of SEQ ID NO: 3. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 3. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 3.

[0186] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-58 and 97-104 of SEQ ID NO: 4; residues 31-35, 50-66 and 99-104 of SEQ ID NO: 4; or residues 27-35, 47-60 and 97-105 of SEQ ID NO: 4. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 4. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 4.

[0187] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-58 and 97-112 of SEQ ID NO: 5; residues 31-35, 50-66 and 99-112 of SEQ ID NO: 5; or residues 27-35, 47-60 and 98-112 of SEQ ID NO: 5. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 5. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 5.

[0188] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-58 and 97-110 of SEQ ID NO: 6; residues 31-35, 50-66 and 99-110 of SEQ ID NO: 6; or residues 27-35, 47-61 and 98-110 of SEQ ID NO: 6. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 6. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 6.

[0189] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-58 and 97-116 of SEQ ID NO: 7; residues 31-35, 50-66 and 99-116 of SEQ ID NO: 7; or residues 27-35, 47-64 and 98-116 of SEQ ID NO: 7. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 7. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 7.

[0190] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-58 and 97-113 of SEQ ID NO: 8; residues 31-35, 50-66 and 99-113 of SEQ ID NO: 8; or residues 27-35, 47-60 and 98-113 of SEQ ID NO: 8. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 8. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 8.

[0191] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-34, 52-59 and 98-117 of SEQ ID NO: 9; residues 31-36, 51-67 and 100-117 of SEQ ID NO: 9; or residues 27-36, 48-61 and 99-117 of SEQ ID NO: 9. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 9. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 9.

[0192] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-58 and 97-116 of SEQ ID NO: 10; residues 31-35, 50-66 and 99-116 of SEQ ID NO: 10; or residues 27-35, 47-60 and 98-116 of SEQ ID NO: 10. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 10. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 10.

[0193] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-34, 52-59 and 98-117 of SEQ ID NO: 11; residues 31-36, 51-67 and 100-117 of SEQ ID NO: 11; or residues 27-36, 48-61 and 99-117 of SEQ ID NO: 11. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 11. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 11.

[0194] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-58 and 97-116 of SEQ ID NO: 12; residues 31-35, 50-66 and 99-116 of SEQ ID NO: 12; or residues 27-33, 45-59 and 97-114 of SEQ ID NO: 12. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 12. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 12.

[0195] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-57 and 96-116 of SEQ ID NO: 13; residues 31-35, 50-65 and 98-117 of SEQ ID NO: 13; or residues 26-35, 47-60 and 96-117 of SEQ ID NO: 13. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 13. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 13.

[0196] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-58 and 97-114 of SEQ ID NO: 14; residues 31-35, 50-66 and 99-114 of SEQ ID NO: 14; or residues 27-34, 47-60 and 98-114 of SEQ ID NO: 14. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 14. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 14.

[0197] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-59 and 98-109 of SEQ ID NO: 15; residues 31-35, 50-67 and 100-109 of SEQ ID NO: 15; or residues 27-33, 45-61 and 98-101 of SEQ ID NO: 15. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 15. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 15.

[0198] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-57 and 96-112 of SEQ ID NO: 16; residues 31-35, 50-65 and 98-112 of SEQ ID NO: 16; or residues 27-33, 45-58 and 94-107 of SEQ ID NO: 16. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 16. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 16.

[0199] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-58 and 97-106 of SEQ ID NO: 17; residues 31-35, 50-66 and 99-106 of SEQ ID NO: 17; or residues 27-35, 47-61 and 97-106 of SEQ ID NO: 17. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 17. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 17.

[0200] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-58 and 97-105 of SEQ ID NO: 18; residues 32-35, 50-66 and 99-105 of SEQ ID NO: 18; or residues 27-35, 47-61 and 97-105 of SEQ ID NO: 18. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 18. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 18.

[0201] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-58 and 97-104 of SEQ ID NO: 19; residues 31-35, 50-66 and 99-104 of SEQ ID NO: 19; or residues 27-35, 47-61 and 96-104 of SEQ ID NO: 19. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 19. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 19.

[0202] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-58 and 97-104 of SEQ ID NO: 20; residues 31-35, 50-66 and 99-104 of SEQ ID NO: 20; or residues 27-35, 47-61 and 96-104 of SEQ ID NO: 20. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 20. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 20.

[0203] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-58 and 97-104 of SEQ ID NO: 21; residues 31-35, 50-66 and 99-104 of SEQ ID NO: 21; or residues 27-35, 47-60 and 98-105 of SEQ ID NO: 21. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 21. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 21.

[0204] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-58 and 97-104 of SEQ ID NO: 22; residues 31-35, 50-66 and 99-104 of SEQ ID NO: 22; or residues 27-35, 47-60 and 98-105 of SEQ ID NO: 22. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 22. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 22.

[0205] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-57 and 96-110 of SEQ ID NO: 23; residues 31-35, 51-57 and 98-110 of SEQ ID NO: 23; or residues 27-35, 47-60 and 97-110 of SEQ ID NO: 23. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 23. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 23.

[0206] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-58 and 97-111 of SEQ ID NO: 24; residues 31-35, 50-66 and 99-111 of SEQ ID NO: 24; or residues 27-35, 47-60 and 98-111 of SEQ ID NO: 24. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 24. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 24.

[0207] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-58 and 97-109 of SEQ ID NO: 25; residues 31-35, 50-66 and 99-109 of SEQ ID NO: 25; or residues 27-35, 47-60 and 97-109 of SEQ ID NO: 25. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 25. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 25.

[0208] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-58 and 97-117 of SEQ ID NO: 26; residues 31-35, 50-66 and 99-117 of SEQ ID NO: 26; or residues 27-35, 47-61 and 98-117 of SEQ ID NO: 26. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 26. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 26.

[0209] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-58 and 97-111 of SEQ ID NO: 27; residues 31-35, 50-66 and 99-111 of SEQ ID NO: 27; or residues 27-35, 47-60 and 98-111 of SEQ ID NO: 27. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 27. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 27.

[0210] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-32, 51-57 and 96-103 of SEQ ID NO: 28; residues 31-35, 50-65 and 98-103 of SEQ ID NO: 28; or residues 27-35, 47-60 and 96-104 of SEQ ID NO: 28. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 28. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 28.

[0211] In some embodiments, the CDR1, CDR2 and CDR3 sequences respectively include residues 26-33, 51-57 and 96-106 of SEQ ID NO: 29; residues 31-35, 50-65 and 98-106 of SEQ ID NO: 29; or residues 27-35, 47-60 and 97-106 of SEQ ID NO: 29. In some examples, the amino acid sequence of the polypeptide is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 29. In specific examples, the amino acid sequence of the polypeptide includes or consists of SEQ ID NO: 29.

[0212] In some embodiments, the polypeptide is a single-domain monoclonal antibody. In some examples, the single-domain monoclonal antibody is a camel V.sub.HH single-domain antibody. In some examples, the single-domain monoclonal antibody is a humanized single-domain monoclonal antibody or a chimeric single-domain monoclonal antibody. In other examples, the polypeptide is a recombinant fibronectin or albumin.

[0213] Further provided herein are polypeptide (for example, antibody) compositions that include at least two, at least three, at least four or at least five different polypeptides specific for the S protein. The polypeptides can each bind a separate epitope of the S protein or can bind overlapping epitopes. In some embodiments, the polypeptide composition includes at least one polypeptide having the CDR sequences of SEQ ID NO: 1 (NCI-CoV-1B5), SEQ ID NO: 2 (NCI-CoV-7A3), SEQ ID NO: 3 (NCI-CoV-2F7), SEQ ID NO: 4 (NCI-CoV-8A4), SEQ ID NO: 5 (NCI-CoV-1H6), or SEQ ID NO: 6 (NCI-CoV-8A2). In some examples, the polypeptide composition includes a first antibody selected from the antibodies having the amino acid sequences of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 26; and a second antibody selected from the antibodies having the amino acid sequences of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 26, wherein the first and second antibodies are different. In several examples, the first antibody comprises the CDR sequence of SEQ ID NO: 2 and the second antibody comprises the CDR sequences of SEQ ID NO: 26; the first antibody comprises the CDR sequences of SEQ ID NO: 2 and the second antibody comprises the CDR sequences of SEQ ID NO: 3; the first antibody comprises the CDR sequence of SEQ ID NO: 3 and the second antibody comprises the CDR sequences of SEQ ID NO: 26; the first antibody comprises the CDR sequence of SEQ ID NO: 1 and the second antibody comprises the CDR sequences of SEQ ID NO: 26; the first antibody comprises the CDR sequence of SEQ ID NO: 1 and the second antibody comprises the CDR sequences of SEQ ID NO: 2; the first antibody comprises the CDR sequence of SEQ ID NO: 2 and the second antibody comprises the CDR sequences of SEQ ID NO: 4; the first antibody comprises the CDR sequences of SEQ ID NO: 1; and the second antibody comprises the CDR sequences of SEQ ID NO: 3; or the first antibody comprises the CDR sequences of SEQ ID NO: 2 and the second antibody comprises the CDR sequences of SEQ ID NO: 5. In specific non-limiting examples, the first antibody comprises the amino acid sequence of SEQ ID NO: 2 and the second antibody comprises the amino acid sequence SEQ ID NO: 26; the first antibody comprises the amino acid sequence of SEQ ID NO: 2 and the second antibody comprises the amino acid sequence SEQ ID NO: 3; the first antibody comprises the amino acid sequence of SEQ ID NO: 3 and the second antibody comprises the amino acid sequence SEQ ID NO: 26; the first antibody comprises the amino acid sequence of SEQ ID NO: 1 and the second antibody comprises the amino acid sequence SEQ ID NO: 26; the first antibody comprises the amino acid sequence of SEQ ID NO: 1 and the second antibody comprises the amino acid sequence SEQ ID NO: 2; the first antibody comprises the amino acid sequence of SEQ ID NO: 2 and the second antibody comprises the amino acid sequence SEQ ID NO: 4; the first antibody comprises the amino acid sequence of SEQ ID NO: 1 and the second antibody comprises the amino acid sequence SEQ ID NO: 3; or the first antibody comprises the amino acid sequence of SEQ ID NO: 2 and the second antibody comprises the amino acid sequence SEQ ID NO: 5.

[0214] In some examples, the polypeptide (for example, antibody) composition further includes a third antibody selected from the antibodies having the amino acid sequences of any one of SEQ ID NOs: 1-29, wherein the first, second and third antibodies are different.

[0215] In some examples, the polypeptide compositions further include a pharmaceutically acceptable carrier, such as water or saline. In some examples, the polypeptide composition is formulated for administration by inhalation. In other examples, the polypeptide is formulated for oral administration. In specific examples, the composition for oral administration includes bacteria or yeast engineered to express a disclosed polypeptide (such as a single-domain monoclonal antibody).

[0216] In some examples, the polypeptide composition is lyophilized

[0217] Also provided are fusion proteins that include an S protein-specific polypeptide (for example, antibody) disclosed herein and a heterologous protein. In some embodiments, the heterologous protein is an Fc protein or a leucine zipper. In some examples, the Fc protein is a human Fc protein. In some embodiments, provided is a disclosed single-domain monoclonal antibody in an IgG, IgA or IgM format.

[0218] Also provided herein are chimeric antigen receptors (CARs) that include a polypeptide (such as a single-domain monoclonal antibody) disclosed herein. In some embodiments, the CAR further includes a hinge region, a transmembrane domain, a costimulatory signaling moiety, a signaling domain, or any combination thereof. In specific non-limiting examples, the hinge region comprises a CD8α hinge region, the transmembrane domain comprises a CD8α transmembrane domain, the costimulatory signaling moiety comprises a 4-1BB signaling moiety and/or the signaling domain comprises a CD3ζ signaling domain.

[0219] Also provided herein are S protein-specific polypeptides (for example, antibodies) modified to enable their use with a universal CAR system. In some embodiments, the S protein-specific polypeptide is fused to one component of a specific binding pair. In some examples, the antibody is fused to a leucine zipper or biotin.

[0220] Further provided are cells expressing an S protein-specific CAR. In some examples, the cell is a T lymphocyte, such as a CTL, a natural killer (NK) cell, a macrophage or an induced pluripotent stem cell. In some examples, the T cells, NK cells are allogeneic cells, such as allogeneic cells obtained from a healthy donor. In specific non-limiting examples, the T cells are genetically modified to express the CAR and optionally to disrupt expression of the endogenous TCR. CARs and CAR-expressing cells are further described in section IV.

[0221] Also provided herein are immunoconjugates that include a polypeptide (for example, single-domain antibody) disclosed herein and an effector molecule. In some embodiments, the effector molecule is a toxin, such as, but not limited to, Pseudomonas exotoxin or a variant thereof, such as PE38. In other embodiments, the effector molecule is a detectable label, such as, but not limited to, a fluorophore, an enzyme or a radioisotope. In other embodiments, the effector molecule is a photon absorber, such as IR700. Immunoconjugates comprising a photon absorber can be used for photoimmunotherapy or in vivo diagnostic imaging. Immunoconjugates are further described in section V.

[0222] Further provided herein are antibody-drug conjugates (ADCs) that include a drug conjugated to a polypeptide (for example, single-domain antibody) disclosed herein. In some embodiments, the drug is a small molecule, for example an anti-viral agent, anti-microtubule agent, an anti-mitotic agent and/or a cytotoxic agent. In some examples, the anti-viral agent is remdesivir, galidesivir, arbidol, favipiravir, baricitinib, or lopinavir/ritonavir. ADCs are further described in section VI.

[0223] Also provided herein are multi-specific antibodies that include a polypeptide (for example, single-domain antibody) disclosed herein and at least one additional monoclonal antibody or antigen-binding fragment thereof. In some embodiments, the multi-specific antibody is a bispecific antibody. In other embodiments, the multi-specific antibody is a trispecific antibody. Multi-specific antibodies are further described in section VII.

[0224] Further provided herein are antibody-nanoparticle conjugates that include a nanoparticle conjugated to a polypeptide (for example, single-domain antibody) disclosed herein. In some embodiments, the nanoparticle comprises a polymeric nanoparticle, nanosphere, nanocapsule, liposome, dendrimer, polymeric micelle, or niosome. In some embodiments, the nanoparticle includes a cytotoxic agent or an anti-viral agent. In some examples, the anti-viral agent is remdesivir, galidesivir, arbidol, favipiravir, baricitinib, molnupiravir, or lopinavir/ritonavir. Antibody-nanoparticle conjugates are further described in section VIII.

[0225] Further provided herein are nucleic acid molecules that encode a polypeptide, an antibody, fusion protein, single-domain monoclonal antibody in an IgG, IgA or IgM format, CAR, immunoconjugate, or multiple-specific antibody disclosed herein. In some embodiments, the nucleic acid molecule is operably linked to a promoter. In some examples, the nucleic acid molecule is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to any one of SEQ ID NOs: 60-88. In some examples, the nucleic acid molecule comprises or consists of any one of SEQ ID NOs: 60-88. Vectors that include the disclosed nucleic acid molecules are also provided. In some examples, the vector is an expression vector. In other examples, the vector is a viral vector. Isolated cells that include a nucleic acid molecule are vector disclosed herein are further provided. In some examples, the isolated cell is a prokaryotic cell, such as an E. coli cell. In other examples, the isolated cell is a mammalian cell, such as a human cell. Nucleic acid molecules are further described in section IX.

[0226] Compositions that include a pharmaceutically acceptable carrier and a polypeptide (for example, single-domain monoclonal antibody), fusion protein (such as an Fc fusion, or nanobody in an IgG, IgA or IgM format), CAR, isolated cell (such as a CAR expressing cell, for example a CAR T cell, a CAR NK cell, a CAR iPSC, or a CAR macrophage), immunoconjugate, ADC, multi-specific antibody, antibody-nanoparticle conjugate, isolated nucleic acid molecule or vector disclosed herein are further provided by the present disclosure. Compositions are further described in section X.

[0227] Also provided are methods of detecting a coronavirus, or a coronavirus S protein, in a sample, such as one obtained from a subject or the environment. In some embodiments, the method includes contacting the sample with a polypeptide (for example, antibody) disclosed herein and detecting binding of the polypeptide to the sample. Further provided are methods of detecting coronavirus in the environment.

[0228] Further provided are methods of diagnosing a subject as having a coronavirus infection. In some embodiments, the method includes contacting a sample obtained from the subject with a polypeptide disclosed herein and detecting binding of the polypeptide to the sample, thereby diagnosing the subject as having a coronavirus infection. In some examples of these methods, the polypeptide is directly labeled. In other examples, the method includes contacting the polypeptide with a detection antibody, and detecting the binding of the detection antibody to the polypeptide, thereby detecting the coronavirus in the sample or diagnosing the subject as having a coronavirus infection. In some examples, the sample is obtained from a subject suspected of having a coronavirus infection. In specific examples, the coronavirus is SARS-CoV-2 or SARS-CoV. In some embodiments, the subject is a human subject. In other embodiments, the subject is a non-human animal subject, such as a non-human primate, cat, dog, bank vole, ferret, fruit bat, hamster, mink, otter, pig, rabbit, racoon dog, tree shrew or deer.

[0229] Also provided herein are solid supports that include one or more of the S protein-specific antibodies disclosed herein. In some embodiments, the solid support comprises a bead, microchip, multiwell plate, or nitrocellulose having attached thereto one or more of the disclosed antibodies. Further provided is a method of detecting a coronavirus in a sample that includes contacting the sample with the solid support having attached thereto one or more of the disclosed antibodies and detecting binding of the coronavirus to the one or more antibodies attached to the solid support, thereby detecting coronavirus in the sample. In some embodiments, the sample is an environmental sample or a biological sample obtained from a subject. In some examples, the environmental sample is a water, air, or soil sample, or a sample from a swabbed surface. Diagnostic and detection methods are further described in section XII. In some embodiments, the subject is a human subject. In other embodiments, the subject is a non-human animal subject, such as a non-human primate, cat, dog, bank vole, ferret, fruit bat, hamster, mink, otter, pig, rabbit, racoon dog, tree shrew or deer.

[0230] Further provided are methods of treating a coronavirus infection in a subject. In some embodiments, the method includes administering to the subject a therapeutically effective amount of a polypeptide (for example, single-domain monoclonal antibody), fusion protein, CAR, isolated cell (such as a CAR expressing cell, for example a CAR T cell, a CAR NK cell, a CAR iPSC, or a CAR macrophage), immunoconjugate, ADC, multi-specific antibody, antibody-nanoparticle conjugate, isolated nucleic acid molecule or vector disclosed herein, thereby treating the coronavirus infection. In some embodiments, administration is by injection, such as intravenous. In some embodiments, administration is by inhalation, such as with an inhaler or nebulizer. In specific examples, the coronavirus is SARS-CoV-2 or SARS-CoV. In some embodiments, the subject is a human subject. In other embodiments, the subject is a non-human animal subject, such as a non-human primate, cat, dog, bank vole, ferret, fruit bat, hamster, mink, otter, pig, rabbit, racoon dog, tree shrew or deer. Therapeutic methods are further described in section XI.

IV. Chimeric Antigen Receptors (CARs)

[0231] The disclosed nanobodies can also be used to produce CARs and/or immune cells (such as T cells, natural killer (NK) cells, or macrophages) or induced pluripotent stem cells (iPSCs) engineered to express CARs. In some embodiments, CARs include a binding moiety, an extracellular hinge and spacer element, a transmembrane region and an endodomain that performs signaling functions (Cartellieri et al., J Biomed Biotechnol 2010:956304, 2010; Dai et al., J Natl Cancer Inst 108(7):djv439, 2016). In some instances, the binding moiety is an antigen binding fragment of a monoclonal antibody, such as a scFv, or a single-domain antibody (such as a camel VHH or shark VNAR). The spacer/hinge region typically includes sequences from IgG subclasses, such as IgG1, IgG4, IgD, CD28 or CD8 domains. The transmembrane domain can be derived from a variety of different T cell proteins, such as CD3ζ, CD4, CD8, CD28 or inducible T cell co-stimulator (ICOS). Several different endodomains can be used to generate CARs. For example, the endodomain can consist of a signaling chain having an ITAM, such as CD3ζ or FcϵRIγ. In some instances, the endodomain further includes the intracellular portion of at least one additional co-stimulatory domain, such as CD28, 4-1BB (CD137, TNFRSF9), OX-40 (CD134), ICOS, CD27, MYD88-CD40, killer cell immunoglobulin-like receptor 2DS2 (KIR2DS2) and/or DAP10.

[0232] In some embodiments, the CAR is a two-chained antibody-T cell receptor (AbTCR), which includes the transmembrane and intracellular domains of the γ and δ chains of the TCR (see, e.g., Xu et al., Cell Discovery 4:62, 2018), wherein each of the y and 8 chains is fused to an antigen-binding domain, such as a spike protein-specific single-domain antibody disclosed herein. When expressed in T cells, the AbTCR engages endogenous CD3 complexes to induce T cell activation (Xu et al., Cell Discovery 4:62, 2018). In some examples, the AbTCR includes two of the same single-domain antibodies disclosed herein (bivalent) or two different single-domain antibodies disclosed herein (bispecific).

[0233] In some embodiments, the CAR is a synthetic T cell receptor and antigen receptor (STAR), which is a double-chain chimeric receptor that includes an antigen-binding domain (such a spike protein-specific monoclonal antibody) and the constant regions of the TCR that engage endogenous CD3 complexes (Liu et al., Sci Transl Med 13(586):eabb5191, 2021). In some examples, the STAR CAR includes two of the same single-domain antibodies disclosed herein (bivalent) or two different single-domain antibodies disclosed herein (bispecific).

[0234] Immune cells (e.g., T cells, NK cells or macrophages) or iPSCs expressing CARs can be used to target a specific cell type, such as a coronavirus-infected cell. Thus, the nanobodies disclosed herein can be used to engineer immune cells or iPSCs that express a CAR containing the S protein-specific monoclonal antibody, thereby targeting the engineered immune cells or iPSCs to cells infected with coronavirus (such as SARS-CoV-2 or SARS-CoV) and thereby expressing S protein.

[0235] Multispecific (such as bispecific) or bicistronic CARs are also contemplated by the present disclosure. In some embodiments, the multispecific or bispecific CAR includes a nanobody specific for SARS-CoV-2 spike protein and a monoclonal antibody specific for a different antigen or a different epitope of the spike protein. Similarly, a bicistronic CAR includes two CAR molecules expressed from the same construct where one CAR molecule is an S protein-targeted CAR and the second CAR targets a second antigen or epitope. See, for example, Qin et al., Blood 130:810, 2017; and WO/2018/213337.

[0236] Accordingly, provided herein are CARs that include an S protein-specific antibody, such as any one of the nanobodies disclosed herein. Also provided are isolated nucleic acid molecules and vectors encoding the CARs (including bispecific and bicistronic CARs), and host cells, such as immune cells (e.g., T cells, NK cells, macrophages) or iPSCs expressing the CARs, bispecific CAR or bicistronic CARs. Immune cells or iPSCs expressing CARs comprised of an S protein-specific monoclonal antibody can be used for the treatment of a coronavirus infection (such as a SARS-CoV-2 or SARS-CoV infection). In some embodiments herein, the CAR is a bispecific CAR. In other embodiments herein, the CAR is a bicistronic CAR.

[0237] In some embodiments, the CAR includes a signal peptide sequence, for example, N-terminal to the antigen binding domain. The signal peptide sequence can be any suitable signal peptide sequence, such as a signal sequence from granulocyte-macrophage colony-stimulating factor receptor (GMCSFR), immunoglobulin light chain kappa, or IL-2. While the signal peptide sequence may facilitate expression of the CAR on the surface of the cell, the presence of the signal peptide sequence in an expressed CAR is not necessary in order for the CAR to function. Upon expression of the CAR on the cell surface, the signal peptide sequence may be cleaved off of the CAR. Accordingly, in some embodiments, the CAR lacks a signal peptide sequence.

[0238] In some embodiments, the CARs disclosed herein are expressed from a construct (such as from a lentivirus or other viral vector) that also expresses a truncated version of human EGFR (huEGFRt). The CAR and huEGFRt are separated by a self-cleaving peptide sequence (such as T2A) such that upon expression in a transduced cell, the CAR is cleaved from huEGFRt (see, e.g., WO 2019/094482, which herein incorporated by reference).

[0239] The human epidermal growth factor receptor is comprised of four extracellular domains, a transmembrane domain and three intracellular domains. The EGFR domains are found in the following N-terminal to C-terminal order: Domain I—Domain II—Domain III—Domain IV—transmembrane (TM) domain—juxtamembrane domain—tyrosine kinase domain—C-terminal tail. Domain I and Domain III are leucine-rich domains that participate in ligand binding. Domain II and Domain IV are cysteine-rich domains and do not make contact with EGFR ligands. Domain II mediates formation of homo- or hetero-dimers with analogous domains from other EGFR family members, and Domain IV can form disulfide bonds with Domain II. The EGFR TM domain makes a single pass through the cell membrane and may play a role in protein dimerization. The intracellular domain includes the juxtamembrane domain, tyrosine kinase domain and C-terminal tail, which mediate EGFR signal transduction (Wee and Wang, Cancers 9(52), doi:10.3390/cancers9050052; Ferguson, Annu Rev Biophys 37:353-373, 2008; Wang et al., Blood 118(5):1255-1263, 2011).

[0240] A truncated version of human EGFR, referred to as “huEGFRt” includes only Domain III, Domain IV and the TM domain. Thus, huEGFRt lacks Domain I, Domain II, and all three intracellular domains. huEGFRt is not capable of binding EGF and lacks signaling activity. However, this molecule retains the capacity to bind particular EGFR-specific monoclonal antibodies, such as FDA-approved cetuximab (PCT Publication No. WO 2011/056894, which is herein incorporated by reference).

[0241] Transduction of immune cells or iPSCs with a construct (such as a lentivirus vector) encoding both huEGFRt and an S protein-specific CAR disclosed herein allows for selection of transduced cells using labelled EGFR monoclonal antibody cetuximab (ERBITUX™). For example, cetuximab can be labeled with biotin, and transduced cells can be selected using anti-biotin magnetic beads, which are commercially available (such as from Miltenyi Biotec). Co-expression of huEGFRt also allows for in vivo tracking of adoptively transferred CAR-expressing cells. Furthermore, binding of cetuximab to immune cells or iPSCs expressing huEGFRt induces cytotoxicity of ADCC effector cells, thereby providing a mechanism to eliminate transduced cells in vivo (Wang et al., Blood 118(5):1255-1263, 2011), such as at the conclusion of therapy.

[0242] Also provided herein are S protein-specific monoclonal antibodies (such as a nanobody disclosed herein) modified to enable their use with a universal CAR system. Universal CAR systems increase CAR flexibility and expand their use to additional antigens. Currently, for each patient who receives CAR T cell therapy, autologous T cells are cultured, expanded, and modified to express an antigen-specific CAR. This process is lengthy and expensive, limiting its use. Universal CARs are based on a system in which the signaling components of the CAR are split from the antigen-binding portion of the molecule, but come together using a “lock-key” system. For example, biotin-binding immune receptor (BBIR) CARs are comprised of an intracellular T cell signaling domain fused to an extracellular domain comprising avidin. Biotinylated antigen-specific (such as S protein-specific) monoclonal antibodies can then bind the BBIR to direct immune cells or iPSCs to tumor antigen-expressing cells. Another example is the split, universal and programmable (SUPRA) CAR system. In the SUPRA system, the CAR includes the intracellular signaling domains fused to an extracellular leucine zipper, which is paired with an antigen-specific monoclonal antibody fused to a cognate leucine zipper. For a review of universal CAR systems, see, for example, Zhao et al., J Hematol Oncol 11(1):132, 2018; and Cho et al., Cell 173:1426-1438, 2018. In some embodiments herein, the S protein-specific monoclonal antibody is fused to one component of a specific binding pair. In some examples, the monoclonal antibody is fused to a leucine zipper or biotin.

[0243] Another type of universal CAR can be generated using a sortase enzyme. A sortase is a prokaryotic enzyme that modifies surface proteins by recognizing and cleaving a carboxyl-terminal sorting signal.

[0244] Sortase catalyzes transpeptidation between a sortase recognition motif and a sortase acceptor motif. Thus, antigen-specific CARs can be generated by contacting an antigen-specific antibody fused to a sortase recognition motif with a portion of a CAR molecule that includes the intracellular signaling domain(s), a transmembrane region and an extracellular portion comprising a sortase acceptor motif. In the presence of the sortase enzyme, the two components become covalently attached to form a complete antigen-specific CAR. Accordingly, in some embodiments herein, an S protein-specific monoclonal antibody is modified to include a sortase recognition motif (see, for example, PCT Publication No. WO 2016/014553).

[0245] In some embodiments, the S protein-targeted CAR is expressed in allogeneic immune cells (e.g., allogeneic T cells, NK cells, or macrophages), such as allogeneic immune cells from a healthy donor(s). In some examples, the allogeneic T cells are genetically engineered to express the S protein-targeted CAR, for example by disrupting expression of an endogenous T cell receptor by insertion of the CAR (see, for example, MacLeod et al., Mol Ther 25(4): 949-961, 2017). Gene editing can be performed using any appropriate gene editing system, such as CRISPR/Cas9, zinc finger nucleases or transcription activator-like effector nucleases (TALEN).

V. Immunoconjugates

[0246] The disclosed single-domain monoclonal antibodies can be conjugated to a therapeutic agent or effector molecule. Immunoconjugates include, but are not limited to, molecules in which there is a covalent linkage of a therapeutic agent to an antibody. A therapeutic agent is an agent with a particular biological activity directed against a particular target molecule or a cell bearing a target molecule. One of skill in the art will appreciate that therapeutic agents can include various drugs such as vinblastine, daunomycin and the like, cytotoxins such as native or modified Pseudomonas exotoxin or diphtheria toxin, encapsulating agents (such as liposomes) that contain pharmacological compositions, radioactive agents such as .sup.125I, .sup.32P, .sup.14C, .sup.3H and .sup.35S, photon absorbers such as IR700, and other labels, target moieties and ligands.

[0247] The choice of a particular therapeutic agent depends on the particular target molecule or cell, and the desired biological effect. Thus, for example, the therapeutic agent can be a cytotoxin that is used to bring about the death of a particular target cell (such as a coronavirus-infected cell). Conversely, where it is desired to invoke a non-lethal biological response, the therapeutic agent can be conjugated to a non-lethal pharmacological agent or a liposome containing a non-lethal pharmacological agent.

[0248] With the therapeutic agents and antibodies described herein, one of skill can readily construct a variety of clones containing functionally equivalent nucleic acids, such as nucleic acids which differ in sequence but which encode the same effector moiety or antibody sequence. Thus, the present disclosure provides nucleic acids encoding antibodies and conjugates and fusion proteins thereof.

[0249] Effector molecules can be linked to an antibody of interest using any number of means known to those of skill in the art. Both covalent and noncovalent attachment means may be used. The procedure for attaching an effector molecule to an antibody varies according to the chemical structure of the effector. Polypeptides typically contain a variety of functional groups; such as carboxylic acid (COOH), free amine (—NH.sub.2) or sulfhydryl (—SH) groups, which are available for reaction with a suitable functional group on an antibody to result in the binding of the effector molecule. Alternatively, the antibody is derivatized to expose or attach additional reactive functional groups. The derivatization may involve attachment of any of a number of known linker molecules. The linker can be any molecule used to join the antibody to the effector molecule. The linker is capable of forming covalent bonds to both the antibody and to the effector molecule. Suitable linkers are well-known to those of skill in the art and include, but are not limited to, straight or branched-chain carbon linkers, heterocyclic carbon linkers, or peptide linkers. Where the antibody and the effector molecule are polypeptides, the linkers may be joined to the constituent amino acids through their side groups (such as through a disulfide linkage to cysteine) or to the alpha carbon amino and carboxyl groups of the terminal amino acids.

[0250] In some circumstances, it is desirable to free the effector molecule from the antibody when the immunoconjugate has reached its target site. Therefore, in these circumstances, immunoconjugates will include linkages that are cleavable in the vicinity of the target site. Cleavage of the linker to release the effector molecule from the antibody may be prompted by enzymatic activity or conditions to which the immunoconjugate is subjected either inside the target cell or in the vicinity of the target site.

[0251] In view of the large number of methods that have been reported for attaching a variety of radiodiagnostic compounds, radiotherapeutic compounds, labels (such as enzymes or fluorescent molecules), drugs, toxins, and other agents to antibodies, one skilled in the art can determine a suitable method for attaching a given agent to an antibody or other polypeptide.

[0252] The antibodies disclosed herein can be derivatized or linked to another molecule (such as another peptide or protein). In general, the antibodies or portion thereof is derivatized such that the binding to the target antigen is not affected adversely by the derivatization or labeling. For example, the antibody can be functionally linked (by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as another antibody (for example, a bispecific antibody or a diabody), a detection agent, a photon absorber, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).

[0253] One type of derivatized antibody is produced by cross-linking two or more antibodies (of the same type or of different types, such as to create bispecific antibodies). Suitable crosslinkers include those that are heterobifunctional, having two distinctly reactive groups separated by an appropriate spacer (such as m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional (such as disuccinimidyl suberate). Such linkers are commercially available.

[0254] The antibody can be conjugated with a detectable marker; for example, a detectable marker capable of detection by ELISA, spectrophotometry, flow cytometry, microscopy or diagnostic imaging techniques (such as computed tomography (CT), computed axial tomography (CAT) scans, magnetic resonance imaging (MRI), nuclear magnetic resonance imaging NMRI), magnetic resonance tomography (MTR), ultrasound, fiberoptic examination, and laparoscopic examination). Specific, non-limiting examples of detectable markers include fluorophores, chemiluminescent agents, enzymatic linkages, radioactive isotopes and heavy metals or compounds (for example super paramagnetic iron oxide nanocrystals for detection by MRI). For example, useful detectable markers include fluorescent compounds, including fluorescein, fluorescein isothiocyanate, rhodamine, 5-dimethylamine-1-napthalenesulfonyl chloride, phycoerythrin, lanthanide phosphors and the like. Bioluminescent markers are also of use, such as luciferase, green fluorescent protein (GFP) and yellow fluorescent protein (YFP). An antibody can also be conjugated with enzymes that are useful for detection, such as horseradish peroxidase, β-galactosidase, luciferase, alkaline phosphatase, glucose oxidase and the like. When an antibody or antigen binding fragment is conjugated with a detectable enzyme, it can be detected by adding additional reagents that the enzyme uses to produce a reaction product that can be discerned. For example, when the agent horseradish peroxidase is present the addition of hydrogen peroxide and diaminobenzidine leads to a colored reaction product, which is visually detectable. An antibody or antigen binding fragment may also be conjugated with biotin, and detected through indirect measurement of avidin or streptavidin binding. It should be noted that the avidin itself can be conjugated with an enzyme or a fluorescent label.

[0255] An antibody provided herein may be labeled with a magnetic agent, such as gadolinium. Antibodies can also be labeled with lanthanides (such as europium and dysprosium), and manganese. Paramagnetic particles such as superparamagnetic iron oxide are also of use as labels. An antibody may also be labeled with a predetermined polypeptide epitopes recognized by a secondary reporter (such as leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags). In some embodiments, labels are attached by spacer arms of various lengths to reduce potential steric hindrance.

[0256] An antibody provided herein can also be labeled with a radiolabeled amino acid. The radiolabel may be used for both diagnostic and therapeutic purposes. For instance, the radiolabel may be used to detect expression of a target antigen by x-ray, emission spectra, or other diagnostic techniques. Examples of labels for polypeptides include, but are not limited to, the following radioisotopes or radionucleotides: .sup.3H, .sup.14C , .sup.15N , .sup.35S, .sup.90Y, .sup.99Tc, .sup.111In, .sup.125I, .sup.131I.

[0257] An antibody disclosed herein can also be conjugated to a photon absorber. In some embodiments, the photon absorber is a phthalocyanine dye, such as, but not limited to, IRDye® 700DX (also known as “IR700”). Antibody-photoabsorber conjugates can be used for photoimmunotherapy (for example to kill cells infected with a coronavirus, such as SARS-CoV and/or SARS-CoV-2).

[0258] An antibody provided herein can also be derivatized with a chemical group such as polyethylene glycol (PEG), a methyl or ethyl group, or a carbohydrate group. These groups may be useful to improve the biological characteristics of the antibody, such as to increase serum half-life or to increase tissue binding.

[0259] Toxins can be employed with the monoclonal antibodies described herein to produce immunotoxins. Exemplary toxins include ricin, abrin, diphtheria toxin and subunits thereof, as well as botulinum toxins A through F. These toxins are readily available from commercial sources (for example, Sigma Chemical Company, St. Louis, MO). Contemplated toxins also include variants of the toxins described herein (see, for example, see, U.S. Pat. Nos. 5,079,163 and 4,689,401). In one embodiment, the toxin is Pseudomonas exotoxin (PE) (U.S. Pat. No. 5,602,095). As used herein “Pseudomonas exotoxin” refers to a full-length native (naturally occurring) PE or a PE that has been modified. Such modifications can include, but are not limited to, elimination of domain Ia, various amino acid deletions in domains Ib, II and III, single amino acid substitutions and the addition of one or more sequences at the carboxyl terminus (for example, see Siegall et al., J. Biol. Chem. 264:14256-14261, 1989).

[0260] PE employed with the monoclonal antibodies described herein can include the native sequence, cytotoxic fragments of the native sequence, and conservatively modified variants of native PE and its cytotoxic fragments. Cytotoxic fragments of PE include those which are cytotoxic with or without subsequent proteolytic or other processing in the target cell. Cytotoxic fragments of PE include PE40, PE38, and PE35. For additional description of PE and variants thereof, see for example, U.S. Pat. Nos. 4,892,827; 5,512,658; 5,602,095; 5,608,039; 5,821,238; and 5,854,044; U.S. Patent Application Publication No. 2015/0099707; PCT Publication Nos. WO 99/51643 and WO 2014/052064; Pai et al., Proc. Natl. Acad. Sci. USA 88:3358-3362, 1991; Kondo et al., J. Biol. Chem. 263:9470-9475, 1988; Pastan et al., Biochim. Biophys. Acta 1333:C1-C6, 1997.

[0261] Also contemplated herein are protease-resistant PE variants and PE variants with reduced immunogenicity, such as, but not limited to PE-LR, PE-6X, PE-8X, PE-LR/6X and PE-LR/8X (see, for example, Weldon et al., Blood 113(16):3792-3800, 2009; Onda et al., Proc Natl Acad Sci USA 105(32):11311-11316, 2008; and PCT Publication Nos. WO 2007/016150, WO 2009/032954 and WO 2011/032022, which are herein incorporated by reference).

[0262] In some examples, the PE is a variant that is resistant to lysosomal degradation, such as PE-LR (Weldon et al., Blood 113(16):3792-3800, 2009; PCT Publication No. WO 2009/032954). In other examples, the PE is a variant designated PE-LR/6X (PCT Publication No. WO 2011/032022). In other examples, the PE variant is PE with reducing immunogenicity. In yet other examples, the PE is a variant designated PE-LR/8M (PCT Publication No. WO 2011/032022).

[0263] Modification of PE may occur in any previously described variant, including cytotoxic fragments of PE (for example, PE38, PE-LR and PE-LR/8M). Modified PEs may include any substitution(s), such as for one or more amino acid residues within one or more T-cell epitopes and/or B cell epitopes of PE, or deletion of one or more T-cell and/or B-cell epitopes (see, for example, U.S. Patent Application Publication No. 2015/0099707).

[0264] Contemplated forms of PE also include deimmunized forms of PE, for example versions with domain II deleted (for example, PE24). Deimmunized forms of PE are described in, for example, PCT Publication Nos. WO 2005/052006, WO 2007/016150, WO 2007/014743, WO 2007/031741, WO 2009/32954, WO 2011/32022, WO 2012/154530, and WO 2012/170617.

[0265] The antibodies described herein can also be used to target any number of different diagnostic or therapeutic compounds to cells expressing coronavirus S protein on their surface (e.g., SARS-CoV-2 or SARS-CoV infected cells). Thus, an antibody of the present disclosure can be attached directly or via a linker to a drug that is to be delivered directly to cells expressing coronavirus spike protein. This can be done for therapeutic, diagnostic or research purposes. Therapeutic agents include such compounds as nucleic acids, proteins, peptides, amino acids or derivatives, glycoproteins, radioisotopes, photon absorbers, lipids, carbohydrates, or recombinant viruses. Nucleic acid therapeutic and diagnostic moieties include antisense nucleic acids, derivatized oligonucleotides for covalent cross-linking with single or duplex DNA, and triplex forming oligonucleotides.

[0266] Alternatively, the molecule linked to an antibody can be an encapsulation system, such as a nanoparticle, liposome or micelle that contains a therapeutic composition such as a drug, a nucleic acid (for example, an antisense nucleic acid), or another therapeutic moiety that is preferably shielded from direct exposure to the circulatory system. Means of preparing liposomes attached to antibodies are well known to those of skill in the art (see, for example, U.S. Pat. No. 4,957,735; Connor et al., Pharm. Ther. 28:341-365, 1985).

[0267] Antibodies described herein can also be covalently or non-covalently linked to a detectable label. Detectable labels suitable for such use include any composition detectable by spectroscopic, photochemical, biochemical, immunochemical, electrical, optical or chemical means. Useful labels include magnetic beads, fluorescent dyes (for example, fluorescein isothiocyanate, Texas red, rhodamine, green fluorescent protein, and the like), radiolabels (for example, .sup.3H, .sup.125I, .sup.35S, .sup.14C, or .sup.32P), enzymes (such as horseradish peroxidase, alkaline phosphatase and others commonly used in an ELISA), and colorimetric labels such as colloidal gold or colored glass or plastic (such as polystyrene, polypropylene, latex, and the like) beads.

[0268] Means of detecting such labels are known. Thus, for example, radiolabels may be detected using photographic film or scintillation counters, fluorescent markers may be detected using a photodetector to detect emitted illumination. Enzymatic labels are typically detected by providing the enzyme with a substrate and detecting the reaction product produced by the action of the enzyme on the substrate, and colorimetric labels are detected by simply visualizing the colored label.

VI. Antibody-Drug Conjugates (ADCs)

[0269] ADCs are compounds comprised of an antigen-specific antibody (such as a single-domain antibody or antigen-binding fragment of an immunoglobulin) and a drug, for example an anti-viral agent (such as remdesivir, galidesivir, arbidol, favipiravir, baricitinib, molnupiravir, or lopinavir/ritonavir) or a cytotoxic agent (such as an anti-microtubule agent or cross-linking agent). Because ADCs are capable of specifically targeting cells expressing a particular antigen, the drug can be much more potent than agents used for standard systemic therapy. For example, the most common cytotoxic drugs currently used with ADCs have an IC.sub.50 that is 100- to 1000-fold more potent than conventional chemotherapeutic agents. Exemplary cytotoxic drugs include anti-microtubule agents, such as maytansinoids and auristatins (such as auristatin E and auristatin F). Other cytotoxins for use with ADCs include pyrrolobenzodiazepines (PBDs), which covalently bind the minor groove of DNA to form interstrand crosslinks In some instances, ADCs include a 1:2 to 1:4 ratio of antibody provided herein to drug (Bander, Clinical Advances in Hematology & Oncology 10(8; suppl 10):3-7, 2012).

[0270] The antibody and drug can be linked by a cleavable or non-cleavable linker. However, in some instances, it is desirable to have a linker that is stable in the circulation to prevent systemic release of the cytotoxic drug that could result in significant off-target toxicity. Non-cleavable linkers prevent release of the cytotoxic agent before the ADC is internalized by the target cell. Once in the lysosome, digestion of the antibody by lysosomal proteases results in the release of the cytotoxic agent (Bander, Clinical Advances in Hematology & Oncology 10(8; suppl 10):3-7, 2012).

[0271] One method for site-specific and stable conjugation of a drug to a monoclonal antibody (or a V.sub.HH-Fc protein) is via glycan engineering. Monoclonal antibodies have one conserved N-linked oligosaccharide chain at the Asn297 residue in the CH2 domain of each heavy chain (Qasba et al., Biotechnol Prog 24:520-526, 2008). Using a mutant β1,4-galactosyltransferase enzyme (Y289L-Gal-T1; U.S. Patent Application Publication Nos. 2007/0258986 and 2006/0084162, herein incorporated by reference), 2-keto-galactose is transferred to free GlcNAc residues on the antibody heavy chain to provide a chemical handle for conjugation.

[0272] The oligosaccharide chain attached to monoclonal antibodies can be classified into three groups based on the terminal galactose residues—fully galactosylated (two galactose residues; IgG-G2), one galactose residue (IgG-G1) or completely degalactosylated (IgG-G0). Treatment of a monoclonal antibody with β1,4-galactosidase converts the antibody to the IgG-G0 glycoform. The mutant β1,4-galactosyltransferase enzyme can transfer 2-keto-galactose or 2-azido-galactose from their respective UDP derivatives to the GlcNAc residues on the IgG-G1 and IgG-G0 glycoforms. The chemical handle on the transferred sugar enables conjugation of a variety of molecules to the monoclonal antibody via the glycan residues (Qasba et al., Biotechnol Prog 24:520-526, 2008).

[0273] Provided herein are ADCs that include a drug (such as an anti-viral agent) conjugated to a monoclonal antibody that binds (such as specifically binds) coronavirus S protein. In some embodiments, the drug is a small molecule. In some examples, the drug is an anti-viral agent, such as remdesivir, galidesivir, arbidol, favipiravir, baricitinib, molnupiravir, or lopinavir/ritonavir. In some examples, the drug is a cross-linking agent, an anti-microtubule agent and/or anti-mitotic agent, or any cytotoxic agent suitable for mediating killing of tumor cells. Exemplary cytotoxic agents include, but are not limited to, a PBD, an auristatin, a maytansinoid, dolastatin, calicheamicin, nemorubicin and its derivatives, PNU-159682, anthracycline, vinca alkaloid, taxane, trichothecene, CC1065, camptothecin, elinafide, a combretastain, a dolastatin, a duocarmycin, an enediyne, a geldanamycin, an indolino-benzodiazepine dimer, a puromycin, a tubulysin, a hemiasterlin, a spliceostatin, or a pladienolide, as well as stereoisomers, isosteres, analogs, and derivatives thereof that have cytotoxic activity.

[0274] In some embodiments, the ADC includes a pyrrolobenzodiazepine (PBD), such as the natural product anthramycin (a PBD) (Leimgruber et al., J Am Chem Soc, 87:5793-5795, 1965; Leimgruber et al., J Am Chem Soc, 87:5791-5793, 1965), as well as other naturally-occurring and synthetic analogues of PBD (Gerratana, Med Res Rev 32(2):254-293, 2012; and U.S. Pat. Nos. 6,884,799; 7,049,311; 7,067,511; 7,265,105; 7,511,032; 7,528,126; and 7,557,099). As one example, PBD dimers recognize and bind to specific DNA sequences, and are useful as cytotoxic agents. PBD dimers have been conjugated to antibodies and the resulting ADC shown to have anti-cancer properties (see, for example, US 2010/0203007). Exemplary linkage sites on the PBD dimer include the five-membered pyrrolo ring, the tether between the PBD units, and the N10-C11 imine group (see WO 2009/016516; US 2009/304710; US 2010/047257; US 2009/036431; US 2011/0256157; and WO 2011/130598).

[0275] In some embodiments, the ADC includes an antibody provided herein conjugated to one or more maytansinoid molecules. Maytansinoids are derivatives of maytansine, and are mitotic inhibitors which act by inhibiting tubulin polymerization. Maytansine is described in U.S. Pat. No. 3,896,111. Subsequently, it was discovered that certain microbes also produce maytansinoids, such as maytansinol and C-3 maytansinol esters (U.S. Pat. No. 4,151,042). Synthetic maytansinoids are disclosed, for example, in U.S. Pat. Nos. 4,137,230; 4,248,870; 4,256,746; 4,260,608; 4,265,814; 4,294,757; 4,307,016; 4,308,268; 4,308,269; 4,309,428; 4,313,946; 4,315,929; 4,317,821; 4,322,348; 4,331,598; 4,361,650; 4,364,866; 4,424,219; 4,450,254; 4,362,663; and 4,371,533.

[0276] In some embodiments, the ADC includes an antibody provided herein conjugated to a dolastatin or auristatin, or an analog or derivative thereof (see U.S. Pat. Nos. 5,635,483; 5,780,588; 5,767,237; and 6,124,431). Auristatins are derivatives of the marine mollusk compound dolastatin-10. Dolastatins and auristatins have been shown to interfere with microtubule dynamics, GTP hydrolysis, and nuclear and cellular division (Woyke et al., Antimicrob Agents and Chemother 45(12):3580-3584, 2001) and have anticancer (U.S. Pat. No. 5,663,149) and antifungal activity (Pettit et al., Antimicrob Agents Chemother 42:2961-2965, 1998). Exemplary dolastatins and auristatins include, but are not limited to, dolastatin 10, auristatin E, auristatin F, auristatin EB (AEB), auristatin EFP (AEFP), MMAD (Monomethyl Auristatin D or monomethyl dolastatin 10), MMAF (Monomethyl Auristatin F or N-methylvaline-valine-dolaisoleuine-dolaproine-phenylalanine), MMAE (Monomethyl Auristatin E or N-methylvaline-valine-dolaisoleuine-dolaproine-norephedrine), 5-benzoylvaleric acid-AE ester (AEVB), and other auristatins (see, for example, U.S. Publication No. 2013/0129753).

[0277] In some embodiments, the ADC includes an antibody provided herein conjugated to one or more calicheamicin molecules. The calicheamicin family of antibiotics, and analogues thereof, can produce double-stranded DNA breaks at sub-picomolar concentrations (Hinman et al., Cancer Res 53:3336-3342, 1993; Lode et al., Cancer Res 58:2925-2928, 1998). Exemplary methods for preparing ADCs with a calicheamicin drug moiety are described in U.S. Pat. Nos. 5,712,374; 5,714,586; 5,739,116; and 5,767,285.

[0278] In some embodiments, the ADC includes an anthracycline. Anthracyclines are antibiotic compounds that exhibit cytotoxic activity. Anthracyclines kill cells by a number of different mechanisms, including intercalation of the drug molecules into the DNA of the cell thereby inhibiting DNA-dependent nucleic acid synthesis; inducing production of free radicals which then react with cellular macromolecules to cause damage to the cells; and/or interactions of the drug molecules with the cell membrane. Non-limiting exemplary anthracyclines include doxorubicin, epirubicin, idarubicin, daunomycin, daunorubicin, doxorubicin, epirubicin, nemorubicin, valrubicin and mitoxantrone, and derivatives thereof. For example, PNU-159682 is a potent metabolite (or derivative) of nemorubicin (Quintieri et al., Clin Cancer Res 11(4):1608-1617, 2005). Nemorubicin is a semisynthetic analog of doxorubicin with a 2-methoxymorpholino group on the glycoside amino of doxorubicin (Grandi et al., Cancer Treat Rev 17:133, 1990; Ripamonti et al., Br J Cancer 65:703-707, 1992).

[0279] In some embodiments, the ADC can further include a linker. In some examples, the linker is a bifunctional or multifunctional moiety that can be used to link one or more drug moieties to an antibody to form an ADC. In some embodiments, ADCs are prepared using a linker having reactive functionalities for covalently attaching to the drug and to the antibody. For example, a cysteine thiol of an antibody can form a bond with a reactive functional group of a linker or a drug-linker intermediate to make an ADC.

[0280] In some examples, a linker has a functionality that can react with a free cysteine present on an antibody to form a covalent bond. Exemplary linkers with such reactive functionalities include maleimide, haloacetamides, a-haloacetyl, activated esters such as succinimide esters, 4-nitrophenyl esters, pentafluorophenyl esters, tetrafluorophenyl esters, anhydrides, acid chlorides, sulfonyl chlorides, isocyanates, and isothiocyanates.

[0281] In some examples, a linker has a functionality that can react with an electrophilic group present on an antibody. Exemplary electrophilic groups include, but are not limited to, aldehyde and ketone carbonyl groups. In some cases, a heteroatom of the reactive functionality of the linker can react with an electrophilic group on an antibody and form a covalent bond to an antibody unit. Non-limiting examples include hydrazide, oxime, amino, hydrazine, thiosemicarbazone, hydrazine carboxylate and arylhydrazide.

[0282] In some examples, the linker is a cleavable linker, which facilitates release of the drug. Examples of cleavable linkers include acid-labile linkers (for example, comprising hydrazone), protease-sensitive linkers (for example, peptidase-sensitive), photolabile linkers, and disulfide-containing linkers (Chari et al., Cancer Res 52:127-131, 1992; U.S. Pat. No. 5,208,020).

[0283] The ADCs disclosed herein can be used for the treatment of a coronavirus infection alone or in combination with another therapeutic agent and/or in combination with any standard therapy for the treatment of a coronavirus infection, such as COVID-19 (e.g., remdesivir, galidesivir, lenzilumab, hydroxychloroquine, arbidol, favipiravir, baricitinib, molnupiravir, lopinavir/ritonavir, Zinc ions, and interferon beta-1b.

VII. Multi-Specific Antibodies

[0284] Multi-specific antibodies are recombinant proteins comprised of two or more monoclonal antibodies (such as single-domain antibodies) or antigen-binding fragments of two or more different monoclonal antibodies. For example, bispecific antibodies are comprised of two different monoclonal antibodies or antigen-binding fragments thereof. Thus, bispecific antibodies bind two different antigens and trispecific antibodies bind three different antigens. Multi-specific antibodies can be used for treating a coronavirus infection by simultaneously targeting, for example, a coronavirus S protein (including N-terminal domain (NTD), receptor binding domain (RBD), or whole S1 or S2 subunits) and a carbohydrate (including N-glycans), envelope protein, or hemagglutinin-esterase dimer (HE). In some examples, the multi-specific antibody includes a first binding domain that targets a portion of a coronavirus S protein (such as the NTD, RBD, S1 subunit or S2 subunit) and a second binding domain that targets a different portion of the same coronavirus S protein (such as the NTD, RBD, S1 subunit or S2 subunit).

[0285] In some embodiments, the multi-specific antibodies include a monoclonal antibody that specifically binds a SARS-CoV-2 spike protein and an immune cell engager, for example, a T cell engager (e.g., an antibody that specifically binds CD3) or an NK cell engager (e.g., an antibody that specifically binds NKp46 or CD16). The spike protein-specific single-domain monoclonal antibodies disclosed herein can be used to generate multi-specific (such as bispecific or trispecific) antibodies that target both spike protein and CTLs, or target both spike protein and NK cells, thereby providing a means to treat coronavirus-infected cells.

[0286] Bi-specific T-cell engagers (BiTEs) are a type of bispecific monoclonal antibody that are fusions of a first monoclonal antibody (such as a scFv or a single-domain antibody) that targets a specific antigen (such as SARS-CoV-2 spike protein) and a second antibody that binds T cells, such as CD3 on T cells.

[0287] Bi-specific killer cell engagers (BiKEs) are a type of bispecific monoclonal antibody that are fusions of a first monoclonal antibody (such as a scFv or single-domain antibody) that targets a specific antigen (such as SARS-CoV-2 spike protein) and a second scFv that binds a NK cell activating receptor, such as CD16.

[0288] Provided herein are multi-specific, such as trispecific or bispecific, monoclonal antibodies comprising an S protein-specific monoclonal antibody. In some embodiments, the multi-specific monoclonal antibody further comprises a monoclonal antibody that specifically binds S protein RBD, NTD, S1 subunit or S2 subunit, or a carbohydrate (such as an N-glycan), or other viral proteins (such as envelope or HE). In other embodiments, the multi-specific monoclonal antibody includes an S protein-specific monoclonal antibody and an immune cell engager. Also provided are isolated nucleic acid molecules and vectors encoding the multi-specific antibodies, and host cells comprising the nucleic acid molecules or vectors. Multi-specific antibodies comprising an S protein-specific antibody can be used for the treatment of a coronavirus infection. Thus, provided herein are methods of treating a subject with a coronavirus infection by administering to the subject a therapeutically effective amount of the S protein-targeting multi-specific antibody.

VIII. Antibody-Nanoparticle Conjugates

[0289] The monoclonal antibodies disclosed herein can be conjugated to a variety of different types of nanoparticles to deliver cytotoxic agents or anti-viral agents (such as remdesivir, galidesivir, arbidol, favipiravir, baricitinib, molnupiravir, or lopinavir/ritonavir) directly to coronavirus-infected cells via binding of the antibody to the spike protein expressed on the surface of infected cells. The use of nanoparticles reduces off-target side effects and can also improve drug bioavailability and reduce the dose of a drug required to achieve a therapeutic effect. Nanoparticle formulations can be tailored to suit the drug that is to be carried or encapsulated within the nanoparticle. For example, hydrophobic molecules can be incorporated inside the core of a nanoparticle, while hydrophilic drugs can be carried within an aqueous core protected by a polymeric or lipid shell. Examples of nanoparticles include, but at not limited to, nanospheres, nanocapsules, liposomes, dendrimers, polymeric micelles, niosomes, and polymeric nanoparticles (Fay and Scott, Immunotherapy 3(3):381-394, 2011).

[0290] Liposomes are common types of nanoparticles used for drug delivery. An antibody conjugated to a liposome is often referred to as an “immunoliposome.” The liposomal component of an immunoliposome is typically a lipid vesicle of one or more concentric phospholipid bilayers. In some cases, the phospholipids are composed of a hydrophilic head group and two hydrophobic chains to enable encapsulation of both hydrophobic and hydrophilic drugs. Conventional liposomes are rapidly removed from the circulation via macrophages of the reticuloendothelial system (RES). To generate long-circulating liposomes, the composition, size and charge of the liposome can be modulated. The surface of the liposome may also be modified, such as with a glycolipid or sialic acid. For example, the inclusion of polyethylene glycol (PEG) significantly increases circulation half-life. Liposomes for use as drug delivery agents, including for preparation of immunoliposomes, have been described in the art (see, for example, Paszko and Senge, Curr Med Chem 19(31)5239-5277, 2012; Immordino et al., Int J Nanomedicine 1(3):297-315, 2006; U.S. Patent Application Publication Nos. 2011/0268655; 2010/00329981).

[0291] Niosomes are non-ionic surfactant-based vesicles having a structure similar to liposomes. The membranes of niosomes are composed only of nonionic surfactants, such as polyglyceryl-alkyl ethers or N-palmitoylglucosamine. Niosomes range from small, unilamellar to large, multilamellar particles. These nanoparticles are monodisperse, water-soluble, chemically stable, have low toxicity, are biodegradable and non-immunogenic, and increase bioavailability of encapsulated drugs.

[0292] Dendrimers include a range of branched polymer complexes. These nanoparticles are water-soluble, biocompatible and are sufficiently non-immunogenic for human use. Generally, dendrimers consist of an initiator core, surrounded by a layer of a selected polymer that is grafted to the core, forming a branched macromolecular complex. Dendrimers are typically produced using polymers such as poly(amidoamine) or poly(L-lysine). Dendrimers have been used for a variety of therapeutic and diagnostic applications, including for the delivery of DNA, RNA, bioimaging contrast agents, chemotherapeutic agents and other drugs.

[0293] Polymeric micelles are composed of aggregates of amphiphilic co-polymers (consisting of both hydrophilic and hydrophobic monomer units) assembled into hydrophobic cores, surrounded by a corona of hydrophilic polymeric chains exposed to the aqueous environment. In many cases, the polymers used to prepare polymeric micelles are heterobifunctional copolymers composed of a hydrophilic block of PEG, poly(vinyl pyrrolidone) and hydrophobic poly(L-lactide) or poly(L-lysine) that forms the particle core. Polymeric micelles can be used to carry drugs that have poor solubility. These nanoparticles have been used to encapsulate a number of drugs, including doxorubicin and camptothecin. Cationic micelles have also been developed to carry DNA or RNA molecules.

[0294] Polymeric nanoparticles include both nanospheres and nanocapsules. Nanospheres consist of a solid matrix of polymer, while nanocapsules contain an aqueous core. The formulation selected typically depends on the solubility of the therapeutic agent to be carried/encapsulated; poorly water-soluble drugs are more readily encapsulated within a nanospheres, while water-soluble and labile drugs, such as DNA and proteins, are more readily encapsulated within nanocapsules. The polymers used to produce these nanoparticles include, for example, poly(acrylamide), poly(ester), poly(alkylcyanoacrylates), poly(lactic acid) (PLA), poly(glycolic acids) (PGA), and poly(D,L-lactic-co-glycolic acid) (PLGA).

[0295] Antibodies provided herein can be conjugated to a suitable nanoparticle according to standard methods. For example, conjugation can be either covalent or non-covalent. In some embodiments in which the nanoparticle is a liposome, the antibody is attached to a sterically stabilized, long circulation liposome via a PEG chain. Coupling of antibodies or antibody fragments to a liposome can also involve thioester bonds, for example by reaction of thiols and maleimide groups. Cross-linking agents can be used to create sulfhydryl groups for attachment of antibodies to nanoparticles (Paszko and Senge, Curr Med Chem 19(31)5239-5277, 2012).

IX. Nucleic Acid Molecules

[0296] Nucleic acid molecules (for example, DNA, cDNA or RNA molecules) encoding the amino acid sequences of the disclosed antibodies, fusion proteins, and conjugates that specifically bind to a coronavirus spike protein, are provided. Nucleic acid molecules encoding these molecules can readily be produced using the amino acid sequences provided herein (such as the CDR sequences and the V.sub.HH sequences), sequences available in the art (such as framework or constant region sequences), and the genetic code. In some embodiments, the nucleic acid molecules can be expressed in a host cell (such as a mammalian cell, yeast cell or a bacterial cell) to produce a disclosed antibody, fusion protein or antibody conjugate (e.g., CAR, immunotoxin, multi-specific antibody). In some examples, the nanobody is in an IgG, IgA or IgM format.

[0297] Provided below are exemplary nucleic acid sequences of the disclosed nanobodies specific for the spike protein of SARS-CoV-2.

TABLE-US-00002 NCI-CoV-7A3 (SEQ ID NO: 60) CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTCGGTGCAGC CTGGAGGGTCTCTGAGACTCTCCTGTGTAGTCTCTGGATA CACCAGCAGTAGCCGCTACATGGGCTGGTTCCGCCAGGTT CCAGGGAAGGGGCTGGAGTGGGTGTCCGGAATTAAACGTG ATGGTACTAACACATACTATGCAGACTCCGTGAAGGGCCG ATTCACCATCTCCCAAGACAACGCCAAGAATACGGTGTAT CTGCAAATGAACAGCCTGAAACCTGAGGACACTGCCATGT ACTACTGTGCAGCGGGTAGCTGGTACAACCAGTGGGGTTA CAGTATGGACTACTGGGGCAAAGGGACCCAGGTCACCGTC TCCTCA NCI-CoV-8A2 (SEQ ID NO: 61) GCCGTGCAGCTGGTGGATTCTGGGGGAGGCTCGGTGCAGG CTGGAGGGTCTCTGAGACTCTCCTGTGCAGCCTCTGGATA CACCTACAGTATCTGCACCATGGGCTGGTACCGCCAGGCT CCAGGGGAGGGGCTGGAGTGGGTGTCCGGCATTAATGCTG ATGGTAGTAACACACACTATACAGACTCCGTGAAGGGCCG ATTCACCATCTCCAGAGACAACGCCAAGAAGACGCTGTAT CTGCAAATGAACAGCCTGAAACCTGAGGACACGGCCATCT ATTACTGTGCGGCCCACGGGACCTATGACAAGTATGCGCC CTGCGGTGGATTTGCGGGAACCTATACGTACTGGGGCCAG GGGACCCAGGTCACCGTCTCCTCA NCI-CoV-2F7 (SEQ ID NO: 62) CAGGTAAAGCTGGAGGAGTCTGGGGGAGGCTCGGTGCAGT CTGGAGGGTCTCTGAGACTCTCGTGTACAGTCTCTAGAGA CACCAACACCAATATTAACAGGTGCATGGGCTGGTTCCGC CAGGCGCCAGGGAAGGGCCTGGAGACCGTCGCCACGATTA ATAGAGATGGTACCAATACATACTATACAGATGCCGTGAA GGGGCGATTCACCATCTCCCAAGACAACGTCAAGAATACG GTGTATCTGCAAATGAACAACCTGACGCCTGAAGACACGG GCACGTATATCTGTAACGCGATGGGTCGCGGATCAGGTTC GCGGTGCGATAATTGGGACCCCAACTACTGGGGCCAGGGG ACCCAGGTCACCGTCTCCTCA NCI-CoV-1B5 (SEQ ID NO: 63) GATGTGCAGCTGGTGGAGTCTGGGGGAGGCTCGGTGCAGG CTGGAGGGTCTCTGAGACTCTCCTGTACAGGCTCTAGATA CACCTACAGTACCTATTGCATGGGCTGGTTCCGCCAGGCT CCAGGGAAGGAGGAAGAGGCAGTCGCGATAATTAATAGTG GTGGTGGTGAGCCATACTACGGCGACTCCGTGAAGGGCCG ATTCACCATCTCCCAAGACCGCGCCAAGAACACGGTGTAT CTGCAAATGGACGGCCTGCAGCCTGATGACACTGCCATAT ATTACTGTGTCGCAGCAGATTCGCACAACTCTCGGTGCTA CCTCGGCCGCTCGTATGTTAACTACTGGGGCCAGGGGACC CAGGTCACCGTCTCCTCA NCI-CoV-8A4 (SEQ ID NO: 64) GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTGCAGC CTGGGGAGTCTCTGAGACTCTCCTGTGAAGCCTCTGGATT CACCTTCAGTAGCGTCTACATGAGCTGGGTCCGCCAGGCT CCAGGGAAGGGGCTCGAGTGGATCTCAACTATTCATCCTG CTGGCGGTAGCACATACTATGCAGACTCAATGAAGGACCG ATTCACCATCTCCAGAGACAACGCCAAGAACACGCTGTAT CTGCAAATGAACAGCCTGAAATCTGAGGACACGGCCCTGT ATTACTGTATTATAGAGGCGCTGTCTGGTTACCGGGGCCC GGGGACCCAGGTCACCGTCTCCTCA NCI-CoV-1H6 (SEQ ID NO: 65) GCCGTGCAGCTGGTGGATTCTGGGGGAGGCTCGGTGCAGG CTGGAGGGTCTCTGAACCTCTCCTGTGTAGCCTCTGGAAC GACCCTTCGAAACGGGTGCATGGCCTGGTTCCGCCAGGTT CCAGGGAAGGAGCGCGAGGTGGTCGCTATAATAATACGTG CTACTTCATATACAGACTATGCCGACTCCGTGAAGGGCCG ATTCACCATCTCCCAAGACAACGCCAAGAACACGGTGTAT TTGCAGATGAAGAGCCTGACACCTGAGGACACGGCCACGT ATTACTGTGCGGCAACTTTGTATCGTGTGAACTGCGCCAA GCGGGAGTTTGATAAGTGGGGCCAGGGGACCCAGGTCACC GTCTCCTCA NCI-CoV-1A10 (SEQ ID NO: 66) GCCGTGCAGCTGGTGGATTCTGGGGGAGGCTCGGTGCAGG CGGGAGGGTCTCTGAGACTCTCCTGTGCAGCCTCTGGATT CACCGGCAGTAACTACTGCTTGGGCTGGTTCCGCCAGGCT CCCGGGAAGGAGCGTGAGGGGGTTGCAGTTATTGAACGTG ATACTGGCGGCACAACCTACCCCAACTCCCTGGAGGGCCG GTTCACCATCGCCCAAGACAACGCCAAGAATATGGTTTAT TTGCATATGCGCAATCTACAACCTGAGGACACGGGTACCT ATACTTGTGCGGCAGCCCGGAATTATGGCGATTCCTTTGG AGGTTTTACTTTCTGGGGCCAGGGGACCCAGGTCACCGTC TCCTCA NCI-CoV-2C7 (SEQ ID NO: 67) GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTCGGTGCAAA CTGGAGGGTCTCTGAGACTGTCCTGTGTAGTCTCTGGATA CGATTATAGTAATTATTGTGTGGCCTGGTTCCGTCAGGCT GAAGGGAAGAACCGTGAGGGGCTCGCCGGTATCAATACGC ACGGTGCTTATACAAACTACAACACCCCCGCGAAGGGCCG CTTCACCATTTCCCAAGACCTGACCAAGAACACGTTTACA CTGCAAATGAACAGCCTGACACCTGAGGACACGGCCATCT ATTATTGTGCGGCATATCCTGAATACTGCCCTCGATTCTC GTCATCGTCCTGGAACAACTCTGCCGTCTGGGGCCAGGGG ACCCAGGTCACCGTCTCCTCA NCI-CoV-2B3 (SEQ ID NO: 68) GATGTGCAGCTGGTGGAGTCTGGGGGAAGCTCGGTGCAGG CTGGAGGGTCTCTGAGACTCTCCTGTGCAGCCTCTGGAGA CAGCTACAGAGGCAACTTGATGGGCTGGTTCCGCCAGGCT CCAGGGAAGGCGCGCGAGGGGGTCGCAGTTATTTTTACTC CTAATCATAACACATACGCTGCCGACTCCGTGAAGGGCCG CTTCACCATCTCCCAAGACAAGGCCAAGAACATGGTATAC CTGCAAATGAACAGCCTGAAACCTGAGGACACTGCCATGT ACTACTGTGCCACAGGTTGGGAGGGGGGTCTGATTCTTTC GGCCCGTGCGTATAGGTACTGGGGCCAGGGGACCCAGGTC ACCGTCTCCTCA NCI-CoV-2A3 (SEQ ID NO: 69) CAGGTGCAGCTGGTGGAGTCTGGGGGAGACTCGGTGCAGG CTGGAGAGTCTCTGAGACTCTCCTGTCAAGCCTCAGGAGA CACCAGCGGTGATTACGTCTACGTGGCCTGGTTCCGCCAG GCTCCAGGGAAGGAGCGTGAGGGGGTCGCAGTCGTACACA GTAATAGTGGTGGCACATATGTCGCCGACTCCGTGAAGGA ACGATTCATCATCTCCCAAGACAACACCAAGAACACGGTG TATCTGACTATGAACAGCCTGAAACCTGAGGACACGGCCA TCTATTACTGTGCGGCCAAAACCAGGTTAATTCCACACTT CAACGTCTTTTCCGCCGCGTCGTATAGTTACTGGGGCCAG GGGACCCAGGTCACCGTCTCCTCA NCI-CoV-1G11 (SEQ ID NO: 70) CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTCGGTGCAGG CTGGAGGGTCTCTGAGACTCTCCTGTGTAGCCTCTGGAGA CACCAACACTAGGCAGTACATGGGCTGGTTCCGCCAGGCT CCAGGGAAGGAGCGTGAGGGGGTCGCAGTCGTACACAGTG ATAGTGGTGGCACATATTACGCCGACTCCGTGAAGGAACG ATTCATCATCGCCCAAGACAACGCCAAAAACACGGTGTAT CTGACTATGAACAGCCTGAAAGTTGAGGACACGGCCATCT ATTACTGTGCGGCCAAAACCTTGGAAAAGCCACACTTCAG CGTCTTTTCCGCCGCGTCGTATGATTACTGGGGCCAGGGG ACCCAGGTCACCGTCTCCTCA NCI-CoV-2C9 (SEQ ID NO: 71) CAGGTGCAGCTGGTGGAGTCTGGGGGAGACTCGGTGCAGG CTGGAGAGTCTCTGAGACTCTCCTGTCAAGCCTCAGGAGA CACCAGCAGTTTGTACTACTACGTGGCCTGGTTCCGCCAG GCTCCAGGGAAGGAGCGTGAGGGGGTCGCAGTCGTACACA GTGATAGTGGTGGCACATATTACGCCGACTCCGTGAAGGA ACGATTCATCATCGCCCAAGACAACGCCAAAAACACGGTG TATCTGACTATGAACAGCCTGAAAGTTGAGGACACGGCCA TCTATTACTGTGCGGCCAAAACCTTGGAAAAGCCACACTT CAGCGTCTTTTCCGCCGCGTCGTATGATTACTGGGGCCAG GGGACCCAGGTCACCGTCTCCTCA NCI-CoV-4C6 (SEQ ID NO: 72) CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTCGGTGCAGG CTGGGGAGTCTCTGAGACTTTCCTGTGCAGTTTCTGGAAT CAGCTCAAGTACGCACTATATGGCATGGTTCCGCCAGCTT CCAGGAAAGGAGCGCGAGGGCCTCGCCAACATTTATACTC CGGCTAAAGTCTCACTCTATGCCAACGACGTGAAGGGCCG ATTCACCATCTCCCAAGACGTCACCAAGAACACGGTGTAT CTGCAAATGAACAGCCTGAAACCTGAGGACACTGCCATGT ACTATTGTGCAGCGCGACGGAATGCTGTCTGTAATGCGGG CTCTCCGCTGGATTTTGAGTTTAGTTATTGGGGCCAGGGG ACCCAGGTCACCGTCTCCTCA NCI-CoV-2D4 (SEQ ID NO: 73) GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTCGGTGCAGG CTGGAGGGTCTCTGAGACTCTCTTGTGCAGCCTCTGCAGT CACCTCTAATACCAACTACGTGGGCTGGCTCCGCCAGGTT CCAGGAAAGGAGCGCGAGGGAGTCGCAGGCATTTATTACG ATGGTGGTGTATACTATGACGAATCCGTGAAGGGCCGATT CACCATCTCCCGAGACAACGCCCAGAACACGGTGTTTCTT CAAATGAACAGCCTGAAACCTGAGGACACTGCGATGTACT ACTGTGGAGCGGGCAGGGGGTACCGCTATCAGTACGGTAG TGCATGGTACAAACCTGGCCAATATCACTACTGGGGCCAG GGGACCCAGGTCACCGTCTCCTCA NCI-CoV-2A10 (SEQ ID NO: 74) CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTCGGTGCAGG CTGGTGGGTCTCTGAGACTCTCCTGTGCAATGTCTGGATT ACGTGTGAGTAACCGCTGCATGGGCTGGTTCCGCCAGGCT CCAGGGAAGGAGCGCGAGGGGGTCGCCACTATTTGTATTG GTGATGGTAGTACAGCCTATGCCGACTCCGTGAAGGGCCG ATTCACCATCTCCCAAGACAACGCCAAGACAACGGTCTTT CTGGAAATGAACAGCCTGAAACCTGAGGATACTGCCATGT ACTCCTGTGCAAGGGCAGTGAGGGCAACGGCGGCGACGCT CGATCCAGGCAACTTTTTTTATTGGGGCCAGGGGACCCAG GTCACCGTCTCCTCA NCI-CoV-3E5 (SEQ ID NO: 75) GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTGCAGC CTGGGGGGTCTCTGAGACTCTCCTGTGCAGCCTCTGGATT CGCCTTCAGCAGTACCCGGATGCACTGGGTCCGCCAGGCT CCAGGGGTGGGGCTCGAGTGGGTCTCGTTTATTGATCGGA CTGATGGTGGGATCATATCGTATGCAGACTCAGTGCGGGG CCGATTCACCATCTCTAGAGACAACGCCAAGAACACGGTG TATTTGCAAATGGATAGGCTGAACGCTGAGGACACGGCCG TGTATTACTGTCTGAAAGAAGGGCCCTATTTGGACTACTG GGACGCCTGGGGCCAGGGGACCCAGGTCACCGTCTCCTCA NCI-CoV-3E8 (SEQ ID NO: 76) CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTGCAGG CTGGGGGGTCTCTGAGACTCTCCTGTGCAACATCTGGCTT CACCTTCAGTGGCGGCTACATGGCGTGGGTCCGCCAGGTT CCAGGGAAGGGCCTGGAATGGGTGGCCAACAGTATTTATG ATGGTTCGACATACTATTCCGACGCCGTGAAGGGGCGATT CACCGTCTCCCAAGACAACGCCGAGAACACGGTCTATCTG GAAATGAACAGCCTCGAACCTGAGGACACTGCCATGTACT ACTGTGCAGCAGGGTGGAACGGTGGTCCCTGGTCCCGCAC AAATGCGTATATCTACTGGGGCCAGGGGACCCAGGTCACC GTCTCCTCA NCI-CoV-1H8 (SEQ ID NO: 77) CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTGCAGC CTGGGGGGTCTCTGAGACTCTCCTGTGCAGCCTCTGGATT CACATTCAGTAGCTACGACATGACCTGGGTCCGCCAGGCT CCAGGGAAGGGGCTCGAGTGGGTCGCAGCTATTTATACTG CTGATGGGAGCACATACTTGGACGACTCCGTGAAGGGCCG ATTCACCATCTCCCAAGACAACGCCAAGAAAACGTTGTAT CTGCAAATGACAAGTCTGAAAGTAGAAGACACTGCCAAAT ACACCTGTGCGACAGGGGTAGGAGGTTCGTTTTCGAACTG GGGCCGGGGGACCCAGGTCACCGTCTCCTCA NCI-CoV-1A7 (SEQ ID NO: 78) CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTGCAGC CTGGGGGGTCTCTGAGACTCTCCTGTGTAGCCTCTGGATT CACATTCAGTAGCGTTGACATGAGCTGGGTCCGCCAGGAT CCACGGAAGGGGCTCGAGTGGGTCTCAGGTATTAATAGTG GTGGTGGTAGTACAAGCTATGCAGACTCCGTGAAGGGCCA ATTTACCATCTCCAGAGACAACGCCAAGAACACGCTGTAT CTAGAAATGAACAATTTGAAACCTGAGGACACTGCCGTCT ATTACTGTGCCACAGGGCTCGCGGCTTCGGGGGTCTGGGG CCAGGGGACCCAGGTCACCGTCTCCTCA NCI-CoV-2F5 (SEQ ID NO: 79) CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTGCAGC CTGGGGGGTCTCTGAAACTCTCCTGTACAGCCTCTGGATT CACCTTCAGTTCCTACAACATGAGTTGGGTCCGCCAGGCT CCAGGGAAGGGGCTGAAGTGGGTGTCCATGATTCGTAGTG ATGGTAGTAACACATACTATCTAGACTCCGTGAAGGGCCG ATTCACCATCTCCAGAGACAATGCCAAGAACACGGTGTAT CTGCAAATGAACAGCCTGGAACCTGGGGACACGGCCGTGT ATTACTGCGTTGCGGGCCGACACGCGACATACTGGGGCCA GGGGACCCAGGTCACCGTCTCCTCA NCI-CoV-1D7 (SEQ ID NO: 80) CAGGTAAAGCTGGAGGAGTCTGGGGGAGGCTTGGTGCAGC CTGGGGGGTCTCTGAAACTCTCCTGTACAGCCTCTGGATT CACCTTCAGTTCCTACAACATGAGTTGGGTCCGCCAGGCT CCAGGGAAGGGGCTGAAGTGGGTGTCCATGATTCGTAGTG ATGGTAGTAACACATACTATCTAGACTCCGTGAAGGGCCG ATTCACCATCTCCAGAGACAATGCCAAGAACACGGTGTAT CTGCAAATGAACAGCCTGGAACCTGGGGACACGGCCGTGT ATTACTGCGTTGCGGGCCGACACGCGACATACTGGGGCCA GGGGACCCAGGTCACCGTCTCCTCA NCI-CoV-7A5 (SEQ ID NO: 81) GCGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTGCAGC CTGGGGGGTCTCTGAGACTCTCCTGTGCAGCCTCTGGATT CACCTTCAGTAGCTACTACATGAGCTGGGTCCGCCAGGCT CCAGGGAAGGGGCTCGAGTGGGTCTCAACTATTAATAGTC GTGGTAGTAGCACATACTATGCAGACTCCGTGAAGGGCCG ATTCACCATCTCCAGAGACAACGCCAAGAACACGCTGTAT CTGCAAATGAGCAGCCTGAAATCTGAGGACACGGCCCTGT ATTACTGTGCCATAGGACGCCTATATAGTGTTAAGGGCCA GGGGACCCAGGTCACCGTCTCCTCA NCI-CoV-7C4 (SEQ ID NO: 82) GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTGCAGC CTGGGGGGTCTCTGAGACTCTCCTGTACAGCCTCTGGATT CACATTCAGTAGCTACGACATGAGCTGGGTCCGCCAGGCT CCAGGGAAGGGGCTCGAGTGGGTCTCAGGTATTAATAGTG GTGGTAATAAAATATATTATGCAGACTCCGTGAAGGGCCG ATTCACCATCTCCAGAGACAACGCCAAGAACACGCTGTAT CTGCAAATGAGCAGCCTGAAATCTGAGGACACGGCCCTGT ATTACTGTGCCATAGGACGCCTATATAGTGTTAAGGGCCA GGGGACCCAGGTCACCGTCTCCTCA NCI-CoV-7E5 (SEQ ID NO: 83) GCGGTGCAGCTGGTGGAGTCTGGGGGAGGCTCGGTGCAGG CTGGAGGGTCTCTGAGACTCTCCTGTGCAGCCTCTGGATA CACCTACAGTAGCAACTACATGGGCTGGTTCCGCCAGGCT CCAGGGAAGGAGCTGGAGTGGGTGTCCGGTATTTATAGTG ATGGTAGGACATACTATGGAGACTCGGTGAAGGGCCGATT CACCATCTCCAGAGACAACGCCAAGAATACGGTGTATCTG CAAATGAACAGCCTGAAACCTGAGGACACTGCCATGTACT ACTGTGCAGCGGGTAGCTGGTACAACCAGTGGGGTTACAG TATGGACTACTGGGGCAAAGGGACCCAGGTCACCGTCTCC TCA NCI-CoV-7E7 (SEQ ID NO: 84) GCCGTGCAGCTGGTGGATTCTGGGGGAGGCTCGGTGCAGT CTGGAGGGTCTCTGAGACTCTCCTGTGTAGCCTCCGGATA CACCTACAGTATCTACAACATGGGCTGGTTCCGCCAGGCT CCAGGGAAGGGGCTGGAGTGGGTGTCCGGTATTAATAGTG ATGGTAGTAACACATACTATGCAGACTCCGTGAAGGGCCG ATTCACCATCTCCAGAGACAACGCCAAGAACACGCTGTAT CTGCAAATGAACAGCCTGAAATCTGAGGACACGGCCCTGT ATTACTGTGCCACCCTACCCATTTGTAGTGGTGGTTACTG CCCGCCCGGCTACTGGGGCCAGGGGACCCAGGTCACCGTC TCCTCA NCI-CoV-8A1 (SEQ ID NO: 85) CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTCGGTGCAGG CTGGAGGGTCTCTGAGACTCTCCTGTGCAGCCTCTGGATT CACCTTCAGTAGCTACTTTATGACCTGGGTCCGCCAGGCT CCAGGGAAAGGGCTGGAGTGGGTGTCCACTATTAATAGTG ATGGTAGTAACACATACTATGCAGACTCCGTGAAGGGCCG ATTCACCATCTCCAGAGACAACGCCAAGAACACGCTGTAT CTGCAAATGAACAGCCTGAAACCTGAGGACACGGCCATGT ATTACTGTAACTTCCGACGTATGATAGGCACAAGCAATTT GAACTACTGGGGCCAGGGGACCCAGGTCACCGTCTCCTCA NCI-CoV-8B6 (SEQ ID NO: 86) GCCGTGCAGCTGGTGGATTCTGGGGGAGGCTCGGTGCAGG CTGGAGGGTCTCTGAGACTCTCCTGTGCAGCCTCTGGAAT TACCTACAGTACTAACTGCATGGGCTGGTTCCGCCAGGCT CCAGGGAAGGGGCTGGAGTGGGTGTCCGGTATTAATAGCG ATGGCAGAAACACATACTATGCAGACTCCGTGAAGGGGCG ATTCACCATCTCCCAAGACAACGCCAAGAACACGGTGTAT CTGCAAATGAACAGCCTGAAACCTGAGGACACTGCCATGT ACTACTGTGCAGCGGGTAGCTGGTACAACCAGTGGGGTTA CAGTATGGACTACTGGGGCCAGGGGACCCAGGTCACCGTC TCCTCA NCI-CoV-8E1 (SEQ ID NO: 87) GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTCGGTGCAGG CTGGAGGGTCTCTGAGACTCTCCTGTGCAGCCTCTGGATT CACCTTCAGTAGCTACTACATGAGCTGGGTCCGCCAGGCT CCAGGGAAGGGGCTGGAGTGGGTGTCCGGTATTTATAGTG ATGGTAGCACATACTATGGAGACTCGGTGAAGGGCCGATT CACCATCTCCAGAGACAACGCCAAGAACACGCTGTATCTG CAAATGAACAGCCTGAAATCAGAGGACACGGCCCTGTATT ACTGTGCCATCGGGACCGGTACTACCCGTCAGGGCCAGGG GACCCAGGTCACCGTCTCCTCA NCI-CoV-8G12 (SEQ ID NO: 88) GCCGTGCAGCTGGTGGATTCTGGGGGAGGCTCGGTGCAGG CTGGAGGGTCTCTGAGACTCTCCTGTGCAGCCTCTGGATA CACCAGCAATATGAACCACATGGGCTGGTTCCGCCAGGCT CCAGGGAAGGGGCTGGAGTGGGTGTCCGGTATTTATAGTG ATGGTAGCACATACTATGGAGACTCGGTGAAGGGCCGATT CACCATCTCCAGAGACAACGCCAAGAACATGCTGTATCTG CAAATGAACAACCTGAAACCTGAGGACACGGCCGTGTATT ATTGTTCAGGAGACGGGGGGGGAATTGGGTATAACTACTG GGGCCAGGGGACCCAGGTCACCGTCTCCTCA

[0298] The genetic code can be used to construct a variety of functionally equivalent nucleic acid sequences, such as nucleic acids that differ in their sequence but which encode the same antibody sequence, or encode a conjugate or fusion protein including the V.sub.HH sequence. In some examples, the nucleic acid sequence is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to any one of SEQ ID NOs: 60-88. In some examples, the nucleic acid sequence comprises or consists of any one of SEQ ID NOs: 60-88, or a degenerate variant thereof.

[0299] Nucleic acid molecules encoding the antibodies, fusion proteins, and conjugates that specifically bind to a coronavirus spike protein can be prepared by any suitable method including, for example, cloning of appropriate sequences or by direct chemical synthesis by standard methods. Chemical synthesis produces a single stranded oligonucleotide. This can be converted into double stranded DNA by hybridization with a complementary sequence or by polymerization with a DNA polymerase using the single strand as a template.

[0300] Exemplary nucleic acids can be prepared by cloning techniques. Examples of appropriate cloning and sequencing techniques can be found, for example, in Green and Sambrook (Molecular Cloning: A Laboratory Manual, 4.sup.th ed., New York: Cold Spring Harbor Laboratory Press, 2012) and Ausubel et al. (Eds.) (Current Protocols in Molecular Biology, New York: John Wiley and Sons, including supplements).

[0301] Nucleic acids can also be prepared by amplification methods. Amplification methods include the polymerase chain reaction (PCR), the ligase chain reaction (LCR), the transcription-based amplification system (TAS), and the self-sustained sequence replication system (3SR).

[0302] The nucleic acid molecules can be expressed in a recombinantly engineered cell such as in bacterial, plant, yeast, insect and mammalian cells. The antibodies and conjugates can be expressed as individual proteins including the V.sub.HH (linked to an effector molecule or detectable marker as needed), or can be expressed as a fusion protein. Any suitable method of expressing and purifying antibodies and antigen binding fragments may be used; non-limiting examples are provided in Al-Rubeai (Ed.), Antibody Expression and Production, Dordrecht; New York: Springer, 2011).

[0303] One or more DNA sequences encoding the antibodies, fusion proteins, or conjugates can be expressed in vitro by DNA transfer into a suitable host cell. The cell may be prokaryotic or eukaryotic. Numerous expression systems available for expression of proteins including E. coli, other bacterial hosts, yeast, and various higher eukaryotic cells, for example mammalian cells, such as the COS, CHO, HeLa and myeloma cell lines, can be used to express the disclosed antibodies and antigen binding fragments. Methods of stable transfer, meaning that the foreign DNA is continuously maintained in the host may be used.

[0304] The expression of nucleic acids encoding the antibodies and conjugates described herein can be achieved by operably linking the DNA or cDNA to a promoter (which is either constitutive or inducible), followed by incorporation into an expression cassette. The promoter can be any promoter of interest, including a cytomegalovirus promoter. Optionally, an enhancer, such as a cytomegalovirus enhancer, is included in the construct. The cassettes can be suitable for replication and integration in either prokaryotes or eukaryotes. Typical expression cassettes contain specific sequences useful for regulation of the expression of the DNA encoding the protein. For example, the expression cassettes can include appropriate promoters, enhancers, transcription and translation terminators, initiation sequences, a start codon (i.e., ATG) in front of a protein-encoding gene, splicing signals for introns, sequences for the maintenance of the correct reading frame of that gene to permit proper translation of mRNA, and stop codons. The vector can encode a selectable marker, such as a marker encoding drug resistance (for example, ampicillin or tetracycline resistance).

[0305] To obtain high level expression of a cloned gene, it is desirable to construct expression cassettes which contain, for example, a strong promoter to direct transcription, a ribosome binding site for translational initiation (e.g., internal ribosomal binding sequences), and a transcription/translation terminator. For E. coli, this can include a promoter such as the T7, trp, lac, or lambda promoters, a ribosome binding site, and a transcription termination signal. For eukaryotic cells, the control sequences can include a promoter and/or an enhancer derived from, for example, an immunoglobulin gene, HTLV, SV40 or cytomegalovirus, and a polyadenylation sequence, and can further include splice donor and/or acceptor sequences (for example, CMV and/or HTLV splice acceptor and donor sequences). The cassettes can be transferred into the chosen host cell by any suitable method such as transformation or electroporation for E. coli and calcium phosphate treatment, electroporation or lipofection for mammalian cells. Cells transformed by the cassettes can be selected by resistance to antibiotics conferred by genes contained in the cassettes, such as the amp, gpt, neo and hyg genes.

[0306] Modifications can be made to a nucleic acid encoding an antibody described herein without diminishing its biological activity. Some modifications can be made to facilitate the cloning, expression, or incorporation of the antibody into a fusion protein. Such modifications include, for example, termination codons, sequences to create conveniently located restriction sites, and sequences to add a methionine at the amino terminus to provide an initiation site, or additional amino acids (such as poly His) to aid in purification steps.

[0307] Once expressed, the antibodies, fusion proteins, and conjugates can be purified according to standard procedures in the art, including ammonium sulfate precipitation, affinity columns, column chromatography, and the like (see, generally, Simpson et al. (Eds.), Basic methods in Protein Purification and Analysis: A Laboratory Manual, New York: Cold Spring Harbor Laboratory Press, 2009). The antibodies, fusion proteins, and conjugates need not be 100% pure. Once purified, partially or to homogeneity as desired, if to be used prophylactically, the antibodies should be substantially free of endotoxin.

[0308] Methods for expression of antibodies, fusion proteins, and conjugates, and/or refolding to an appropriate active form, from mammalian cells, and bacteria such as E. coli have been described and are applicable to the antibodies disclosed herein. See, e.g., Greenfield (Ed.), Antibodies: A Laboratory Manual, 2.sup.nd ed. New York: Cold Spring Harbor Laboratory Press, 2014, Simpson et al. (Eds.), Basic methods in Protein Purification and Analysis: A Laboratory Manual, New York: Cold Spring Harbor Laboratory Press, 2009, and Ward et al., Nature 341(6242):544-546, 1989.

X. Compositions

[0309] Compositions are provided that include one or more of the disclosed polypeptides (such as monoclonal antibodies) that bind (for example specifically bind) coronavirus spike protein in a carrier. Also provided are compositions that include one or more of the disclosed antibody coding sequences (which may be part of a vector, such as a plasmid or viral vector). Compositions comprising fusion proteins (such as V.sub.HH-Fc fusion proteins or nanobodies in IgG, IgA or IgM format), ADCs, CARs (and immune cells expressing CARs), multi-specific (such as bispecific or trispecific) antibodies, antibody-nanoparticle conjugates, immunoliposomes and immunoconjugates are also provided, as are nucleic acid molecule and vectors encoding the antibodies or antibody conjugates. The compositions can be prepared in unit dosage form for administration to a subject. The amount and timing of administration are at the discretion of the treating clinician to achieve the desired outcome. The polypeptide, nucleic acid molecule, antibody, fusion protein, ADC, CAR, CAR-expressing cell, multi-specific antibody, antibody-nanoparticle conjugate, immunoliposome or immunoconjugate can be formulated for systemic or local administration. In one example, the composition is formulated for inhalation administration. In one example, the composition is formulated for intravenous administration. In one example, the composition is lyophilized. In another example, the composition is formulated for oral administration. For example, a composition can include yeast or bacteria formulated to express a disclosed polypeptide (such as a single-domain monoclonal antibody).

[0310] In some embodiments, the composition includes more than one S protein-specific single-domain monoclonal antibody disclosed herein, such as 2, 3, 4 or 5 antibodies. In particular examples, the composition includes: a single-domain monoclonal antibody having the CDR sequences of nanobody 7A3 (SEQ ID NO: 2) and a single-domain monoclonal antibody having the CDR sequences of nanobody 2F7 (SEQ ID NO: 3); a single-domain monoclonal antibody having the CDR sequences of nanobody 7A3 (SEQ ID NO: 2) and a single-domain monoclonal antibody having the CDR sequences of nanobody 8A4 (SEQ ID NO: 4); or a single-domain monoclonal antibody having the CDR sequences of nanobody 1B5 (SEQ ID NO: 1) and a single-domain monoclonal antibody having the CDR sequences of nanobody 2F7 (SEQ ID NO: 3);

[0311] or a single-domain monoclonal antibody having the CDR sequences of nanobody 7A3 (SEQ ID NO: 2) and a single-domain monoclonal antibody having the CDR sequences of nanobody 1H6 (SEQ ID NO: 5).

[0312] The compositions for administration can include a solution of the antibody, fusion protein, ADC, CAR, CAR-expressing cell (such as a T cell, NK cell, iPSC, or macrophage), multi-specific (such as bispecific or trispecific) antibody, antibody-nanoparticle conjugate, immunoliposome or immunoconjugate in a pharmaceutically acceptable carrier, such as an aqueous carrier. A variety of aqueous carriers can be used, for example, buffered saline and the like. These solutions are sterile and generally free of undesirable matter. These compositions may be sterilized by conventional, well known sterilization techniques. The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, toxicity adjusting agents and the like, for example, sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate and the like. The concentration of antibody in these formulations can vary, and can be selected based on fluid volumes, viscosities, body weight and the like in accordance with the particular mode of administration selected and the subject's needs.

[0313] An exemplary pharmaceutical composition for intravenous administration includes about 0.1 to 10 mg of antibody (or fusion protein, ADC, CAR, multi-specific antibody, antibody-nanoparticle conjugate, or immunoconjugate) per subject per day. Dosages from 0.1 up to about 100 mg per subject per day may be used, particularly if the agent is administered to a secluded site and not into the circulatory or lymph system, such as into a body cavity or into a lumen of an organ. In some embodiments, the composition can be a liquid formulation including one or more antibodies in a concentration range from about 0.1 mg/ml to about 20 mg/ml, or from about 0.5 mg/ml to about 20 mg/ml, or from about 1 mg/ml to about 20 mg/ml, or from about 0.1 mg/ml to about 10 mg/ml, or from about 0.5 mg/ml to about 10 mg/ml, or from about 1 mg/ml to about 10 mg/ml. Actual methods for preparing administrable compositions will be known or apparent to those skilled in the art and are described in more detail in such publications as Remington: The Science and Practice of Pharmacy, The University of the Sciences in Philadelphia, Editor, Lippincott, Williams, & Wilkins, Philadelphia, PA, 21.sup.st Edition (2005).

[0314] The monoclonal antibodies disclosed herein can also be administered by other routes, including via inhalation or orally, such as by oral administration of yeast or bacteria (e.g., Lactococcus lactis) engineered to express a disclosed antibody (see, e.g., Vandenbroucke et al., Mucosal Immunol 3(1):49-56, 2010).

[0315] Antibodies (or antibody conjugates, or nucleic acid molecules encoding such molecules) may be provided in lyophilized form and rehydrated with sterile water before administration, although they are also provided in sterile solutions of known concentration. The antibody solution can be added to an infusion bag containing 0.9% sodium chloride, USP, and in some cases administered at a dosage of from 0.5 to 15 mg/kg of body weight. Considerable experience is available in the art in the administration of antibody drugs, which have been marketed in the U.S. since the approval of RITUXAN™ in 1997. Antibodies, Fc fusion proteins, ADCs, CARs (or CAR-expressing cells), multi-specific (such as bispecific or trispecific) antibodies, antibody-nanoparticle conjugates, immunoliposomes or immunoconjugates can be administered by slow infusion, rather than in an intravenous push or bolus. In one example, a higher loading dose is administered, with subsequent, maintenance doses being administered at a lower level. For example, an initial loading dose of 4 mg/kg may be infused over a period of some 90 minutes, followed by weekly maintenance doses for 4-8 weeks of 2 mg/kg infused over a 30-minute period if the previous dose was well tolerated.

[0316] Controlled release parenteral formulations can be made as implants, oily injections, or as particulate systems. For a broad overview of protein delivery systems see, Banga, A. J., Therapeutic Peptides and Proteins: Formulation, Processing, and Delivery Systems, Technomic Publishing Company, Inc., Lancaster, PA, (1995). Particulate systems include, for example, microspheres, microparticles, microcapsules, nanocapsules, nanospheres, and nanoparticles. Microcapsules contain the therapeutic protein, such as a cytotoxin or a drug, as a central core. In microspheres the therapeutic is dispersed throughout the particle. Particles, microspheres, and microcapsules smaller than about 1 μm are generally referred to as nanoparticles, nanospheres, and nanocapsules, respectively. Capillaries have a diameter of approximately 5 μm so that only nanoparticles are administered intravenously. Microparticles are typically around 100 pm in diameter and are administered subcutaneously or intramuscularly. See, for example, Kreuter, J., Colloidal Drug Delivery Systems, J. Kreuter, ed., Marcel Dekker, Inc., New York, NY, pp. 219-342 (1994); and Tice & Tabibi, Treatise on Controlled Drug Delivery, A. Kydonieus, ed., Marcel Dekker, Inc. New York, NY, pp. 315-339, (1992).

[0317] Polymers can be used for ion-controlled release of the antibody-based compositions disclosed herein. Various degradable and nondegradable polymeric matrices for use in controlled drug delivery are known (Langer, Accounts Chem. Res. 26:537-542, 1993). For example, the block copolymer, polaxamer 407, exists as a viscous yet mobile liquid at low temperatures but forms a semisolid gel at body temperature. It is an effective vehicle for formulation and sustained delivery of recombinant interleukin-2 and urease (Johnston et al., Pharm. Res. 9:425-434, 1992; and Pec et al., J. Parent. Sci. Tech. 44(2):58-65, 1990). Alternatively, hydroxyapatite has been used as a microcarrier for controlled release of proteins (Ijntema et al., Int. J. Pharm.112:215-224, 1994). In yet another aspect, liposomes are used for controlled release as well as drug targeting of the lipid-capsulated drug (Betageri et al., Liposome Drug Delivery Systems, Technomic Publishing Co., Inc., Lancaster, PA (1993)). Numerous additional systems for controlled delivery of therapeutic proteins are known (see U.S. Pat. Nos. 5,055,303; 5,188,837; 4,235,871; 4,501,728; 4,837,028; 4,957,735; 5,019,369; 5,055,303; 5,514,670; 5,413,797; 5,268,164; 5,004,697; 4,902,505; 5,506,206; 5,271,961; 5,254,342 and 5,534,496).

XI. Therapeutic Methods

[0318] Methods are disclosed herein for the reduction or inhibition of a coronavirus infection in a subject, such as a SARS-CoV and/or a SARS-CoV-2 infection. The methods include administering to the subject a therapeutically effective amount (that is, an amount effective to reduce or inhibit the infection in the subject) of a disclosed antibody, fusion protein, ADC, CAR, CAR-expressing cell (such as a T cell, NK cell, macrophage or iPSC), multi-specific (such as bispecific or trispecific) antibody, antibody-nanoparticle conjugate, immunoliposome or immunoconjugate, or a nucleic acid encoding such an antibody or antibody conjugate, to a subject at risk of a coronavirus infection or having the coronavirus infection. The methods can be used pre-exposure or post-exposure.

[0319] The infection does not need to be completely eliminated or inhibited for the method to be effective. For example, the method can decrease the infection by a desired amount, for example by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, at least 99%, or even 100% (elimination or prevention of detectable coronavirus infection) as compared to the coronavirus infection in the absence of the treatment. In some embodiments, the subject can also be treated with an effective amount of an additional agent, such as an anti-viral agent.

[0320] In some embodiments, administration of a therapeutically effective amount of a disclosed antibody, fusion protein, ADC, CAR, CAR-expressing cell (such as a T cell, NK cell, macrophage or iPSC), multi-specific (such as bispecific or trispecific) antibody, antibody-nanoparticle conjugate, immunoliposome or immunoconjugate, or nucleic acid molecule or vector encoding such molecules, inhibits the establishment of an infection and/or subsequent disease progression in a subject, which can encompass any statistically significant reduction in activity (for example, virus replication) or symptoms of the coronavirus infection in the subject (such as fever or cough).

[0321] Methods are disclosed herein for the inhibition of coronavirus replication in a subject, such as inhibition of SARS-CoV-2 or SARS-CoV replication. In specific examples, the method can reduce or inhibit replication of more than one type of SARS-CoV-2, such as native SARS-CoV-2 and one or more variants thereof, such as one or more of: alpha (B.1.1.7 and Q lineages); beta (B.1.351 and descendent lineages); delta (B.1.617.2 and AY lineages); gamma (P.1 and descendent lineages); epsilon (B.1.427 and B.1.429); eta (B.1.525); iota (B.1.526); kappa (B.1.617.1); 1.617.3; mu (B.1.621, B.1.621.1) and zeta (P.2). The methods include administering to the subject a therapeutically effective amount (that is, an amount effective to inhibit replication in the subject) of a disclosed antibody, antigen binding fragment, or a nucleic acid encoding such an antibody or antigen binding fragment, to a subject at risk of a coronavirus infection or having a coronavirus infection. In some examples, replication of SARS-CoV, SARS-CoV-2 (native and/or variants thereof), MERS-CoV, HKU1-CoV, OC43-CoV, 229E-CoV, or NL63-CoV is inhibited by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, at least 99%, or even 100% (elimination of detectable coronavirus infection). The methods can be used pre-exposure or post-exposure. In some embodiments, the subject is a human subject. In other embodiments, the subject is a non-human animal subject, such as a non-human primate, cat, dog, bank vole, ferret, fruit bat, hamster, mink, otter, pig, rabbit, racoon dog, tree shrew or deer.

[0322] Methods are disclosed for treating a coronavirus infection in a subject. Methods are also disclosed for preventing a coronavirus infection in a subject. These methods include administering one or more of the disclosed antibodies, fusion proteins, ADC, CAR, CAR-expressing cells (such as a T cell, NK cell, macrophage or iPSC), multi-specific (such as bispecific or trispecific) antibody, antibody-nanoparticle conjugate, immunoliposome or immunoconjugate, or nucleic acid molecule or vector encoding such molecules, or a composition including such molecules, as disclosed herein. In some examples, the coronavirus is SARS-CoV or SARS-CoV-2. In specific examples, the coronavirus is SARS-CoV-2 or SARS-CoV. In specific examples, the coronavirus is SARS-CoV-2 or a variant thereof, such as: alpha (B.1.1.7 and Q lineages); beta (B.1.351 and descendent lineages); delta (B.1.617.2 and AY lineages); gamma (P.1 and descendent lineages); epsilon (B.1.427 and B.1.429); eta (B.1.525); iota (B.1.526); kappa (B.1.617.1); 1.617.3; mu (B.1.621, B.1.621.1) or zeta (P.2). In some embodiments, the subject is a human subject. In other embodiments, the subject is a non-human animal subject, such as a non-human primate, cat, dog, bank vole, ferret, fruit bat, hamster, mink, otter, pig, rabbit, racoon dog, tree shrew or deer.

[0323] Antibodies can be administered, for example, by intravenous infusion. Doses of the antibody or conjugate thereof can vary, but generally range between about 0.5 mg/kg to about 50 mg/kg, such as a dose of about 1 mg/kg, about 5 mg/kg, about 10 mg/kg, about 20 mg/kg, about 30 mg/kg, about 40 mg/kg, or about 50 mg/kg. In some embodiments, the dose of the antibody or conjugate can be from about 0.5 mg/kg to about 5 mg/kg, such as a dose of about 1 mg/kg, about 2 mg/kg, about 3 mg/kg, about 4 mg/kg or about 5 mg/kg. The antibody or conjugate is administered according to a dosing schedule determined by a medical practitioner. In some examples, the antibody or conjugate is administered weekly, every two weeks, every three weeks or every four weeks.

[0324] In some embodiments, a subject is administered DNA or RNA encoding a disclosed antibody to provide in vivo antibody production, for example using the cellular machinery of the subject. Any suitable method of nucleic acid administration may be used; non-limiting examples are provided in U.S. Pat. Nos. 5,643,578, 5,593,972 5,817,637, 5,880,103 describes several methods of delivery of nucleic acids encoding proteins to an organism. One approach to administration of nucleic acids is direct administration with plasmid DNA, such as with a mammalian expression plasmid. The nucleotide sequence encoding the disclosed antibody, or antigen binding fragments thereof, can be placed under the control of a promoter to increase expression. The methods include liposomal delivery of the nucleic acids. Such methods can be applied to the production of an antibody, or antigen binding fragments thereof.

[0325] In several embodiments, a subject (such as a human subject at risk of a coronavirus infection or having a coronavirus infection) is administered an effective amount of a viral vector that includes one or more nucleic acid molecules encoding a disclosed antibody. The viral vector is designed for expression of the nucleic acid molecules encoding a disclosed antibody, and administration of the effective amount of the viral vector to the subject leads to expression of an effective amount of the antibody in the subject. Non-limiting examples of viral vectors that can be used to express a disclosed antibody or antigen binding fragment in a subject include those provided in Johnson et al., Nat. Med., 15(8):901-906, 2009 and Gardner et al., Nature, 519(7541):87-91, 2015, each of which is incorporated by reference herein in its entirety.

[0326] In one embodiment, a nucleic acid encoding a disclosed antibody, or conjugate thereof, is introduced directly into tissue. For example, the nucleic acid can be loaded onto gold microspheres by standard methods and introduced into the skin by a device such as Bio-Rad's HELIOS TM Gene Gun. The nucleic acids can be “naked,” consisting of plasmids under control of a strong promoter.

[0327] Typically, the DNA is injected into muscle, although it can also be injected directly into other sites. Dosages for injection are usually around 0.5 μg/kg to about 50 mg/kg, and typically are about 0.005 mg/kg to about 5 mg/kg (see, e.g., U.S. Pat. No. 5,589,466).

[0328] Single or multiple administrations of a composition including a disclosed antibody or antibody conjugate, or nucleic acid molecule encoding such molecules, can be administered depending on the dosage and frequency as required and tolerated by the patient. The dosage can be administered once, but may be applied periodically until either a desired result is achieved or until side effects warrant discontinuation of therapy. Generally, the dose is sufficient to inhibit a coronavirus infection without producing unacceptable toxicity to the patient.

[0329] Data obtained from cell culture assays and animal studies can be used to formulate a range of dosage for use in humans. The dosage normally lies within a range of circulating concentrations that include the ED.sub.50, with little or minimal toxicity. The dosage can vary within this range depending upon the dosage form employed and the route of administration utilized. The coronavirus spike protein-specific antibody, antibody conjugate, or nucleic acid molecule encoding such molecules, or a composition including such molecules, can be administered to subjects in various ways, including local and systemic administration, such as, e.g., by injection subcutaneously, intravenously, intra-arterially, intraperitoneally, intramuscularly, intradermally, or intrathecally. In some embodiments, the composition is administered by inhalation, such as by using an inhaler. In one embodiment, the antibody, antigen binding fragment, or nucleic acid molecule encoding such molecules, or a composition including such molecules, is administered by a single subcutaneous, intravenous, intra-arterial, intraperitoneal, intramuscular, intradermal or intrathecal injection once a day. The antibody, antigen binding fragment, bispecific antibody, conjugate, or nucleic acid molecule encoding such molecules, or a composition including such molecules, can also be administered by direct injection at or near the site of disease. A further method of administration is by osmotic pump (e.g., an Alzet pump) or mini-pump (e.g., an Alzet mini-osmotic pump), which allows for controlled, continuous and/or slow-release delivery of the antibody, antibody conjugate, or nucleic acid molecule encoding such molecules, or a composition including such molecules, over a pre-determined period. The osmotic pump or mini-pump can be implanted subcutaneously, or near a target site.

[0330] In one example, an S protein-specific polypeptide (such as antibody) provided herein is conjugated to IR700, and photoimmunotherapy is used to treat a coronavirus infection. For example, such a method can include administering to the subject with a coronavirus infection a therapeutically effective amount of one or more S protein-specific antibody-IR700 conjugates, wherein the S protein-specific antibody specifically binds to S protein on infected cells. Following administration of the conjugate, irradiation is performed at a wavelength of 660 to 740 nm (such as 660 to 710 nm, for example, 680 nm) and at a dose of at least 1 J cm.sup.−2, thereby treating the coronavirus infection in the subject. In some examples, the coronavirus infection is irradiated at a wavelength of 660 to 740 nm (such as 660 to 710 nm, for example, 680 nm) at a dose of at least 1 J cm.sup.−2 (such as at least 1 J cm.sup.−2, at least 4 J cm.sup.−2 at least 10 J cm.sup.−2, at least 50 J cm.sup.−2, or at least 100 J cm.sup.−2) thereby treating the coronavirus infection in the subject. In some examples, multiple rounds of treatment are performed, such as 2, 3, 4, 5, 6, 7, 8, 9 or 10 treatment cycles. In particular examples, a therapeutically effective dose of an S protein-specific antibody-IR700 conjugates is at least 0.5 milligram per 60 kilogram (mg/kg), at least 5 mg/60 kg, at least 10 mg/60 kg, at least 20 mg/60 kg, at least 30 mg/60 kg, at least 50 mg/60 kg, for example 0.5 to 50 mg/60 kg, such as a dose of 1 mg/60 kg, 2 mg/60 kg, 5 mg/60 kg, 20 mg/60 kg, or 50 mg/60 kg, for example when administered iv. In another example, a therapeutically effective dose of an S protein-specific antibody-IR700 conjugates is at least 10 μg/kg, such as at least 100 μg/kg, at least 500 μg/kg, or at least 500 μg/kg, for example 10 μg/kg to 1000 μg/kg, such as a dose of 100 μg/kg, 250 μg/kg, about 500 μg/kg, 750 μg/kg, or 1000 μg/kg, for example when administered i.p. In one example, a therapeutically effective dose of an S protein-specific antibody-IR700 conjugates is at least 1 μg/ml, such as at least 500 μg/ml, such as between 20 μg/ml to 100 μg/ml, such as 10 μg/ml, 20 μg/ml, 30 μg/ml, 40 μg/ml, 50 μg/ml, 60 μg/ml, 70 μg/ml, 80 μg/ml, 90 μg/ml or 100 μg/ml administered in a topical solution.

[0331] In some embodiments, the method of treating a coronavirus infection in a subject further includes administration of one or more additional agents to the subject. Additional agents of interest include, but are not limited to, anti-viral agents such as remdesivir, galidesivir, favipiravir, baricitinib, lopinavir/ritonavir, hydroxychloroquine, dexamethasone, molnupiravir (Merck), arbidol, zinc ions, and interferon beta-1b, or their combinations.

[0332] Kits are provided for treating or preventing coronavirus infection, such as SARS-CoV-2 infection. Kits for treating or preventing a coronavirus infection include a monoclonal antibody that specifically binds coronavirus S protein, such as one or more of the nanobodies disclosed herein. In some examples, such a kit includes a means for administering the antibody in the kit to a subject, such as a syringe, needle and/or nebulizer. In some examples, such a kit includes additional therapeutic agents, such as one or more additional anti-viral agents, such as remdesivir, galidesivir, favipiravir, baricitinib, lopinavir/ritonavir, hydroxychloroquine, dexamethasone, molnupiravir (Merck), arbidol, zinc ions, and/or interferon beta-1b.

XII. Methods for Diagnosis and Detection

[0333] Methods are also provided for the detection of the presence of a coronavirus spike protein in vitro or in vivo. For example, the disclosed nanobodies can be used for in vivo imaging to detect a coronavirus infection. To use the disclosed antibodies as diagnostic reagents in vivo, the antibodies are labelled with a detectable moiety, such as a radioisotope, fluorescent label, or positron emitting radionuclides. As one example, the nanobodies disclosed herein can be conjugated to a positron emitting radionuclide for use in positron emission tomography (PET); this diagnostic process is often referred to as immunoPET. While full length antibodies can make good immunoPET agents, their biological half-life necessitates waiting several days prior to imaging, which increases associated non-target radiation doses. Smaller, single domain antibodies/nanobodies, such as those disclosed herein, have biological half-lives amenable to same day imaging.

[0334] In some examples, the presence of a coronavirus spike protein is detected in a biological sample from a subject and can be used to identify a subject with a coronavirus infection. In some examples, the coronavirus is SARS-CoV-2 or SARS-CoV. The sample can be any sample, including, but not limited to, sputum, saliva, mucus, nasal wash, nasopharyngeal samples, oropharyngeal samples, peripheral blood, tissue, cells, urine, tissue biopsy, fine needle aspirate, surgical specimen, feces, cerebral spinal fluid (CSF), and bronchoalveolar lavage (BAL) fluid. Biological samples also include sections of tissues, for example, frozen sections taken for histological purposes. The method of detection can include contacting a cell or sample, with an antibody or antibody conjugate (e.g., a conjugate including a detectable marker) that specifically binds to a coronavirus spike protein, under conditions sufficient to form an immune complex, and detecting the immune complex (e.g., by detecting a detectable marker conjugated to the antibody or antigen binding fragment. In some embodiments, the subject from which the sample is obtained is a human subject. In other embodiments, the subject from which the sample is obtained is a non-human animal subject, such as a non-human primate, cat, dog, bank vole, ferret, fruit bat, hamster, mink, otter, pig, rabbit, racoon dog, tree shrew or deer.

[0335] In one embodiment, the antibody or antigen binding fragment is directly labeled with a detectable marker. In another embodiment, the antibody that binds the coronavirus spike protein (the primary antibody) is unlabeled and a secondary antibody or other molecule that can bind the primary antibody is utilized for detection. The secondary antibody that is chosen is able to specifically bind the specific species and class of the first antibody. For example, if the first antibody is a human IgG, then the secondary antibody may be an anti-human-IgG. Other molecules that can bind to antibodies include, without limitation, Protein A and Protein G, both of which are available commercially.

[0336] Suitable labels for the antibody or secondary antibody include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, magnetic agents and radioactive materials. Non-limiting examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase. Non-limiting examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin. Non-limiting examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin. A non-limiting exemplary luminescent material is luminol; a non-limiting exemplary a magnetic agent is gadolinium, and non-limiting exemplary radioactive labels include .sup.125I, .sup.131I, .sup.35S or .sup.3H.

[0337] In an alternative embodiment, S protein can be assayed in a biological sample by a competition immunoassay utilizing S protein standards labeled with a detectable substance and an unlabeled antibody that specifically binds S protein. In this assay, the biological sample, the labeled S protein standards and the antibody that specifically bind S protein are combined and the amount of labeled S protein standard bound to the unlabeled antibody is determined. The amount of S protein in the biological sample is inversely proportional to the amount of labeled S protein standard bound to the antibody that specifically binds S protein.

[0338] The immunoassays and methods disclosed herein can be used for a number of purposes. In one embodiment, the antibody that specifically binds coronavirus S protein may be used to detect the production of S protein in cells in cell culture. In another embodiment, the antibody can be used to detect the amount of S protein in a biological sample, such as a sample obtained from a subject having or suspected or having a coronavirus infection.

[0339] In one embodiment, a kit is provided for detecting coronavirus S protein in a biological sample, such as a nasopharyngeal, oropharyngeal, sputum, saliva, or blood sample. Kits for detecting a coronavirus infection include a monoclonal antibody that specifically binds coronavirus S protein, such as one or more of the nanobodies disclosed herein. In a further embodiment, the antibody is labeled (for example, with a fluorescent, radioactive, or an enzymatic label).

[0340] In one embodiment, a kit includes instructional materials disclosing means of use of an antibody that binds coronavirus S protein. The instructional materials may be written, in an electronic form or may be visual (such as video files). The kits may also include additional components to facilitate the particular application for which the kit is designed. Thus, for example, the kit may additionally contain means of detecting a label (such as enzyme substrates for enzymatic labels, filter sets to detect fluorescent labels, appropriate secondary labels such as a secondary antibody, or the like). The kits may additionally include buffers and other reagents routinely used for the practice of a particular method. Such kits and appropriate contents are well known to those of skill in the art.

[0341] In one embodiment, the diagnostic kit comprises an immunoassay. Although the details of the immunoassays may vary with the particular format employed, the method of detecting S protein in a biological sample generally includes the steps of contacting the biological sample with an antibody which specifically reacts, under immunologically reactive conditions, to coronavirus S protein. The antibody is allowed to specifically bind under immunologically reactive conditions to form an immune complex, and the presence of the immune complex (bound antibody) is detected directly or indirectly.

[0342] The antibodies disclosed herein can also be utilized in immunoassays, such as, but not limited to radioimmunoassays (RIAs), ELISA, lateral flow assay (LFA), or immunohistochemical assays. The antibodies can also be used for fluorescence activated cell sorting (FACS), such as for identifying/detecting virus-infected cells. FACS employs a plurality of color channels, low angle and obtuse light-scattering detection channels, and impedance channels, among other more sophisticated levels of detection, to separate or sort cells (see U.S. Pat. No. 5,061,620). Any of the monoclonal antibodies that bind S protein, as disclosed herein, can be used in these assays. Thus, the antibodies can be used in a conventional immunoassay, including, without limitation, ELISA, RIA, LFA, FACS, tissue immunohistochemistry, Western blot or immunoprecipitation. The disclosed nanobodies can also be used in nanotechnology methods, such as microfluidic immunoassays, which can be used to capture SARS-CoV and/or SARS-CoV-2, or exosomes containing these viruses. Suitable samples for use with a microfluidic immunoassay or other nanotechnology method, include but are not limited to, saliva, blood, and fecal samples. Microfluidic immunoassays are described in U.S. Patent Application No. 2017/0370921, 2018/0036727, 2018/0149647, 2018/0031549, 2015/0158026 and 2015/0198593; and in Lin et al., JALA June 2010, pages 254-274; Lin et al., Anal Chem 92: 9454-9458, 2020; and Herr et al., Proc Natl Acad Sci USA 104(13): 5268-5273, 2007, all of which are herein incorporated by reference).

[0343] The method can also include the use of an assay that distinguishes between SARS-CoV and SARS-CoV-2 as some of the disclosed nanobodies only bind to SARS-CoV-2 RBD but not the SARS-CoV RBD, and some isolated mAbs bind to both SARS-CoV RBD and SARS-CoV-2 RBD. In some embodiments, a comparison is made between the binding of a sample to an antibody that binds SARS-CoV RBD and SARS-CoV-2 RBD, and the binding of a sample to an antibody that binds only the SARS-CoV-2 RBD but not the SARS-CoV RBD. If both antibodies bind the sample, then the sample is from a subject infected with SARS-CoV-2. If only the antibody that binds both SARS-CoV RBD and SARS-CoV-2 RBD binds the sample, then the sample is from a subject infected with SARS-CoV.

[0344] The following examples are provided to illustrate certain particular features and/or embodiments. These examples should not be construed to limit the disclosure to the particular features or embodiments described.

EXAMPLES

[0345] SARS-CoV-2 infects human cells by binding angiotensin converting enzyme-2 (ACE2) via the receptor-binding domain (RBD) of the viral spike protein. Single domain antibodies (also called “nanobodies”) can recognize unusual sites on the protein surface including cavities or grooves, where standard antibodies with heavy and light chains may not be capable of accessing, providing an alternative approach for discovery of novel neutralizing antibodies against viruses. This example describes V.sub.HH single domain phage display libraries constructed from 3 male and 3 female camels (Camelus dromedaries) with ages ranging from 3 months to 20 years and isolation of 29 nanobodies against the RBD and SARS-CoV-2 spike homotrimer protein as the targeting antigens. Several nanobodies, including NCI-CoV-7A3 (7A3), NCI-CoV-1B5 (1B5), NCI-CoV-2F7 (2F7), NCI-CoV-8A4 (8A4) and NCI-CoV-1H6 (1H6), were identified as potent ACE2 blockers that inhibit the interaction between SARS-CoV-2 RBD and ACE2. In addition, 1B5 was identified as a cross-reactive nanobody that binds spike proteins derived from both SARS-CoV-2 and SARS-CoV. Several of the disclosed nanobodies are capable of binding multiple variants of SARS-CoV-2, including 1B5, 7A3 and 8A2. Neutralization assays using SARS-CoV-2 spike-expressing pseudovirus showed that 7A3, 8A2, 1B5, 2F7, 8A4 and 1H6 V.sub.HH nanobodies potently protect host cells from virus infection with an IC.sub.50 value of 5-7 nM (for 7A3, 8A2 and 1B5). The nanobodies disclosed herein are drug candidates for the prevention and treatment of COVID-19.

Example 1

Isolation of Camel Vail Single Domain Antibodies that Bind the RBD of the SARS-CoV-2 S Protein

[0346] Phage panning was carried out using two sets of camel single domain libraries (FIG. 1A). The camel V.sub.HH single domain phage libraries were constructed from six individual camels, 3 male and 3 female, with ages ranging from 3 months to 20 years. Phage panning was conducted following a previously described protocol (Ho et al., J Biol Chem 280(1): 607-617, 2005; Feng et al., Proc Natl Acad Sci USA 11(12): E1083-E1091, 2013; Feng et al., Antib Ther 2(1): 1-11, 2019). For the first set of camel V.sub.HH phage libraries, an immunotube was coated with 5 μg/ml SARS-CoV-2 RBD for the first and second round of panning and 5 μg/ml SARS-CoV-2 S trimer for the 3.sup.rd and 4.sup.th rounds of panning. After each of the second, third, and fourth rounds of panning, 192 monoclonal V.sub.HH phage clones were isolated for analysis. For the second set of 3 camel V.sub.HH libraries, an immunotube was coated with 5 μg/ml SARS-CoV-2 RBD for the first, second, and third rounds of panning, and 5 μg/ml SARS-CoV-2 S trimer for the 4.sup.th round of panning (FIG. 1B). After the 4.sup.th round, 192 monoclonal phages were isolated. In total, 768 V.sub.HH phage clones were isolated for analysis.

Example 2

Enrichment of Phage V.SUB.H.H Single Domain Antibodies Against SARS-CoV-2 RBD and S Protein

[0347] ELISA was performed to evaluate enrichment of S protein-specific antibodies following each round of panning. An ELISA plate was coated with 1 μg/ml SARS-CoV-2 RBD, SARS-CoV-2 S1, SARS-CoV-2 S trimer, or BSA as negative control. As shown in FIG. 2, from the first set of 3 camel V.sub.HH phage libraries, signals increased from 1.sup.st to 2.sup.nd round when panned on RBD. On the third round, when S trimer was used for panning, the signal dropped back down, but was enriched in the 4.sup.th round of panning when S trimer was used again. From the second set of 3 camel V.sub.HH phage libraries, enrichment was shown in the 3.sup.rd round of panning using SARS-CoV-2 RBD, and further enriched in the 4.sup.th round when SARS-CoV-2 S trimer was used.

[0348] After isolating 768 monoclonal phages, 127 clones with the highest binding signal for the RBD were picked for sequencing and further analysis. Out of the 127 clones, there were 29 unique sequences. Group 1 clone (1B5) binds both SARS-CoV-2 S protein and SARS-CoV S1 protein. Group 2 clones (such as 7A3) bind the RBD and S protein of SARS-CoV-2. Group 3 clones bind the RBD but have modest or no binding to the SARS-CoV-2 S protein (FIG. 3A).

[0349] Flow cytometry was used to evaluate binding of select camel V.sub.HH single domain antibodies against the S protein of SARS-CoV and SARS-CoV-2. Human A431 cells were engineered to express SARS-CoV or SARS-CoV-2 S protein trimer. Nanobodies 8A2, 1H6, 1B5, 8A4, 7A3 and 2F7 V.sub.HH-hFc were tested in this assay; antibody CR3022 was used as a positive control. As shown in FIG. 3B, all nanobodies bound to SARS-CoV-2 S protein. In addition, 1B5-hFc exhibited strong binding, and 7A3-hFc exhibited modest binding, to the S protein of SARS-CoV. 8A2, 2F7, 8A4 and 1H6 did not bind the S protein of SARS-CoV.

Example 3

Phylogenetic Analysis of the Isolated SARS-CoV-2 Binding Nanobodies

[0350] FIG. 4A shows a phylogenetic tree of the isolated and sequenced SARS-CoV-2 binding V.sub.HHs based on the neighbor joining method (EMBL-EBI Clustal Omega Program). Some of the anti-SARS-CoV-2 nanobodies (e.g., 1B5 and 2F7) were found at proximal nodes in the phylogenetic tree, whereas some nanobodies (e.g.,7A3) were found at distal nodes, indicating high divergence from their corresponding germline and intermediate counterparts. FIG. 4B provides a table showing the types of V.sub.HHs based on the location and number of cysteines (see English et al., Antib Ther 3(1): 1-9, 2020). Type IV V.sub.HHs contain only two canonical cysteines, one before (N-terminal to) CDR1 and the other before CDR3. Type II V.sub.HHs have a total of 4 cysteines, the two canonical cysteines found in Type IV, plus two additional, non-canonical cysteines, one in CDR1 and the other in CDR3. The V.sub.HHs in which the number or location of non-canonical cystines do not fit Type II are grouped as “Others.”

Example 4

Binding Analysis of V.SUB.H.H-hFc Fusion Proteins

[0351] Ten of the camel nanobodies (1B5, 7A3, 2F7, 8A4, 1H6, 7C4, 1A7, 3E8, 7A5 and 2C7) were fused to human Fc to produce V.sub.HH-hFc fusion proteins (see FIG. 5 schematic). Binding of the V.sub.HH-hFc antibodies to SARS-CoV-2 RBD, SARS-CoV-2 S trimer, and SARS-CoV S1 was evaluated by ELISA. A plate was coated with 1μg/ml SARS-CoV-2 RBD, SARS-CoV-2 S trimer, SARS-CoV S1 or BSA as a control. The results are shown in FIG. 5A. One μg/ml of each V.sub.HH-hFc antibody was used. 1B5 and 7A3 bound strongly to all SARS-CoV-2 proteins. The rest of the antibodies bound to the RBD and S trimer strongly, but weaker to S1. 7A5 was nonspecific as it also bound the control protein at similar intensity. Overall, the majority of V.sub.HH binders (out of 10 clones) exhibited specific binding to both RBD and S trimer of SARS-CoV-2.

[0352] Nanobodies 1B5, 7A3, 2F7, 8A4, 1H6, 7C4, 1A7, 3E8, 7A5 and 2C7 (in V.sub.HH-hFc format) were also tested for their ability to bind the RBD of SARS-CoV-2 variant B.1.617.2. A plate was coated with 5 μg/ml SARS-CoV-2 B.1.617.2 RBD and 5 μg/ml of each V.sub.HH-hFc antibody was used. As shown in FIG. 5B, nanobodies 1B5, 7A3, 1A10, 3E8 and 2C7 bound to the B.1.617.2 variant strongly, while 1A7 exhibited modest binding.

Example 5

Epitope Mapping

[0353] To determine the binding sites of the S protein-specific nanobodies, epitope mapping studies were conducted. A RBD peptide array was constructed with twenty-four 18-mer peptides (peptides 1-24, set forth herein as SEQ ID NOs: 31-54, respectively) with a 9-amino acid overlap, which covers the complete RBD sequence of SARS-CoV-2. An ELISA plate was coated with 5 μg/ml of each peptide. Binding of 1 μg/ml 7A3 V.sub.HH-hFc was detected by goat anti-human Fc HRP. 7A3 showed the strongest binding for peptide 21 (PTNGVGYQPYRVVVLSFE; SEQ ID NO: 51) and peptide 22 (YRVVVLSFELLHAPATVC; SEQ ID NO: 52).

[0354] In a subsequent experiment, epitope mapping of ten V.sub.HH-hFc fusion proteins (1B5, 7A3, 2F7, 8A4, 1H6, 7C4, 1A7, 3E8, 7A5 and 2C7) was conducted. All tested nanobodies bound peptide 22 (YRVVVLSFELLHAPATVC; SEQ ID NO: 52), although some of the binding signal was attributable to background signal, as indicated by signal detected for peptide 22 when incubated with 2nd antibody alone. The 7A3 V.sub.HH-hFc bound multiple peptides, in particular peptides 21 and 22. The 1B5 VHH-hFc modestly bound peptide 22, indicating it binds a highly conformational epitope. The 2F7 V.sub.HH-hFc binds peptides 6 and 22. These data indicate that nanobodies, such as 7A3, 1B5 and 2F7, bind different epitopes on the SARS-CoV-2 spike protein, although they all share the peptide 22 sequence in their binding domains to some degree.

[0355] Two additional epitope mapping experiments were carried out for the 7A3 V.sub.HH nanobody (without Fc). In each study, an ELISA plate was coated with 5 μg/ml of each peptide and 5 μg/ml 7A3 V.sub.HH protein was added. After incubation for 1 hour followed by washing, 50 μl of anti-FLAG tag HRP (1:2500) was added for detection of V.sub.HH nanobodies, and incubated for 1 hour. After washing, 50 μl TMB substrate was added to develop the wells, and then 25 μl of 0.25 M sulfuric acid was added to stop the reaction. The A450 values were read with a plate reader. In the first experiment, the 7A3 V.sub.HH nanobody bound to peptides 21 and 22, as well as peptides 3 and 12 (although low background was detected for peptide 12 when stained with 2nd antibody alone). In the second experiment, the 7A3 V.sub.HH nanobody bound to peptides 3, 6, 12/13 and 21/22. Background staining by the 2n d antibody was not detectable in this repeated experiment. Epitope mapping was also carried out for the 2F7 V.sub.HH nanobody. An ELISA plate was coated with 5 μg/ml of each peptide and 5 μg/ml2F7 V.sub.HH protein was added. After incubation for 1 hour followed by washing, 50 μl of anti-FLAG tag (1:2500) was added for detecting V.sub.HH nanobodies and incubated for 1 hour. After washing, 50 μl TMB substrate was added to develop the wells, and then 25 μl of 0.25 M sulfuric acid was used to stop the reaction. The A450 values were read with a plate reader. The results show that the 7A3 V.sub.HH nanobody bound to peptides 6, 13, 22 and 24.

[0356] To further investigate the RBD epitopes of the nanobodies, a competition assay of VHH-hFc on SARS-CoV-2 RBD was performed. SARS-CoV-2 RBD-His was immobilized onto NTA sensor tips. The RBD-coated tips were then dipped into either PBS or 500 nM of a first nanobody. After loading, the sensor tips were incubated in PBS briefly before being dipped into wells containing 500 nM of the competing nanobody, followed by dissociation in PBS. Percent of residual binding was calculated as follows: (response signal from the second ligand in presence of first ligand/response signal from the second ligand in absence of first ligand)×100. As shown in FIG. 11, 7A3 and 1B5 bind to one epitope and 2F7, 8A4, 1H6, 8A2 bind to another epitope. All tested nanobodies inhibited ACE2.

[0357] FIG. 6 shows a sequence alignment of the RBD region of SARS-CoV-2 (SEQ ID NO: 55), SARS-CoV (SEQ ID NO: 56) and three identified variant strains of SARS-CoV-2 (B.1.1.7 (SEQ ID NO: 57), B.1.351 (SEQ ID NO: 58), and P.1 (SEQ ID NO: 59)), along with the predicted positions of contact for nanobodies 1B5, 7A3, 2F7 and 8A2.

Example 6

Affinity Binding of V.SUB.H.H-hFc Antibodies

[0358] Binding of select nanobodies to the original Wuhan-Hu-1 strain and variants of SARS-CoV-2 was evaluated by Octet. SARS-CoV-2 or SARS-CoV-2 mutant variants (B.1.1.7, B.1.351, P.1 and B.1.617.2) were immobilized onto NTA sensor tips. The antigen-coated tips were then dipped into PBS to stabilize the curve and then dipped into 25 nM V.sub.HH-hFc for association then dipped into PBS for dissociation. As shown in FIG. 12, both 1B5 and 7A3 bind to all variants. In addition, 8A2 was capable of binding several variants, including B.1.1.7, B.1.351 and P.1.

Example 7

Neutralizing Activity of the S Protein-Specific Nanobodies

[0359] An ELISA was performed to assess the inhibitory effect of V.sub.HH-hFc against the interaction of the spike protein RBD and the human ACE2 protein. An ELISA plate was coated with 2 μg/ml ACE2-His. Five μg/ml of each V.sub.HH-hFc (1B5, 7A3, 2F7, 8A4, 1H6, 7C4, 1A7, 3E8, 7A5 and 2C7) was incubated with varying concentrations of RBD-mFc starting from 1 μg/ml with 1:3 dilutions. The V.sub.HH-hFc and RBD-mFc mixture was then added to the ACE2-His coated plate and binding was detected using a goat anti-mouse Fc HRP conjugate. As shown in FIG. 7A, 1B5 exhibited the best inhibitory effect, along with 7A3 and 2F7. Together, these three V.sub.HHs (1B5, 7A3 and 2F7) were identified as the best ACE2 blockers among all V.sub.HHs tested.

[0360] The neutralization assay was repeated using various concentrations of nanobody. An ELISA plate was coated with 2 μg/ml ACE2-His. Five μg/ml V.sub.HH-hFc is incubated with varying concentrations of RBD-mFc starting from 1 μg/ml and 1:3 dilutions were done. The V.sub.HH-hFc and RBD-mFc mixture was then added to the ACE2-His coated plate and detected using goat anti-mouse Fc HRP conjugate. As shown in FIG. 7B, 1B5 showed the best inhibitory effect along with 8A2 and 2F7.

[0361] In a further study, an ELISA plate was coated with 2 μg/ml ACE2-His and 0.1 μg/ml RBD-mFc was incubated with varying concentrations of VHH-hFc starting from 50 μg/ml with 1:2 dilutions. The V.sub.HH-hFc and RBD-mFc mixture was then added to the ACE2-His coated plate and detected using goat anti-mouse Fc HRP conjugate. As shown in FIG. 7C, 1B5 (IC50=<0.001 μg/ml) was the most potent ACE2 inhibitor followed by 2F7 (IC50=0.3 μg/ml or 3.5 nM) and 7A3 (IC50=0.2 μg/ml or 2.3 nM), 8A4 (IC50=1.1 μg/ml or 13 nM) and 1H6 (IC50=3 μg/ml or 35 nM).

[0362] Additional studies were performed to evaluate the neutralizing effect of V.sub.HH-hFc against SARS-CoV-2 pseudovirus. To perform the neutralization assay, 5000 HEK 293T-hACE2 cells were seeded. Ten μl of SARS-CoV-2 spike pseudovirus supernatant per well was used. Nanobody (V.sub.HH)-hFc 7A3, 1B5, 2F7, 8A4, 1H6, 1A7, 2C7, 7C4, 7A5 and 3E8 were prepared in 12 point 2-fold serial dilutions starting with to 50 μg/ml. Nanobodies and virus were mixed for 45 minutes before adding to the HEK 293T-hACE2 cells. After incubation for 72 hours, the reading was performed (FIGS. 8A-8J). Nanobodies 7A3, 1B5, 2F7, 8A4 and 1H6 were identified as neutralizing, with IC50 values ranging from 6.3 nM to 90 mM (7A3=6.3 nM, 0.52 μg/ml; 1B5=6.6 nM, 0.55 μg/ml; 2F7=14 nM, 1.18 μg/ml; 8A4=47 nM, 3.95 μg/ml; and 1H6=90 nM, 7.56 μg/ml). The neutralization assay was repeated using the same protocol and similar results were obtained for the five most potent nanobodies (FIGS. 9A-9F). Neutralizing nanobodies (IC50): 7A3 (6.6 nM), 1B5 (7.6 nM;), 2F7 (8.6 nM), 8A4 (27.5 nM), 1H6 (111 nM), 1A7 (428 nM), 2C7 (5792 nM), 7C4 (4288 nM), 7A5 (3430 nM), and 3E8 (1169 nM). In addition, FIG. 9G shows an additional experiment to assess the neutralization effect of 8A2, 7A3, 1B5, 2F7, 8A4 and 1H6. 8A2 exhibited the greatest neutralization with an IC50 of 5 nM.

[0363] Next, the neutralizing activity of antibody cocktails containing two V.sub.HH-hFc was evaluated. To perform the neutralization assay, 5000 HEK 293T-hACE2 cells were seeded. Ten μl of SARS-CoV-2 spike pseudovirus supernatant per well was used. Two nanobody (V.sub.HH)-hFcs were mixed in 12 point 2-fold serial dilutions starting with total 50μg/ml (each V.sub.HH-hFc is 25μg/ml). Nanobodies and virus were mixed for 45 minutes before adding to HEK 293T-hACE2 cells. After incubation for 72 hours, the reading was performed (FIGS. 10A-10J). The nanobody combinations of 7A3+2F7 and 7A3+8A4 were the most potent with IC50 values of about 2 nM. Neutralizing antibody cocktails (IC50): 7A3+2F7 (1.9 nM), 7A3+8A4 (2.2 nM), 1B5+2F7 (3.5 nM), 7A3+1H6: (4.5 nM), 1B5+1H6 (6.0 nM), 8A4+2F7 (12.1 nM), 1B5+8A4 (19.9 nM), 1H6+2F7 (72.2 nM), 7A3+1B5 (82.9 nM), and 8A4+1H6 (104.9 nM). FIG. 9H shows the results of an additional experiment to assess neutralization effect of nanobody combinations (7A3+8A2, 7A3+2F7, 1B5+8A2, 1B5+2F7, 2F7+8A2, and 7A3+8A4). The combination of 7A3+8A2 exhibited the greatest neutralization with an IC50 of 1.6 nM.

[0364] In view of the many possible embodiments to which the principles of the disclosed subject matter may be applied, it should be recognized that the illustrated embodiments are only examples of the disclosure and should not be taken as limiting the scope of the disclosure. Rather, the scope of the disclosure is defined by the following claims. We therefore claim all that comes within the scope and spirit of these claims.