Heterologous expression of thermophilic lysine decarboxylase and uses thereof

11155840 · 2021-10-26

Assignee

Inventors

Cpc classification

International classification

Abstract

The invention provides microorganisms genetically modified to overexpress thermophilic lysine decarboxylase polypeptides in a mesophilic host to enhance the production of lysine and lysine derivatives by the microorganism, method of generating such microorganism, and methods of producing lysine and lysine derivatives using the genetically modified microorganisms.

Claims

1. A method of producing cadaverine, the method comprising: (a) culturing a mesophilic microorganism host cell at a temperature from 20° C. to 50° C. for a time period sufficient to accumulate lysine, wherein the mesophilic microorganism host cell produces lysine and is genetically modified to express a thermophilic lysine decarboxylase and to overexpress one or more lysine biosynthesis polypeptides, and wherein the amino acid sequence of the thermophilic lysine decarboxylase has at least 95% amino acid sequence identity to any one of SEQ ID NOS: 1-4; and (b) following step (a), incubating the culture of (a) at a temperature of above 55° C. and less than 110° C. to thereby produce cadaverine.

2. The method of claim 1, wherein step (a) is performed at a temperature of from 25° C. to 45° C.

3. The method of claim 1, wherein step (a) is performed at a temperature of from 30° C. to 40° C.

4. The method of claim 1, wherein step (a) is performed at a temperature of from 35° C. to 39° C.

5. The method of claim 1, wherein step (b) is performed at a temperature of from 55° C. to 90° C.

6. The method of claim 1, wherein step (b) is performed at a temperature of from 60° C. to 75° C.

7. The method of claim 1, wherein step (b) is performed at a temperature of from 60° C. to 70° C.

8. The method of claim 1, wherein the thermophilic lysine decarboxylase comprises the amino acid sequence of any one of SEQ ID NOS: 1-4.

Description

DESCRIPTION OF THE FIGURES

(1) FIG. 1 shows a CLUSTAL O(1.2.4) multiple sequence alignment of E. coli LdcC and CadA polypeptide sequences with lysine decarboxylase polypeptide sequences from Tepidanaerobacter syntrophicus (SEQ ID NO:1, encoded by GenBank ID GAQ24853.1), Geobacillus kaustophilus (SEQ ID NO:2, encoded by GenBank ID BAD75350.1), Thermosynechoccus elongatus (SEQ ID NO:3, encoded by GenBank ID BAC09418.1), and Thermomicrobium roseum (SEQ ID NO:4, encoded by GenBank ID ACM05730.1.

DETAILED DESCRIPTION OF ASPECTS OF THE DISCLOSURE

(2) Before the present invention is described, it is to be understood that this invention is not limited to particular embodiments described, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting.

(3) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, the preferred methods and materials are now described. All publications and accession numbers mentioned herein are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited.

Terminology

(4) As used in the context of the present disclosure, a “thermophilic lysine decarboxylase polypeptide” refers to a PLP-dependent lysine decarboxylase from a thermophile that catalyzes the decarboxylation of L-lysine to produce cadaverine. Thermophilic lysine decarboxylases function optimally at above about 55° C. Structural mechanisms contributing to thermostability are described, e.g., in Vieille & Zeikus Microbiology and Molecular Biology Reviews, 65(1), p. 1-43, 2001. Characteristic domains of thermophilic lysine decarboxylase polypeptides include a pyridoxal 5′-phosphate binding pocket and a conserved domain: OKR_DC_1_C (Orn/Lys/Arg decarboxylase, C-terminal domain; PFAM 03711; superfamily cl27246). Such enzymes are known in the art. Illustrative thermophilic lysine decarboxylases include Tepidanaerobacter syntrophicus lysine decarboxylase (GenBank Accession No. GAQ24853), Geobacillus kaustophilus lysine decarboxylase (GenBank Accession No. BAD75350), Thermosynechoccus elongatus lysine decarboxylase (GenBank Accession No. Accession No. BAC09418); Thermomicrobium roseum lysine decarboxylase (GenBank Accession No. ACM05730); Geobacillus kaustophilis lysine decarboxylase (GenBank Accession No. BAD74308); Gracilibacillus halophiles lysine decarboxylase (GenBank Accession No. ENH96106); Geobacillus thermoleovorans lysine decarboxylase (GenBank Accession No. AEV18557); Ruminiclostridium thermocellus lysine decarboxylase (GenBank Accession No. ADU75593); Caldicellulosiruptor obsidians lysine decarboxylase (GenBank Accession No. ADL43096); Parageobacillus genome sp. 1 lysine decarboxylase (GenBank Accession No. EZP77891); and Anoxybacillus flavithermus lysine decarboxylase (GenBank Accession No. EMT45272).

(5) In some embodiments, a thermophilic lysine decarboxylase is from Tepidanaerobacter syntrophicus, Geobacillus kaustophilus, Thermosynechoccus elongatus, or Thermomicrobium roseum; or a biologically active variant of such a lysine decarboxylase enzyme. Biologically active variants include alleles, fragments, and interspecies homologs of the polypeptides. Illustrative thermophilic lysine decarboxylase polypeptide sequences include the lysine decarboxylase from Tepidanaerobacter syntrophicus (SEQ ID NO:1, encoded by GenBank ID GAQ24853.1), Geobacillus kaustophilus (SEQ ID NO:2, encoded by GenBank ID BAD75350.1), Thermosynechoccus elongatus (SEQ ID NO:3, encoded by GenBank ID BAC09418.1), and Thermomicrobium roseum (SEQ ID NO:4, encoded by GenBank ID ACM05730.1).

(6) In some embodiments, a “thermophilic lysine decarboxylase polypeptide” has at least 60% amino acid sequence identity, typically at least 65%, 70%, 75%, 80%, 85%, 90% identity; often at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or greater amino acid sequence identity, over a region of at least about 200, 300, or 400 or more amino acids to a naturally occurring thermophilic lysine decarboxylase polypeptide sequence. In some embodiments, a “thermophilic lysine decarboxylase polypeptide” has at least 90% identity; often at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or greater, amino acid sequence identity to a naturally occurring thermophilic lysine decarboxylase polypeptide sequence over the length of the sequence. In some embodiments, a “thermophilic lysine decarboxylase polypeptide” has at least 60% amino acid sequence identity, often at least 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or greater, amino acid sequence identity, over the length of the polypeptide of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, or SEQ ID NO:4.

(7) A “thermophilic lysine decarboxylase polynucleotide” as used herein refers to a polynucleotide that encodes a thermophilic lysine decarboxylase polypeptide as described in the previous paragraph. A nucleic acid or polynucleotide that encodes a thermophilic lysine decarboxylase polypeptide refers to a gene, pre-mRNA, mRNA, and the like, including nucleic acids encoding variants, alleles, and fragments. Illustrative nucleic acid sequences encoding the thermophilic lysine decarboxylase polypeptide sequences of SEQ ID NOS:1, 2, 3, and 4 are provided in SEQ ID NOS:5, 6, 7, and 8, respectively.

(8) The term “enhanced” or “improved” in the context of the production of an amino acid derivative, e.g., cadaverine, as used herein refers to an increase in the production of the amino acid derivative produced by a genetically modified mesophilic microorganism, which microorganism is modified to express a thermophilic lysine decarboxylase as described herein, at a temperature of about 50° C., but less than about 110° C. in comparison to a control counterpart microorganism of the same strain that is not modified to express the thermophilic lysine decarboxylase. In some embodiments, the control counterpart microorganism is of the same strain, but is modified to overexpress a mesophilic lysine decarboxylase compared to the strain modified to express the thermophilic lysine decarboxylase. In one embodiment, production of the amino acid derivative, e.g., cadaverine, by the genetically modified microorganism is improved by at least 10%, 15% 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 125%, 150%, 200% or greater, compared to the control. An increase in production can be assessed by measuring the production of the amino acid derivative, e.g., cadaverine, by the mesophilic host cell modified to express a thermophilic lysine decarboxylase and the control cell under identical conditions that include incubation of the culture, or an extract of the cultured cells, at a temperature of about 50° C. and less than about 110° C., for example, for a period of time of at least one hour, e.g., two, three, four, five or six hours. By way of illustration, in some embodiments, production of the amino acid derivative, e.g., cadaverine, is tested by culturing mesophilic host cells modified to express a thermophilic lysine decarboxylase under mesophilic conditions (e.g., at 30° to 40° C.) in comparison to a control cell of the same strain modified to express a mesophilic lysine decarboxylase for a period of time, e.g., overnight, sufficient to produce lysine. The host cells are then lysed. Aliquots of supernatant from the lysed cells are incubated at a thermophilic temperature, e.g., 65° C., for four hours with lysine-HCl and PLP to a final concentration of 160 g/L and 0.1 mM. Cadaverine production from the cell lysates from the control cells and the cells modified to express the thermophilic lysine decarboxylase can then be measured and compared. An exemplary assay is provided in the Examples section.

(9) The terms “numbered with reference to”, or “corresponding to,” or “determined with reference to” when used in the context of the numbering of a given amino acid or polynucleotide sequence, refers to the numbering of the residues of a specified reference sequence when the given amino acid or polynucleotide sequence is compared to the reference sequence. For example, a position of a variant thermophilic lysine decarboxylase polypeptide sequence “corresponds to” a position in reference polypeptide sequence SEQ ID NO:1 (or in a position of a reference polypeptide sequence of SEQ ID NO:2, 3, 4, or 9) when the variant polypeptide is aligned with the reference polypeptide sequence in a maximal alignment.

(10) The terms “wild type”, “native”, and “naturally occurring” with respect to a thermophilic lysine decarboxylase polypeptide are used herein to refer to a thermophilic lysine decarboxylase protein that has a sequence that occurs in nature.

(11) The terms “polynucleotide” and “nucleic acid” are used interchangeably and refer to a single or double-stranded polymer of deoxyribonucleotide or ribonucleotide bases read from the 5′ to the 3′ end. A nucleic acid as used in the present invention will generally contain phosphodiester bonds, although in some cases, nucleic acid analogs may be used that may have alternate backbones, comprising, e.g., phosphoramidate, phosphorothioate, phosphorodithioate, or O-methylphophoroamidite linkages (see Eckstein, Oligonucleotides and Analogues: A Practical Approach, Oxford University Press); positive backbones; non-ionic backbones, and non-ribose backbones. Nucleic acids or polynucleotides may also include modified nucleotides that permit correct read-through by a polymerase. “Polynucleotide sequence” or “nucleic acid sequence” includes both the sense and antisense strands of a nucleic acid as either individual single strands or in a duplex. As will be appreciated by those in the art, the depiction of a single strand also defines the sequence of the complementary strand; thus the sequences described herein also provide the complement of the sequence. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses variants thereof (e.g., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated. The nucleic acid may be DNA, both genomic and cDNA, RNA or a hybrid, where the nucleic acid may contain combinations of deoxyribo- and ribo-nucleotides, and combinations of bases, including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine, isoguanine, etc.

(12) The term “substantially identical,” used in the context of this disclosure for two nucleic acids or polypeptides, refers to a sequence that has at least 50% sequence identity with a reference sequence. Percent identity can be any integer from 50% to 100%. Some embodiments include at least: 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%, compared to a reference sequence using the programs described herein; preferably BLAST using standard parameters, as described below.

(13) Two nucleic acid sequences or polypeptide sequences are said to be “identical” if the sequence of nucleotides or amino acid residues, respectively, in the two sequences is the same when aligned for maximum correspondence as described below. The terms “identical” or percent “identity,” in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence over a comparison window, as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection.

(14) For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.

(15) An algorithm that may be used to determine whether a thermophilic lysine decarboxylase polypeptide has sequence identity to any one of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, or SEQ ID NO:4, is the BLAST algorithm, which is described in Altschul et al., 1990, J. Mol. Biol. 215:403-410). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (on the worldwide web at ncbi.nlm.nih.gov/). Illustrative software for performing protein sequence alignments include ClustalW2 and BLASTP. For amino acid sequences, the BLASTP program uses as defaults a word size (W) of 3, an expect threshold (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1989)). In the present disclosure, polypeptide sequence identity is typically determined using BLASTP Align Sequence with the default parameters.

(16) A “comparison window,” as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by manual alignment and visual inspection. Optimal alignments are typically conducted using BLASTP with default parameters.

(17) Nucleic acid or protein sequences that are substantially identical to a reference sequence include “conservatively modified variants.” With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are “silent variations,” which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid. One of skill will recognize that each codon in a nucleic acid (except AUG, which is ordinarily the only codon for methionine) can be modified to yield a functionally identical molecule. Accordingly, each silent variation of a nucleic acid which encodes a polypeptide is implicit in each described sequence.

(18) The term “polypeptide” as used herein includes reference to polypeptides containing naturally occurring amino acids and amino acid backbones as well as non-naturally occurring amino acids and amino acid analogs.

(19) As to amino acid sequences, one of skill will recognize that individual substitutions, in a nucleic acid, peptide, polypeptide, or protein sequence which alters a single amino acid or a small percentage of amino acids in the encoded sequence is a “conservatively modified variant” where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. Examples of amino acid groups defined in this manner can include: a “charged/polar group” including Glu (Glutamic acid or E), Asp (Aspartic acid or D), Asn (Asparagine or N), Gln (Glutamine or Q), Lys (Lysine or K), Arg (Arginine or R) and His (Histidine or H); an “aromatic or cyclic group” including Pro (Proline or P), Phe (Phenylalanine or F), Tyr (Tyrosine or Y) and Trp (Tryptophan or W); and an “aliphatic group” including Gly (Glycine or G), Ala (Alanine or A), Val (Valine or V), Leu (Leucine or L), Ile (Isoleucine or I), Met (Methionine or M), Ser (Serine or S), Thr (Threonine or T) and Cys (Cysteine or C). Within each group, subgroups can also be identified. For example, the group of charged/polar amino acids can be sub-divided into sub-groups including: the “positively-charged sub-group” comprising Lys, Arg and His; the “negatively-charged sub-group” comprising Glu and Asp; and the “polar sub-group” comprising Asn and Gln. In another example, the aromatic or cyclic group can be sub-divided into sub-groups including: the “nitrogen ring sub-group” comprising Pro, His and Trp; and the “phenyl sub-group” comprising Phe and Tyr. In another further example, the aliphatic group can be sub-divided into sub-groups including: the “large aliphatic non-polar sub-group” comprising Val, Leu and Ile; the “aliphatic slightly-polar sub-group” comprising Met, Ser, Thr and Cys; and the “small-residue sub-group” comprising Gly and Ala. Examples of conservative mutations include amino acid substitutions of amino acids within the sub-groups above, such as, but not limited to: Lys for Arg or vice versa, such that a positive charge can be maintained; Glu for Asp or vice versa, such that a negative charge can be maintained; Ser for Thr or vice versa, such that a free —OH can be maintained; and Gln for Asn or vice versa, such that a free —NH2 can be maintained. The following six groups each contain amino acids that further provide illustrative conservative substitutions for one another. 1) Ala, Ser, Thr; 2) Asp, Glu; 3) Asn, Gln; 4) Arg, Lys; 5) Ile, Leu, Met, Val; and 6) Phe, Try, and Trp (see, e.g., Creighton, Proteins (1984)). In some embodiments, conservative substitutions are employed in generating Cada variants having substitutions at sites other than a glutamate residue.

(20) The term “promoter,” as used herein, refers to a polynucleotide sequence capable of driving transcription of a nucleic acid sequence in a cell. Thus, promoters used in the polynucleotide constructs of the invention include cis- and trans-acting transcriptional control elements and regulatory sequences that are involved in regulating or modulating the timing and/or rate of transcription of a gene. For example, a promoter can be a cis-acting transcriptional control element, including an enhancer, a repressor binding sequence and the like. These cis-acting sequences typically interact with proteins or other biomolecules to carry out (turn on/off, regulate, modulate, etc.) gene transcription. Most often the core promoter sequences lie within 1-2 kb of the translation start site, more often within 1 kbp and often within 500 bp or 200 bp or fewer, of the translation start site. By convention, promoter sequences are usually provided as the sequence on the coding strand of the gene it controls. In the context of this application, a promoter is typically referred to by the name of the gene for which it naturally regulates expression. A promoter used in an expression construct of the invention is referred to by the name of the gene. Reference to a promoter by name includes a wild type, native promoter as well as variants of the promoter that retain the ability to induce expression. Reference to a promoter by name is not restricted to a particular species, but also encompasses a promoter from a corresponding gene in other species.

(21) A “constitutive promoter” in the context of this invention refers to a promoter that is capable of initiating transcription under most conditions in a cell, e.g., in the absence of an inducing molecule. An “inducible promoter” initiates transcription in the presence of an inducer molecule.

(22) A polynucleotide is “heterologous” to an organism or a second polynucleotide sequence if it originates from a foreign species, or, if from the same species, is modified from its original form. For example, when a polynucleotide encoding a polypeptide sequence is said to be operably linked to a heterologous promoter, it means that the polynucleotide coding sequence encoding the polypeptide is derived from one species whereas the promoter sequence is derived from another, different species; or, if both are derived from the same species, the coding sequence is not naturally associated with the promoter (e.g., is a genetically engineered coding sequence, e.g., from a different gene in the same species, or an allele from a different species). Similarly, a polypeptide is “heterologous” to a host cell if the native wildtype host cell does not produce the polypeptide.

(23) The term “exogenous” refers generally to a polynucleotide sequence or polypeptide that does not naturally occur in a wild-type cell or organism, but is typically introduced into the cell by molecular biological techniques, i.e., engineering to produce a recombinant microorganism. Examples of “exogenous” polynucleotides include vectors, plasmids, and/or man-made nucleic acid constructs encoding a desired protein.

(24) The term “endogenous” refers to naturally-occurring polynucleotide sequences or polypeptides that may be found in a given wild-type cell or organism. In this regard, it is also noted that even though an organism may comprise an endogenous copy of a given polynucleotide sequence or gene, the introduction of a plasmid or vector encoding that sequence, such as to overexpress or otherwise regulate the expression of the encoded protein, represents an “exogenous” copy of that gene or polynucleotide sequence. Any of the pathways, genes, or enzymes described herein may utilize or rely on an “endogenous” sequence, which may be provided as one or more “exogenous” polynucleotide sequences, or both.

(25) “Recombinant nucleic acid” or “recombinant polynucleotide” as used herein refers to a polymer of nucleic acids wherein at least one of the following is true: (a) the sequence of nucleic acids is foreign to (i.e., not naturally found in) a given host cell; (b) the sequence may be naturally found in a given host cell, but in an unnatural (e.g., greater than expected) amount; or (c) the sequence of nucleic acids comprises two or more subsequences that are not found in the same relationship to each other in nature. For example, regarding instance (c), a recombinant nucleic acid sequence can have two or more sequences from unrelated genes arranged to make a new functional nucleic acid.

(26) The term “operably linked” refers to a functional relationship between two or more polynucleotide (e.g., DNA) segments. Typically, it refers to the functional relationship of a transcriptional regulatory sequence to a transcribed sequence. For example, a promoter or enhancer sequence is operably linked to a DNA or RNA sequence if it stimulates or modulates the transcription of the DNA or RNA sequence in an appropriate host cell or other expression system. Generally, promoter transcriptional regulatory sequences that are operably linked to a transcribed sequence are physically contiguous to the transcribed sequence, i.e., they are cis-acting. However, some transcriptional regulatory sequences, such as enhancers, need not be physically contiguous or located in close proximity to the coding sequences whose transcription they enhance.

(27) The term “expression cassette” or “DNA construct” or “expression construct” refers to a nucleic acid construct that, when introduced into a host cell, results in transcription and/or translation of an RNA or polypeptide, respectively. In the case of expression of transgenes, one of skill will recognize that the inserted polynucleotide sequence need not be identical, but may be only substantially identical to a sequence of the gene from which it was derived. As explained herein, these substantially identical variants are specifically covered by reference to a specific nucleic acid sequence. One example of an expression cassette is a polynucleotide construct that comprises a polynucleotide sequence encoding a polypeptide of the invention protein operably linked to a promoter, e.g., its native promoter, where the expression cassette is introduced into a heterologous microorganism. In some embodiments, an expression cassette comprises a polynucleotide sequence encoding a polypeptide of the invention where the polynucleotide is targeted to a position in the genome of a microorganism such that expression of the polynucleotide sequence is driven by a promoter that is present in the microorganism.

(28) The term “host cell” as used in the context of this invention refers to a microorganism and includes an individual cell or cell culture that can be or has been a recipient of any recombinant vector(s) or isolated polynucleotide(s) of the invention. Host cells include progeny of a single host cell, and the progeny may not necessarily be completely identical (in morphology or in total DNA complement) to the original parent cell due to natural, accidental, or deliberate mutation and/or change. A host cell includes cells into which a recombinant vector or a polynucleotide of the invention has been introduced, including by transformation, transfection, and the like.

(29) The term “isolated” refers to a material that is substantially or essentially free from components that normally accompany it in its native state. For example, an “isolated polynucleotide,” as used herein, may refer to a polynucleotide that has been isolated from the sequences that flank it in its naturally-occurring or genomic state, e.g., a DNA fragment that has been removed from the sequences that are normally adjacent to the fragment, such as by cloning into a vector. A polynucleotide is considered to be isolated if, for example, it is cloned into a vector that is not a part of the natural environment, or if it is artificially introduced in the genome of a cell in a manner that differs from its naturally-occurring state. Alternatively, an “isolated peptide” or an “isolated polypeptide” and the like, as used herein, may refer to a polypeptide molecule that is free of other components of the cell, i.e., it is not associated with in vivo cellular substances.

(30) The invention employs various routine recombinant nucleic acid techniques. Generally, the nomenclature and the laboratory procedures in recombinant DNA technology described below are commonly employed in the art. Many manuals that provide direction for performing recombinant DNA manipulations are available, e.g., Sambrook & Russell, Molecular Cloning, A Laboratory Manual (3rd Ed, 2001); and Current Protocols in Molecular Biology (Ausubel, et al., John Wiley and Sons, New York, 2009-2016).

Summary of Certain Aspects of the Disclosure

(31) In one aspect, the invention provides a genetically modified mesophilic host cell that is modified to express a thermophilic lysine decarboxylase. In some embodiments, the thermophilic lysine decarboxylase of SEQ ID NO:1, 2, 3, or 4; or a thereof as described herein.

(32) Thermophilic Lysine Decarboxylase Polypeptide

(33) Thermophilic lysine decarboxylase enzymes are known and are part of a well-characterized family of decarboxylases as described above. Lysine decarboxylase polypeptides from four thermophilic microorganisms of very different genetic backgrounds are provided by way of illustration of the present invention. The four illustrative thermophiles are Tepidanaerobacter syntrophicus (GenBank ID GAQ24853.1), Geobacillus kaustophilus (GenBank ID BAD75350.1), Thermosynechoccus elongatus (GenBank ID BAC09418.1), and Thermomicrobium roseum (GenBank ID ACM05730.1). Polypeptide sequences encoded by the genes are provided in SEQ ID NOS 1, 2, 3, and 4, respectively. The protein sequence alignment of the lysine decarboxylase enzymes from these four thermophiles and with CadA and LdcC from E. coli show little similarity in protein sequence (FIG. 1). While E. coli CadA and LdcC share 69% sequence identity, the sequence identity between the four thermophilic lysine decarboxylases, CadA, and LdcC range from 23.61% to 38.44%. The thermophilic lysine decarboxylase protein sequences are also significantly shorter than their mesophilic counterparts. The illustrative thermophilic lysine decarboxylases are between 420 and 500 amino acids in length, whereas the mesophilic lysine decarboxylases are over 700 amino acids in length.

(34) Despite the low overall sequence identity shared between these six proteins and their differences in size, there are conserved domains and structural motifs. First, the conserved lysine residue at amino acid position 367 (as determined with the E. coli CadA polypeptide sequence (SEQ ID NO:9) found in mesophilic lysine decarboxylases is conserved. Further, four of the seven residues important for binding PLP in the mesophilic enzymes are also conserved in the four thermophilic enzymes: 5364, H366, T398, 5400. In addition, two of the seven amino acid residues important for binding PLP (S221 and T399) have either serine or threonine in the corresponding position in the thermophilic enzymes. The last of the seven amino acid residues important for binding PLP (T220) also has an alanine, serine, or threonine in the thermophilic enzymes. Furthermore, of the three residues important for enhancing the electron withdrawing ability of PLP, two are conserved—D330 and H245. W333, although not conserved, is replaced with amino acids with similar polar strengths—tryptophan, glutamine, or methionine in the thermophilic polypeptide sequences. Thus, despite the significant difference in the sizes of the thermophilic and mesophilic enzymes, there is a high degree of conservation in active site residues. Amino acid residues, such as R206, R558, R565, and R568, that are important for ppGpp inhibition of CadA are not conserved in the thermophilic enzymes, which indicates that the thermophilic counterparts are not inhibited by the alarmone ppGpp.

(35) In some embodiments, a variant thermophilic lysine decarboxylase that is expressed in a mesophilic host cell in accordance with the invention comprises conserved or semi-conserved residues described in the preceding paragraph (T220, S221, H245, D330, W333, S364, H366, K367, T398, T399, and 5400 of SEQ ID NO:9, which correspond to amino acids A94, T95, H119, D199, Q202, 5226, H228, K229, T261, S262, and S263 of SEQ ID NO:1, respectively) and has at least 60% amino acid sequence identity, often at least 65%, 70%, 75%, 80%, or 85% identity; and typically at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or greater amino acid sequence identity, over a region of 400 or more amino acids in length, or over the length of, the polypeptide of SEQ ID NO:1.

(36) In some embodiments, a variant thermophilic lysine decarboxylase that is expressed in a mesophilic host cell in accordance with the invention comprises conserved or semi-conserved residues described above (T220, S221, H245, D330, W333, S364, H366, K367, T398, T399, and S400 of SEQ ID NO:9, which correspond to amino acids T90, S91, H115, D195, H198, S223, H225, K226, T258, T259, and S260 of SEQ ID NO:2, respectively) and has at least 60% amino acid sequence identity, often at least 65%, 70%, 75%, 80%, or 85% identity; and typically at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or greater amino acid sequence identity, over a region of 400 or more amino acids in length, or over the length of, the polypeptide of SEQ ID NO:2.

(37) In some embodiments, a variant thermophilic lysine decarboxylase that is expressed in a mesophilic host cell in accordance with the invention comprises conserved or semi-conserved residues described above (T220, 5221, H245, D330, W333, S364, H366, K367, T398, T399, and S400 of SEQ ID NO:9, which correspond to amino acids A56, T57, H81, D161, H164, S189, H191, K192, T224, S225, and S226 of SEQ ID NO:3, respectively) and has at least 60% amino acid sequence identity, often at least 65%, 70%, 75%, 80%, or 85% identity; and typically at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or greater amino acid sequence identity, over a region of 400 or more amino acids in length, or over the length of, the polypeptide of SEQ ID NO:3.

(38) In some embodiments, a variant thermophilic lysine decarboxylase that is expressed in a mesophilic host cell in accordance with the invention comprises conserved or semi-conserved residues described above (T220, S221, H245, D330, W333, S364, H366, K367, T398, T399, and S400 of SEQ ID NO:9, which correspond to amino acids S92, T93, H117, D197, W200, S225, H227, K228, T260, T261, and S262 of SEQ ID NO:4, respectively) and has at least 60% amino acid sequence identity, often at least 65%, 70%, 75%, 80%, or 85% identity; and typically at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or greater amino acid sequence identity, over a region of 400 or more amino acids in length, or over the length of, the polypeptide of SEQ ID NO:4.

(39) Nucleic Acids Encoding Thermophilic Lysine Decarboxylase Polypeptides

(40) Isolation or generation of thermophilic lysine decarboxylase polynucleotide sequences can be accomplished by a number of techniques. In some embodiments, oligonucleotide probes and based on the sequences disclosed here can be used to identify the desired polynucleotide in a cDNA or genomic DNA library from a desired bacteria species. For generation of variants of thermophilic lysine decarboxylase polypeptides, desired substitutions may be introduced into a polynucleotide sequence encoding a native thermophilic lysine decarboxylase sequence using appropriate primers.

(41) Appropriate primers and probes for identifying a lysine decarboxylase polynucleotide in a thermophilic microorganism can be generated from comparisons of the sequences provided herein or generated based on a CadA polynucleotide sequence from another bacteria. For a general overview of PCR see PCR Protocols: A Guide to Methods and Applications. (Innis, M, Gelfand, D., Sninsky, J. and White, T., eds.), Academic Press, San Diego (1990). Illustrative primer sequences are shown in the Table of Primers in the Examples section.

(42) Nucleic acid sequences encoding a thermophilic lysine decarboxylase polypeptide for use in the disclosure includes genes and gene products identified and characterized by techniques such as hybridization and/or sequence analysis using illustrative nucleic acid sequences, e.g., a thermophilic lysine decarboxylase polynucleotide sequence of any one of SEQ ID NOS:5-8. In some embodiments, a host cell is genetically modified by introducing a nucleic acid sequence having at least 60% identity, or at least 70%, 75%, 80%, 85%, or 90% identity, or 95% identity, or greater, to an thermophilic lysine decarboxylase polynucleotide of any one of SEQ ID NOS:5-8.

(43) Nucleic acid sequences encoding a thermophilic lysine decarboxylase in accordance with the invention may additionally be codon-optimized for expression in a desired mesophilic host cell. Methods and databases that can be employed are known in the art. For example, preferred codons may be determined in relation to codon usage in a single gene, a set of genes of common function or origin, highly expressed genes, the codon frequency in the aggregate protein coding regions of the whole organism, codon frequency in the aggregate protein coding regions of related organisms, or combinations thereof. See e.g., Henaut and Danchin in “Escherichia coli and Salmonella,” Neidhardt, et al. Eds., ASM Pres, Washington D.C. (1996), pp. 2047-2066; Nucleic Acids Res. 20:2111-2118; Nakamura et al., 2000, Nucl. Acids Res. 28:292). Illustrative codon-optimized nucleic sequences encoding the polypeptides of SEQ ID NOS:1-4 are provided in SEQ ID NOS:5-8, respectively.

(44) Thermophiles that are employed as a source of thermophile lysine decarboxylase sequences for use in the invention can be any thermophilic microorganism, including, but not limited to, the thermophiles Aeropyrum pernix, Caldococcus litoralis; thermophilic species of the genus Pyrococcus, Geobacillus, Gracilibacillus, Tepidanaerobacter, Thermosynechoccus, and Thermomicrobium; and thermophilic species of the order Aquificales, Thermotogales, Sulfolobales, Thermoproteales, Desulfurococcales, Pyrodictiales, Thermococcales, Archaeoglobales, Methanococales, Methanobacteriales, and Methanopyrales.

(45) Preparation of Recombinant Vectors

(46) Recombinant vectors for expression of a thermophilic lysine decarboxylase protein can be prepared using methods well known in the art. For example, a DNA sequence encoding a thermophilic lysine decarboxylase, can be combined with transcriptional and other regulatory sequences which will direct the transcription of the sequence from the gene in the intended mesophilic host cells, e.g., bacterial cells such as H. alvei, E. coli, or C. glutamicum. In some embodiments, an expression vector that comprises an expression cassette that comprises the gene encoding the thermophilic lysine decarboxylase polypeptide further comprises a promoter operably linked to the nucleic acid sequence encoding the polypeptide. In other embodiments, a promoter and/or other regulatory elements that direct transcription of the a thermophilic lysine decarboxylase polynucleotide encoding the lysine decarboxylase polypeptide are endogenous to the host cell and an expression cassette comprising the gene is introduced, e.g., by homologous recombination, such that the exogenous gene is operably linked to an endogenous promoter and expression is driven by the endogenous promoter.

(47) As noted above, expression of the polynucleotide encoding a thermophilic lysine decarboxylase variant polypeptide can be controlled by a number of regulatory sequences including promoters, which may be either constitutive or inducible; and, optionally, repressor sequences, if desired. Examples of suitable promoters, especially in a bacterial host cell, are the promoters obtained from the E. coli lac operon and other promoters derived from genes involved in the metabolism of other sugars, e.g., arabinose, xylose, rhamnose, galactose and maltose. Additional examples include promoters such as the trp promoter, bla promoter, bacteriophage lambda PL, tet promoter and T5. In addition, synthetic promoters, such as the tac promoter (U.S. Pat. No. 4,551,433), can be used. Further examples of promoters include Streptomyces coelicolor agarase gene (dagA), Bacillus subtilis levansucrase gene (sacB), Bacillus licheniformis alpha-amylase gene (amyL), Bacillus stearothermophilus maltogenic amylase gene (amyM), Bacillus amyloliquefaciens alpha-amylase gene (amyQ), Bacillus licheniformis penicillinase gene (penP), Bacillus subtilis xylA and xylB genes. Suitable promoters are also described in Ausubel and Sambrook & Russell, both supra. Additional promoters include promoters described by Jensen & Hammer, Appl. Environ. Microbiol. 64:82, 1998; Shimada, et al., J. Bacteriol. 186:7112, 2004; and Miksch et al., Appl. Microbiol. Biotechnol. 69:312, 2005.

(48) An expression vector may also comprise additional sequences that influence expression of a polynucleotide encoding a thermophilic lysine decarboxylase polypeptide. Such sequences include enhancer sequences, a ribosome binding site, or other sequences such as transcription termination sequences, and the like.

(49) A vector expressing a polynucleotide encoding a thermophilic lysine decarboxylase polypeptide of the invention may be an autonomously replicating vector, i.e., a vector which exists as an extrachromosomal entity, the replication of which is independent of chromosomal replication, e.g., a plasmid, an extrachromosomal element, a minichromosome, or an artificial chromosome. The vector may contain any means for assuring self-replication. Alternatively, the vector may be one which, when introduced into the host, is integrated into the genome and replicated together with the chromosome(s) into which it has been integrated. Thus, an expression vector may additionally contain an element(s) that permits integration of the vector into the host's genome.

(50) An expression vector of the invention preferably contains one or more selectable markers which permit easy selection of transformed hosts. For example, an expression vector may comprise a gene that confers antibiotic resistance (e.g., ampicillin, kanamycin, chloramphenicol or tetracycline resistance) to the recombinant host organism, e.g., a bacterial cell such as E. coli, H. alvei, or C. glutamicum.

(51) Although any suitable expression vector may be used to incorporate the desired sequences, readily available bacterial expression vectors include, without limitation: plasmids such as pSClOl, pBR322, pBBRlMCS-3, pUR, pET, pEX, pMRlOO, pCR4, pBAD24, p15a, pACYC, pUC, e.g., pUC18 or pUC19, or plasmids derived from these plasmids; and bacteriophages, such as M13 phage and λ phage. One of ordinary skill in the art, however, can readily determine through routine experimentation whether any particular expression vector is suited for any given host cell. For example, the expression vector can be introduced into the host cell, which is then monitored for viability and expression of the sequences contained in the vector.

(52) Expression vectors of the invention may be introduced into the host cell using any number of well-known methods, including calcium chloride-based methods, electroporation, or any other method known in the art.

(53) Host Cells

(54) The present invention provides for a genetically modified mesophilic host cell that is engineered to express a thermophilic lysine decarboxylase polypeptide. A genetically modified mesophilic host strain of the present invention typically comprises at least one additional genetic modification to enhance production of an amino acid or amino acid derivative relative to a control strain that does not have the one additional genetic modification, e.g., a wildtype strain or a cell of the same strain without the one additional genetic modification. An “additional genetic modification to enhance production of an amino acid or amino acid derivative” can be any genetic modification. In some embodiments, the genetic modification is the introduction of a polynucleotide that expresses an enzyme involved in the synthesis of the amino acid or amino acid derivative. In some embodiments, the host cell comprises multiple modifications to increase production, relative to a wildtype host cell, of an amino acid or amino acid derivative.

(55) In some aspects, genetic modification of a mesophilic host cell to express a thermophilic lysine decarboxylase polypeptide is performed in conjunction with modifying the host cell to overexpress one or more lysine biosynthesis polypeptides. The term “overexpression” in this context is used herein to refer to an increase in the amount of lysine biosynthesis polypeptide in a genetically modified cell, e.g., a cell into which an expression construct encoding a lysine biosynthesis polypeptide has been introduced, compared to the amount of polypeptide in a counterpart cell that does not have the genetic modification, i.e., a cell of the same strain without the modification. An increased level of expression is typically at least 5%, or at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, or greater, compared to the counterpart unmodified cell. The unmodified cell need not express the polypeptide. Thus, the term “overexpression” also includes embodiments in which a polypeptide is expressed in a host cell that does not natively express the polypeptide. Increased expression of a polypeptide can be assessed by any number of assays, including, but not limited to, measuring the level of RNA transcribed from the gene encoding the polypeptide, the level of polypeptide, and/or the level of polypeptide activity.

(56) In some embodiments, a host cell may be genetically modified to express one or more polypeptides that affect lysine biosynthesis. Examples of lysine biosynthesis polypeptides include the E. coli genes SucA, Ppc, AspC, LysC, Asd, DapA, DapB, DapD, ArgD, DapE, DapF, LysA, Ddh, PntAB, CyoABE, GadAB, YbjE, GdhA, GltA, SucC, GadC, AcnB, PflB, ThrA, AceA, AceB, GltB, AceE, SdhA, MurE, SpeE, SpeG, PuuA, PuuP, and YgjG, or the corresponding genes from other organisms. Such genes are known in the art (see, e.g., Shah et al., J. Med. Sci. 2:152-157, 2002; Anastassiadia, S. Recent Patents on Biotechnol. 1: 11-24, 2007). See, also, Kind, et al., Appl. Microbiol. Biotechnol. 91: 1287-1296, 2011 for a review of genes involved in cadaverine production. Illustrative genes encoding lysine biosynthesis polypeptides are provided below.

(57) TABLE-US-00001 GenBank EC Accession Protein Gene Number No. α-ketogultarate sucA 1.2.4.2 YP_489005.1 dehydrogenase (SucA) Phosphoenolpyruvate ppc 4.1.1.31 AAC76938.1 carboxylase (PPC) aspartate transaminase aspC 2.6.1.1 AAC74014.1 (AspC) aspartate kinase lysC 2.7.2.4 NP_418448.1 (LysC) aspartate semialdehyde asd 1.2.1.11 AAC76458.1 dehydrogenase (Asd) dihydrodipicolinate dapA 4.3.3.7 NP_416973.1 synthase (DapA) dihydropicolinate dapB 1.17.1.8 AAC73142.1 reductase (DapB) tetrahydrodipicoinate dapD 2.3.1.117 AAC73277.1 succinylase (DapD) N-succinyldiaminopimelate argD 2.6.1.11 AAC76384.1 aminotransferase (ArgD) N-succinyl-L-diaminopimelate dapE 3.5.1.18 AAC75525.1 deacylase (DapE) diaminopimelate dapF 5.1.1.7 AAC76812.2 epimerase (DapF) diaminopimelate lysA 4.1.1.20 AAC75877.1 decarboxylase (LysA) meso-diaminopimelate ddh NA P04964.1 dehydrogenase (Ddh) pyridine nucleotide pntAB NA AAC74675.1, transhydrogenase (PntAB) AAC74674.1 cytochrome O oxidase cyoABE 1.10.3.10 AAC73535.1, (CyoABE) AAC73534.1, AAC73531.1 glutamate decarboxylase gadAB 4.1.1.15 AAC76542.1, (GadAB) AAC74566.1 L-amino acid efflux ybjE NA AAC73961.2 transporter (YbjE) glutamate dehydrogenase gdhA 1.4.1.4 AAC74831.1 (GdhA) citrate synthase (GltA) gitA 2.3.3.1/ AAC73814.1 2.3.3.16 succinyl-coA synthase sucC 6.2.1.5 AAC73822.1 (SucC) glutamate-GABA antiporter gadC NA AAC74565.1 (GadC) aconitase B (AcnB) acnB 4.2.1.99 AAC73229.1 pyruvate-formate lyase pflB NA AAC73989.1 (PflB) aspartate kinase/homoserine thrA 2.7.2.4 AAC73113.1 dehydrogenase (ThrA) isocitrate lyase (AceA) aceA 4.1.3.1 AAC76985.1 malate synthase (AceB) aceB 2.3.3.9 AAC76984.1 glutmate synthase (GltB) gltB 1.4.1.13 AAC76244.2 pyruvate dehydrogenase (AceE) aceE 1.2.4.1 AAC73225.1 succinate dehydrogenase sdhA 1.3.5.1 AAC73817.1 (SdhA) UDP-N-acetylmuramoyl-L- murE 6.3.2.13 AAC73196.1 alanyl-D-glutamate: meso-diaminopimelate ligase (MurE) putrescine/cadaverine speE 2.5.1.16 AAC73232.1 aminopropyltransferase (SpeE) spermidine acetyltransferase speG NA AAC74656.1 (SpeG) glutamate-putrescine/glutamate- puuA NA AAC74379.2 cadaverine ligase (PuuA) putrescine importer (PuuP) puuP NA AAC74378.2 putrescine/cadaverine ygjG 2.6.1.82 AAC76108.3 aminotransferase (YgjG)

(58) In some embodiments, a host cell may be genetically modified to attenuate or reduce the expression of one or more polypeptides that affect lysine biosynthesis. Examples of such polypeptides include the E. coli genes Pck, Pgi, DeaD, CitE, MenE, PoxB, AceA, AceB, AceE, RpoC, and ThrA, or the corresponding genes from other organisms. Such genes are known in the art (see, e.g., Shah et al., J. Med. Sci. 2:152-157, 2002; Anastassiadia, S. Recent Patents on Biotechnol. 1: 11-24, 2007). See, also, Kind, et al., Appl. Microbiol. Biotechnol. 91: 1287-1296, 2011 for a review of genes attenuated to increase cadaverine production. Illustrative genes encoding polypeptides whose attenuation increases lysine biosynthesis are provided below.

(59) TABLE-US-00002 GenBank EC Accession Protein Gene Number No. PEP carboxykinase (Pck) pck 4.1.1.49 NP_417862 Glucose-6-phosphate pgi 5.3.1.9 NP_418449 isomerase (Pgi) DEAD-box RNA helicase deaD NP_417631 (DeaD) citrate lyase (CitE) citE 4.1.3.6/4.1.3.34 NP_415149 o-succinylbenzoate-CoA menE 6.2.1.26 NP_416763 ligase (MenE) pyruvate oxidase (PoxB) poxB 1.2.2.2 NP_415392 isocitrate lyase (AceA) aceA 4.1.3.1 NP_418439 malate synthase A (AceB) aceB 2.3.3.9 NP_418438 pyruvate aceE 1.2.4.1 NP_414656 dehydrogenase (aceE) RNA polymerase b′ rpoC 2.7.7.6 NP_418415 subunit (RpoC) aspartokinase I (ThrA) thrA 2.7.2.4/1.1.1.3 NP_414543

(60) Nucleic acids encoding a lysine biosynthesis polypeptide may be introduced into the host cell along with a polynucleotide encoding a thermophilic lysine decarboxylase polypeptide, e.g., encoded on a single expression vector, or introduced in multiple expression vectors at the same time. Alternatively, the host cell may be genetically modified to overexpress one or more lysine biosynthesis polypeptides before or after the host cell is genetically modified to express a thermophilic lysine decarboxylase polypeptide.

(61) In some embodiments, a mesophilic host cell that is engineered to express a thermophilic lysine decarboxylase is engineered to express one or more lysine synthetic operons comprising multiple genes that encode protein for lysine production. Such genes can be incorporated into more than one synthetic operon, e.g., each operon may comprise about 3 kb in length. Thus, for example, and illustrative lysine synthetic operons (I and II) can include six genes, such as Streptomyces lysC, E. coli dapAB, lysA, asd, aspC, and tetA nucleic acid sequences, where each operon comprises three genes.

(62) A host cell engineered to express a thermophilic lysine decarboxylase polypeptide is typically a bacterial host cell. In typical embodiments, the bacterial host cell is a Gram-negative bacterial host cell. In some embodiments of the invention, the bacterium is an enteric bacterium. In some embodiments of the invention, the bacterium is a species of the genus Corynebacterium, Escherichia, Pseudomonas, Zymomonas, Shewanella, Salmonella, Shigella, Enterobacter, Citrobacter, Cronobacter, Erwinia, Serratia, Proteus, Hafnia, Yersinia, Morganella, Edwardsiella, or Klebsiella taxonomical classes. In some embodiments, the host cells are members of the genus Escherichia, Hafnia, or Corynebacterium. In some embodiments, the host cell is an Escherichia coli, Hafnia alvei, or Corynebacterium glutamicum host cell. In some embodiments, the host cell is Escherichia coli. In some embodiments, the host cell is Hafnia alvei. In some embodiments, the host cell is Corynebacterium glutamicum.

(63) In some embodiments, the host cell is a gram-positive bacterial host cell, such as a Bacillus sp., e.g., Bacillus subtilis or Bacillus licheniformis; or another Bacillus sp. such as B. alcalophilus, B. aminovorans, B. amyloliquefaciens, B. caldolyticus, B. circulans, B. stearothermophilus, B. thermoglucosidasius, B. thuringiensis or B. vulgatis.

(64) Host cells modified in accordance with the invention can be screened for increased production of lysine or a lysine derivative, such as cadaverine, as described herein.

(65) In some embodiments, a thermophilic lysine decarboxylase polypeptide may be recovered from a host cell that expresses the variant polypeptide. In some embodiments, the recovered variant protein may be immobilized onto a solid substrate or inert material.

(66) Methods of Producing a Lysine Derivative.

(67) As used herein, the terms “about” when used to modify a numeric value in a temperature range indicates that the numeric value as reasonable deviations from the value e.g., within 1° or 2° below or above the value recited in the range, are within the intended meaning of the recited value or range.

(68) A mesophilic host cell genetically modified to express a thermophilic lysine decarboxylase polypeptide can be employed to produce lysine or a derivative of lysine, such as cadaverine. To produce cadaverine, a host cell genetically modified to express a thermophilic lysine decarboxylase polypeptide as described herein can be cultured under conditions suitable to allow expression of the polypeptide and expression of genes that encode the enzymes that are used to produce lysine. Culture of the mesophilic host cell to produce lysine is conducted at a temperature that is suitable for growth of mesophilic host cells. In some embodiments, the mesophilic host cell is cultured at a temperature from about 20° C. to about 50° C. In some embodiments, the host is cultured at a temperature of from about 25° C. to about 45° C. In some embodiments, the mesophilic host cell is cultured at a temperature of from about 30° C. to about 42° C. or from about 30° C. to about 40° C. The host cell is typically cultured at the temperature that is suitable to produce lysine for a time period sufficient such that lysine production is complete. In typical embodiments, the cells are allowed to grow until stationary phase at which point the amount of glucose in the medium may be monitored. The culture is then shifted at the desired time, e.g., when glucose is minimally detected, to a higher temperature at which the thermophilic lysine decarboxylase is active.

(69) As describe above, culture of the genetically modified host cell at a temperature suitable for growth of a mesophile to produce lysine is then followed by incubation of the host cells at a temperature at which the thermophilic lysine decarboxylase is active, e.g., at a temperature of above about 55° C., but less than about 110° C. In some embodiments, the cells are cultured at a temperature ranging from above about 55° C. to about 90° C. In some embodiments, the cells are cultured at a temperature ranging from about 60° C. to about 70° C.

(70) Culture of the mesophilic host cell modified in accordance with the invention at a lower temperature suitable for mesophilic cell growth for a time period sufficient to accumulate lysine followed by culture at a temperature suitable to support activity of the thermophilic lysine decarboxylase expressed by the host cells improves lysine production, e.g., by reducing toxic side effects of lysine decarboxylase activity on cell growth.

(71) Host cells may be cultured using well known techniques (see, e.g., the illustrative conditions provided in the examples section.)

(72) In some embodiments, host cells are cultured using nitrogen sources that are not salts (e.g., ammonium sulfate or ammonium chloride), such as ammonia or urea.

(73) The lysine or lysine derivative then be separated and purified using known techniques. Lysine or lysine derivatives, e.g., cadverine, produced in accordance with the invention may then be used in any known process, e.g., to produce a polyamide.

(74) In some embodiments, lysine may be converted to caprolactam using chemical catalysts or by using enzymes and chemical catalysts.

(75) The present invention will be described in greater detail by way of specific examples. The following examples are offered for illustrative purposes, and are not intended to limit the invention in any manner. Those of skill in the art will readily recognize a variety of noncritical parameters, which can be changed or modified to yield essentially the same results.

EXAMPLES

Example 1: Construction of Plasmid Vectors that Encode CadA

(76) A plasmid vector containing wild-type E. coli cadA (SEQ ID NO:10), which encodes the lysine decarboxylase CadA (SEQ ID NO:9), was amplified from the E. coli MG1655 K12 genomic DNA using the PCR primers cadA-F and cadA-R, digested using the restriction enzymes SacI and XbaI, and ligated into pUC18 to generate the plasmid pCIB60. The 5′ sequence upstream of the cadA gene was optimized using the PCR primers cadA-F2 and cadA-R2 to create pCIB71. The chloramphenicol resistance gene cat was amplified using the primers cat-HindIII-F and cat-NdeI-R, and cloned behind cadA in pCIB71 to create pCIB128.

Example 2: Construction of a Plasmid Vector Expressing a Lysine Decarboxylase Polypeptide from Tepidanaerobacter syntrophicus

(77) The amino acid sequence of lysine decarboxylase from T. syntrophicus (TsLDC) was obtained from NCBI (GenBank ID GAQ24853.1). The nucleic acid encoding TsLDC was codon optimized (SEQ ID NO:5) for heterologous expression of the protein (SEQ ID NO:1) in E. coli. Codon optimization and DNA assembly was performed according to Hoover D M & Lubkowski J, Nucleic Acids Research 30:10, 2002. The synthesized DNA product was amplified with the PCR primers TsLDC-SacI-F and TsLDC-XbaI-R, digested using the restriction enzymes SacI and XbaI, and ligated into pUC18. The 5′ sequence upstream of the TsLDC gene was optimized using the PCR primers TsLDC-F and cadA-R2 to create plasmid pCIB370.

Example 3: Construction of a Plasmid Vector Expressing a Lysine Decarboxylase Polypeptide from Geobacillus kaustophilus

(78) The amino acid sequence of lysine decarboxylase from G. kaustophilus (GkLDC) was obtained from NCBI (GenBank ID BAD75350.1). The nucleic acid sequence encoding GkLDC sequence was codon optimized (SEQ ID NO:6) for heterologous expression of the protein (SEQ ID NO:2) in E. coli. Codon optimization and DNA assembly was performed according to Hoover D M & Lubkowski J, Nucleic Acids Research 30:10, 2002. The synthesized DNA product was amplified with the PCR primers GkLDC-SacI-F and GkLDC-XbaI-R, digested using the restriction enzymes SacI and XbaI, and ligated into pUC18. The 5′ sequence upstream of the GkLDC gene was optimized using the PCR primers GkLDC-F and cadA-R2 to create plasmid pCIB371.

Example 4: Construction of a Plasmid Vector Expressing a Lysine Decarboxylase Polypeptide from Thermosynechoccus elongatus

(79) The amino acid sequence of lysine decarboxylase from T. elongatus (TeLDC) was obtained from NCBI (GenBank ID BAC09418.1). The nucleic acid sequence encoding TeLDC sequence was codon optimized (SEQ ID NO:7) for heterologous expression of the protein (SEQ ID NO:3 in E. coli. Codon optimization and DNA assembly was performed according to Hoover D M & Lubkowski J, Nucleic Acids Research 30:10, 2002. The synthesized DNA product was amplified with the PCR primers TeLDC-SacI-F and TeLDC-XbaI-R, digested using the restriction enzymes SacI and XbaI, and ligated into pUC18. The 5′ sequence upstream of the TeLDC gene was optimized using the PCR primers TeLDC-F and cadA-R2 to create plasmid pCIB372.

Example 5: Construction of a Plasmid Vector Expressing a Lysine Decarboxylase Polypeptide from Thermomicrobium roseum

(80) The amino acid sequence of lysine decarboxylase from T. roseum (TrLDC) was obtained from NCBI (GenBank ID ACM05730.1). The nucleic acid sequence encoding TrLDC was codon optimized (SEQ ID NO:8) for heterologous expression of the protein (SEQ ID NO:4) in E. coli. Codon optimization and DNA assembly was performed according to Hoover D M & Lubkowski J, Nucleic Acids Research 30:10, 2002. The synthesized DNA product was amplified with the PCR primers TrLDC-SacI-F and TrLDC-XbaI-R, digested using the restriction enzymes SacI and XbaI, and ligated into pUC18. The 5′ sequence upstream of the TrLDC gene was optimized using the PCR primers TrLDC-F and cadA-R2 to create plasmid pCIB373.

Example 6: Comparison of Lysine Decarboxylase Activity at 37° C. and 65° C.

(81) E. coli BL21 was transformed with the plasmids pCIB71, pCIB370, pCIB371, pCIB372, or pCIB373. A single colony from each transformation was grown overnight at 37° C. in 100 mL of LB medium with carbenicillin (100 μg/mL). The following day, each sample was lysed with a french press. The lysed samples were centrifuged, and the supernatant was separated from the pellet in order to perform in vitro experiments. Equal amounts of enzyme from each sample were incubated at either 37° C. or 65° C. for 4 hours with lysine-HCl and PLP to a final concentration of 160 g/L and 0.1 mM, respectively. Cadaverine production from each sample was quantified using NMR, and yield was calculated by dividing the molar amount of cadaverine produced by the molar amount of lysine added. The yield from each sample is presented in Table 1.

(82) TABLE-US-00003 TABLE 1 Production of cadaverine by lysine decarboxylases from E. coli, T. syntrophicus, G. kaustophilus, T. elongates, and T. roseum. Cadaverine Yield (%) Strain Plasmid Enzyme 37° C. 65° C. E. coli pCIB71 CadA 60.0 ± 2.2  10.0 ± 4.3 BL21 pCIB370 TsLDC 5.2 ± 3.1 30.8 ± 3.7 pCIB371 GkLDC 7.9 ± 2.4 35.2 ± 5.2 pCIB372 TeLDC 6.1 ± 1.9 28.1 ± 4.7 pCIB373 TrLDC 3.0 ± 1.2 40.3 ± 3.6

(83) Table 1 shows that wild-type mesophilic lysine decarboxylase CadA (pCIB71) shows significantly higher activity at 37° C. compared to 65° C. However, the plasmids harboring lysine decarboxylase from thermophilic microorganisms (pCIB370-373) show higher activity at 65° C. compared to 37° C. Even though the activity of the thermophilic lysine decarboxylase at 65° C. is not as high as the activity of the mesophilic lysine decarboxylase at 37° C., the activity is still higher than that of the mesophilic enzyme at 65° C.

Example 7: Comparison of Lysine Decarboxylase Stability at 37° C. and 65° C.

(84) The activities of lysine decarboxylases were determined following incubation for different periods of time at 37° C. and 65° C., in order to determine whether the enzymes are able to maintain the structural integrity at different temperatures necessary for function. E. coli BL21 was transformed with the plasmids pCIB71, pCIB370, pCIB371, pCIB372, or pCIB373. A single colony from each transformation were grown overnight at 37° C. in 100 mL of LB medium with carbenicillin (100 μg/mL). The following day, each sample was lysed with a french press. The lysed samples were centrifuged, and the supernatant was separated from the pellet in order to perform in vitro experiments. Equal amounts of enzyme from each sample were incubated at 37° C. for 20, 30, and 40 hours. After incubation at the specific temperature and for the specific time period, the samples were incubated at either 37° C. or 65° C. for 4 hours with lysine-HCl and PLP to a final concentration of 160 g/L and 0.1 mM, respectively. Cadaverine production from each sample was quantified using NMR, and yield was calculated by dividing the molar amount of cadaverine produced by the molar amount of lysine added. The yield from each sample is presented in Table 2.

(85) TABLE-US-00004 TABLE 2 Production of cadaverine by different lysine decarboxylases following incubation at 37° C. for different amounts of time. Reaction Incubation Time (h) Strain Plasmid Enzyme Temp (° C.) 0 20 30 40 E. coli pCIB71 CadA 37 60 42 37 25 BL21 65 10 7 5 4 pCIB370 TsLDC 37 5 7 6 5 65 31 30 28 29 pCIB371 GkLDC 37 8 6 4 5 65 35 33 33 30 pCIB372 TeLDC 37 6 7 5 5 65 28 28 29 27 pCIB373 TrLDC 37 3 5 4 3 65 40 39 39 37

(86) Table 2 shows that mesophilic CadA stability at 37° C. is the lowest out of the six proteins tested. Its activity at 37° C. decreased by more than 50% after incubation for 40 hours. Its activity at 65° C. also decreased significantly compared to that at 37° C. The lysine decarboxylases from thermophilic microorganisms all show little activity at 37° C., similar to CadA activity at 65° C. However, the lysine decarboxylases from thermophilic microorganisms all show relatively stable activity at 65° C. even after 40 hours of incubation at 37° C. This suggests that production and maintenance of the lysine decarboxylases from thermophilic microorganisms can be performed at 37° C. without much effect on its activity at 65° C.

Example 8: Production of Cadaverine from E. coli Co-Overexpressing Genes that Encode a Thermophilic Lysine Decarboxylase, and the Lysine Synthetic Operons I and II at 37° C.

(87) CIB103-3 (FROM MODIFIED MEMBRANE PERMEABILITY PCT/CN2015/094121 OR WO2017079872A1) was transformed with pCIB71, pCIB370, pCIB371, pCIB372, or pCIB373. Three single colonies from each transformation were grown overnight at 37° C. in 4 mL of medium containing 4% glucose, 0.1% KH.sub.2PO.sub.4, 0.1% MgSO.sub.4, 1.6% (NH.sub.4).sub.2SO.sub.4, 0.001% FeSO.sub.4, 0.001% MnSO.sub.4, 0.2% yeast extract, 0.05% L-methionine, 0.01% L-threonine, 0.005% L-isoleucine, tetracycline (10 μg/mL), and carbenicillin (100 μg/mL). The following day, each culture was inoculated into 50 mL of fresh medium with 0.7% CaCO.sub.3 and grown for 72 hours at 37° C., at which point the concentrations of lysine and cadaverine in each culture were determined (Table 3).

(88) TABLE-US-00005 TABLE 3 Production of lysine and cadaverine by E. coli strains containing Synthetic Operons I and II, and co-producing lysine decarboxylases at 37° C. Lysine Cadaverine Plasmids Protein(s) (g/L) (g/L) pCIB103-3 S-LysC, DapA, LysA, Asd, 6.3 ± 0.1 N.D. DapB, AspC, TetA pCIB103-3, S-LysC, DapA, LysA, Asd, 0.4 ± 0.2 5.7 ± 0.2 pCIB71 DapB, AspC, TetA, CadA pCIB103-3, S-LysC, DapA, LysA, Asd, 5.9 ± 0.1 N.D. pCIB370 DapB, AspC, TetA, TsLDC pCIB103-3, S-LysC, DapA, LysA, Asd, 6.0 ± 0.2 0.8 ± 0.3 pCIB371 DapB, AspC, TetA, GkLDC pCIB103-3, S-LysC, DapA, LysA, Asd, 6.1 ± 0.3 0.5 ± 0.2 pCIB372 DapB, AspC, TetA, TeLDC pCIB103-3, S-LysC, DapA, LysA, Asd, 6.0 ± 0.2 N.D. pCIB373 DapB, AspC, TetA, TrLDC

(89) As shown in Table 3, the overexpression of the mesophilic lysine decarboxylase CadA (pCIB103-3, pCIB71) in a host able to produce lysine leads to the production of cadaverine with trace amounts of lysine when the host cell is grown at 37° C. The overexpression of the thermophilic lysine decarboxylases (pCIB103-3, pCIB370-373) leads to lysine accumulation with little to no cadaverine produced, like the control host that does not overexpress any lysine decarboxylase (pCIB103-3).

Example 9: Production of Cadaverine from E. coli Co-Overexpressing Genes that Encode a Thermophilic Lysine Decarboxylase, and the Lysine Synthetic Operons I and II at 65° C.

(90) CIB103-3 was transformed with pCIB71, pCIB370, pCIB371, pCIB372, or pCIB373. Three single colonies from each transformation were grown overnight at 37° C. in 4 mL of medium containing 4% glucose, 0.1% KH.sub.2PO.sub.4, 0.1% MgSO.sub.4, 1.6% (NH.sub.4).sub.2SO.sub.4, 0.001% FeSO.sub.4, 0.001% MnSO.sub.4, 0.2% yeast extract, 0.05% L-methionine, 0.01% L-threonine, 0.005% L-isoleucine, tetracycline (10 μg/mL), and carbenicillin (100 μg/mL). The following day, each culture was inoculated into 50 mL of fresh medium with 0.7% CaCO.sub.3 and grown for 48 hours at 37° C., at which point the culturing temperature was increased to 65° C. The cells were cultured for an additional 24 hours, after which the concentrations of lysine and cadaverine in each culture were determined (Table 4).

(91) TABLE-US-00006 TABLE 4 Production of lysine and cadaverine by E. coli strains containing Synthetic Operons I and II, and co-producing lysine decarboxylases at 65° C. Lysine Cadaverine Plasmids Protein(s) (g/L) (g/L) pCIB103-3 S-LysC, DapA, LysA, Asd, 6.0 ± 0.1 N.D. DapB, AspC, TetA pCIB103-3, S-LysC, DapA, LysA, Asd, 0.2 ± 0.1 5.5 ± 0.3 pCIB71 DapB, AspC, TetA, CadA pCIB103-3, S-LysC, DapA, LysA, Asd, 0.4 ± 0.2 5.9 ± 0.2 pCIB370 DapB, AspC, TetA, TsLDC pCIB103-3, S-LysC, DapA, LysA, Asd, 0.3 ± 0.2 6.0 ± 0.3 pCIB371 DapB, AspC, TetA, GkLDC pCIB103-3, S-LysC, DapA, LysA, Asd, 0.3 ± 0.1 5.8 ± 0.2 pCIB372 DapB, AspC, TetA, TeLDC pCIB103-3, S-LysC, DapA, LysA, Asd, 0.2 ± 0.1 6.0 ± 0.1 pCIB373 DapB, AspC, TetA, TrLDC

(92) As shown in Table 4, the incubation of the host cells at 65° C. during the final 24 hours of the fermentation led to no significant change in lysine or cadaverine production when no lysine decarboxylase was overexpressed (pCIB103-3), or when the mesophilic CadA was overexpressed. However, overexpression of the thermophilic lysine decarboxylases (pCIB103-3, pCIB370-373) led to the accumulation of cadaverine instead of lysine in the fermentation media after the host cells were incubated at 65° C. for a period of time.

(93) TABLE-US-00007 Table of plasmids used in Examples Protein(s) Host Overexpressed Plasmid CadA pCIB71 CadA, Cat pCIB128 TsLDC pCIB370 GkLDC pCIB371 TeLDC pCIB372 TrLDC pCIB373 S-LysC, DapA, LysA, Asd, pCIB103-3 DapB, AspC, TetA E. coli CadA pCIB71 E. coli TsLDC pCIB370 E. coli GkLDC pCIB371 E. coli TeLDC pCIB372 E. coli TrLDC pCIB373 E. coli S-LysC, DapA, LysA, Asd, pCIB103-3 DapB, AspC, TetA E. coli S-LysC, DapA, LysA, Asd, pCIB103-3, DapB, AspC, TetA, CadA pCIB71 E. coli S-LysC, DapA, LysA, Asd, pCIB103-3, DapB, AspC, TetA, TsLDC pCIB370 E. coli S-LysC, DapA, LysA, Asd, pCIB103-3, DapB, AspC, TetA, GkLDC pCIB371 E. coli S-LysC, DapA, LysA, Asd, pCIB103-3, DapB, AspC, TetA, TeLDC pCIB372 E. coli S-LysC, DapA, LysA, Asd, pCIB103-3, DapB, AspC, TetA, TrLDC pCIB373

(94) TABLE-US-00008 Table of primer sequences used in Examples. Name Sequence (5′-3′) cadA-F ggcgagctcacacaggaaacagaccatgaacgttat (SEQ ID NO: 11) tgcaatattgaatcac cadA-R ggctctagaccacttcccttgtacgagc (SEQ ID NO: 12) cadA-F2 atttcacacaggaaacagctatgaacgttattgcaa (SEQ ID NO: 13) tattgaat cadA-R2 agctgtttcctgtgtgaaat (SEQ ID NO: 14) cat-HindIII-F ggcaagcttgagaaaaaaatcactggatatacc (SEQ ID NO: 15) cat-NdeI-R ggccatatgtaagggcaccaataactgcc (SEQ ID NO: 16) TsLDC-SacI-F ggcgagctcatggagaagcaagagattaacaag (SEQ ID NO: 17) TsLDC-XbaI-R ggctctagattagaaatcggttacaacctgaatg (SEQ ID NO: 18) TsLDC-F atttcacacaggaaacagctatggagaagcaagag (SEQ ID NO: 19) attaacaag GkLDC-SacI-F ggcgagctcatgtctcagctcgagacccctc (SEQ ID NO: 20) GkLDC-XbaI-R ggctctagattaacgaattggtttgtattctttaa (SEQ ID NO: 21) tgac GkLDC-F atttcacacaggaaacagctatgtctcagctcgag (SEQ ID NO: 22) acccctc TeLDC-SacI-F ggcgagctcatggaacctctgctgcgtgc (SEQ ID NO: 23) TeLDC-XbaI-R ggctctagattaaactttgcagatacgcagag (SEQ ID NO: 24) TeLDC-F atttcacacaggaaacagctatggaacctctgctg (SEQ ID NO: 25) cgtgc TrLDC-SacI-F ggcgagctcatgtctgaagaacagcaacg (SEQ ID NO: 26) TrLDC-XbaI-R ggctctagattaggcacgaacgacacgga (SEQ ID NO: 27) TrLDC-F atttcacacaggaaacagctatgtctgaagaacag (SEQ ID NO: 28) caacg
Illustrative Nucleic Acid an Polypeptide Sequences:

(95) TABLE-US-00009 T. syntrophicus lysine decarboxylase polypeptide sequence- underlined residues are representative conserved or semi- conserved residues compared to CadA SEQ ID NO: 1 MEKQEINKFSKTPLIQALKEYEKKDSLRFHMPGHKGRCPKGVFCDIKENLFGWDVTEIPG LDDFAQPEGPIKEAQEKLSALYGADTSYFLVNGATSGIISMMAGALSEKDKILIPRTSHKS VLSGLILTGASAAYIMPERCEELGVYAQVEPCAITNKLIENPDIKAILVTNPVYQGFCPDIA RVAEIAKERGTTLLADEAQGPHFGFSKKVPQSAGKFADAWVQSPHKMLTSLTQSAWLHI KGNRIDKERLEDFLHIVTTSSPSYILMASLDGTRELIEENGNSYIEKAVELAQKARYEINNS TVFYAPGQEILGKYGISSQDPLHLMVNVSCAGYTGYDIEKALREDFSIYAEYADLCNVYF LITFSNTLEDIKGLLAVLSHFKPLKNKVKPCFWIKDLPKVALEPKKAFKLPAKSVPFKDSA GSVSKRPLVPYPPGAPLVMPGEIIEKEHIEMINEILNSGGYCQGVTSEKFIQVVTDF G. kaustophilus lysine decarboxylase polypeptide sequence-- underlined residues are representative conserved or semi- conserved residues compared to CadA SEQ ID NO: 2 MSQLETPLFTGLLEHMKKNPVQFHIPGHKKGAGMDPEFRAFIGDNALAIDLINISPLDDL HHPKGMIKRAQELAAEAFGADYTFFSVQGTSGAIMTMVMSVAGPGDKIIVPRNVHKSV MSAIVFSGATPIFIHPEIDKELGISHGITPQAVEKALRQHPDAKGVLVINPTYFGIAGDLKKI VDIAHSYNVPVLVDEAHGVHIHFHEDLPLSAMQAGADMAATSVHKLGGSLTQSSILNVR EGLVSAKHVQAILSMLTTTSTSYLLLASLDVARKQLATKGRELIDKAIRLADWTRRQINE IPYLYCVGEEILGTEATYDYDPTKLIISVKELGLTGHDVERWLRETYNIEVELSDLYNILCI ITPGDTEREASLLVEALRRLSKQFSHQAEKGIKPKVLLPDIPALALTPRDAFYAETEVVPF HESAGRIIAEFVMVYPPGIPIFIPGEIITEENLKYIETNLAAGLPVQGPEDDTLQTLRVIKEY KPIR T. elongates lysine decarboxylase polypeptide sequence-- underlined residues are representative conserved or semi- conserved residues compared to CadA SEQ ID NO: 3 MEPLLRALWGTALEQDLSELPGLDNLAQPTGVLAEAQAVVAATVGSDRAWFLVNGAT GGLLAALLATVGPGDRVLVGRNVHRSVIAGLVLAGAKPVYLGVGVDPQWGLPWPVTR DVVAAGLAAYPDTKAVVLVSPTYEGLCSPLLEIAQCVHNHGVPLIVDEAHGSHFAYHPA FPVTALAAGADVVVQSWHKTLGTLTQTAVLHLKGERVSAERLSQALNLVQTSSPNYWL LAALEGAGVQMAQQGEQIYGRLLQWVKTFEWPLPRWQPPGIPQDPLRLTLGTWPIGLT GFALDELLQPQIIAEFPSGRSLTFCLGLGTTQTMLETLADRLKSVYTEYCHNAPLPPLAIPS IPSCQEPALSPREAYFCPQRSIPLRAALNEISAETIAPYPPGIPTVIAGERFTESVIATLQTLQ ELGAEMVGASDPTLQTLRICKV T. roseum lysine decarboxylase polypeptide sequence--T. elongates lysine decarboxylase polypeptide sequence-- underlined residues are representative conserved or semi-conserved residues compared to CadA SEQ ID NO: 4 MSEEQQRAPYLEQWLAYVDECVIPFTTPGHKQGRGAPPEFVAAFGERALALDIPHDGGT FDAHLEHDPLVAAERLAAALWGARDAVFLVNGSTTGNLAALLTLGRPGQPIVVTRAMH KSLLAGLVLSGARPVYVVPAVHPESGILLDLPPESVAQALAAWPDATAVALVSPTYTGV TSDTAELAALCHAHGVPLFVDEAWGPHLPFHPALPAAAIPSGADLAVTSLHKLAGSLTQ TALLLMAGNLVDQAQLRAATAMVQTTSPAAFLYASLDAARRRLALEGEQLLARTLELA EHARRELAAIPGLEVVGPEIVAGRPGAGFDRTRLVVDVQGFGLTGLEVKRILRRDFRIAA EMADLVSVVFLITIGDTPETIAALVAAFRALAADRTRPDCAAGRRAVRALLRSTGPIVAG APQAMTPREAFFAPAERVPLADAVGRVAAEPVTPYPPGIPVLAPGEVVRPEVVEFLQAG RAAGMRFNGASDPTLATLRVVRA T. syntrophicus lysine decarboxylase codon-optimized nucleic acid sequence SEQ ID NO: 5 ATGGAGAAGCAAGAGATTAACAAGTTCTCTAAGACCCCGCTCATCCAAGCGCTGAA AGAATACGAGAAAAAGGATTCTCTGCGTTTCCACATGCCAGGTCACAAAGGCCGTTG TCCAAAAGGTGTTTTTTGCGATATTAAGGAGAACCTGTTCGGTTGGGATGTTACCGA AATCCCGGGTCTGGATGACTTCGCTCAACCGGAAGGTCCGATCAAGGAAGCACAGG AGAAACTGTCTGCGCTGTACGGTGCCGACACCTCCTATTTCCTCGTTAATGGTGCAAC CTCTGGTATCATTTCTATGATGGCGGGTGCTCTGTCCGAAAAGGACAAAATCCTGAT CCCGCGTACCAGCCATAAGAGCGTACTCTCTGGTCTGATTCTCACTGGCGCCTCTGCG GCGTACATCATGCCGGAGCGTTGCGAAGAGCTGGGTGTTTACGCACAGGTGGAACCT TGTGCCATCACCAACAAACTGATCGAGAACCCGGATATCAAAGCGATTCTGGTTACC AACCCAGTGTACCAGGGTTTCTGCCCGGACATCGCGCGTGTTGCGGAAATCGCGAAA GAACGCGGTACCACCCTGCTCGCAGACGAAGCGCAAGGCCCACATTTCGGCTTTTCC AAGAAAGTTCCGCAGTCTGCGGGTAAGTTCGCGGATGCGTGGGTTCAGTCCCCTCAC AAAATGCTGACGAGCCTGACCCAATCTGCGTGGCTGCACATCAAGGGCAATCGTATC GACAAGGAACGTCTGGAAGACTTTCTCCACATCGTTACCACCTCTTCTCCGTCTTACA TCCTCATGGCGTCTCTGGACGGTACCCGCGAGCTGATTGAAGAAAACGGTAACTCCT ACATTGAAAAGGCGGTTGAACTGGCTCAGAAAGCGCGTTATGAAATCAACAACTCT ACTGTTTTCTACGCGCCAGGCCAGGAGATTCTCGGTAAATACGGTATTTCTTCTCAGG ACCCGCTGCATCTGATGGTTAATGTTTCTTGCGCGGGTTACACGGGCTACGACATCG AAAAAGCCCTGCGTGAGGACTTTTCTATCTACGCCGAATACGCGGACCTGTGTAACG TTTACTTCCTCATTACGTTTAGCAATACCCTGGAGGACATTAAAGGTCTCCTCGCGGT TCTGTCTCACTTCAAACCGCTCAAAAACAAAGTTAAACCGTGCTTCTGGATCAAAGA CCTGCCGAAAGTTGCGCTGGAGCCAAAGAAGGCGTTCAAACTGCCGGCGAAATCTG TGCCTTTCAAAGATTCTGCTGGTAGCGTTTCTAAACGCCCGCTGGTTCCGTATCCGCC AGGTGCGCCACTCGTGATGCCGGGTGAGATCATTGAGAAAGAGCACATCGAGATGA TTAATGAAATTCTCAACTCTGGCGGCTACTGCCAGGGTGTTACGTCTGAAAAGTTCA TTCAGGTTGTAACCGATTTCTAA G. kaustophilus lysine decarboxylase codon-optimized nucleic acid sequence SEQ ID NO: 6 ATGTCTCAGCTCGAGACCCCTCTGTTCACCGGTCTGCTCGAACACATGAAGAAAAAC CCGGTCCAGTTTCACATTCCAGGTCACAAGAAAGGTGCTGGTATGGACCCTGAGTTC CGTGCGTTTATCGGTGATAACGCGCTCGCGATCGACCTGATCAACATCTCCCCTCTCG ACGACCTCCACCACCCGAAAGGCATGATCAAACGTGCGCAGGAACTGGCTGCGGAA GCGTTTGGCGCGGACTACACGTTCTTCAGCGTTCAAGGCACCAGCGGTGCCATCATG ACGATGGTAATGTCTGTTGCGGGTCCGGGCGATAAGATCATCGTCCCTCGTAACGTT CACAAATCTGTTATGTCTGCCATCGTTTTCTCTGGCGCGACCCCTATTTTCATCCACC CGGAAATCGATAAGGAGCTGGGTATTAGCCACGGTATTACCCCGCAGGCCGTGGAG AAAGCCCTGCGTCAACACCCTGATGCTAAAGGCGTTCTGGTAATCAACCCGACTTAT TTCGGTATCGCGGGTGACCTCAAAAAGATCGTTGACATCGCGCACTCTTATAATGTG CCGGTCCTGGTAGATGAAGCGCACGGTGTTCATATTCACTTCCACGAGGACCTCCCA CTCAGCGCAATGCAGGCGGGTGCGGATATGGCGGCGACGTCCGTGCACAAGCTGGG CGGTAGCCTGACTCAGTCTTCCATTCTGAACGTACGCGAAGGTCTGGTTTCTGCTAAA CACGTGCAAGCGATTCTCTCTATGCTGACCACCACTTCTACCTCTTATCTGCTGCTGG CTTCCCTGGACGTAGCGCGTAAACAGCTGGCAACCAAAGGTCGTGAACTCATCGACA AAGCCATCCGCCTCGCGGATTGGACCCGTCGCCAGATTAACGAGATCCCGTACCTCT ACTGCGTGGGTGAAGAGATCCTGGGTACCGAAGCAACCTACGACTACGATCCGACT AAACTGATCATCAGCGTAAAAGAACTCGGTCTCACTGGCCATGACGTTGAGCGTTGG CTCCGTGAAACCTACAATATCGAAGTTGAACTGTCTGACCTCTATAACATCCTCTGCA TCATCACCCCGGGTGATACTGAGCGCGAAGCGTCTCTCCTGGTGGAAGCACTGCGCC GTCTGTCTAAACAATTCTCCCATCAGGCCGAAAAGGGTATCAAACCTAAGGTTCTCC TGCCGGATATTCCTGCCCTCGCCCTGACGCCTCGTGACGCGTTCTATGCGGAAACCG AAGTCGTTCCGTTCCATGAGTCCGCCGGTCGTATCATCGCGGAGTTTGTAATGGTTTA CCCACCGGGCATCCCAATCTTCATCCCTGGCGAGATTATCACTGAGGAAAACCTGAA ATACATCGAAACCAACCTGGCGGCTGGCCTCCCGGTTCAGGGCCCAGAAGACGACA CGCTGCAGACCCTCCGTGTCATTAAAGAATACAAACCAATTCGTTAA T. elongates lysine decarboxylase codon-optimized nucleic acid sequence SEQ ID NO: 7 ATGGAACCTCTGCTGCGTGCGCTGTGGGGTACTGCACTCGAACAAGACCTGTCTGAG CTGCCGGGTCTCGATAACCTGGCGCAACCGACCGGTGTTCTCGCAGAAGCGCAGGCT GTTGTTGCGGCAACTGTAGGTTCTGACCGTGCGTGGTTTCTGGTTAATGGTGCAACG GGCGGTCTCCTCGCCGCACTCCTGGCCACCGTAGGTCCTGGTGATCGTGTGCTGGTTG GCCGTAATGTTCACCGTTCTGTTATCGCAGGTCTCGTTCTGGCAGGTGCAAAGCCGGT TTACCTGGGTGTTGGTGTAGATCCGCAATGGGGTCTGCCGTGGCCGGTAACTCGTGA TGTGGTAGCCGCTGGTCTGGCCGCATATCCGGACACCAAAGCGGTTGTGCTCGTTTC TCCGACGTATGAAGGCCTGTGCAGCCCACTGCTGGAGATCGCGCAATGCGTTCACAA CCACGGTGTCCCGCTGATCGTTGACGAAGCACATGGTTCTCACTTCGCGTATCACCC AGCTTTCCCGGTGACGGCGCTCGCTGCTGGCGCTGACGTTGTCGTACAGTCTTGGCAT AAAACCCTGGGTACGCTGACCCAGACGGCGGTTCTCCACCTCAAAGGTGAGCGTGTT TCCGCCGAACGTCTGTCTCAGGCTCTGAACCTGGTTCAAACCTCTTCCCCGAACTACT GGCTGCTCGCAGCACTGGAAGGTGCAGGCGTCCAAATGGCTCAGCAGGGTGAGCAG ATTTACGGTCGCCTGCTCCAGTGGGTAAAGACCTTCGAATGGCCACTCCCGCGTTGG CAGCCGCCTGGCATCCCTCAGGACCCTCTCCGTCTCACTCTGGGCACTTGGCCTATTG GTCTGACGGGTTTCGCGCTCGACGAACTCCTCCAGCCGCAGATCATCGCGGAGTTCC CGTCCGGTCGTTCCCTCACGTTTTGCCTCGGTCTCGGTACCACCCAAACCATGCTCGA AACGCTGGCGGACCGCCTGAAATCTGTTTACACCGAATACTGCCACAACGCCCCTCT GCCTCCTCTCGCGATTCCATCTATCCCGTCTTGCCAGGAACCTGCTCTCAGCCCGCGT GAAGCGTACTTCTGCCCGCAGCGCTCTATTCCGCTCCGCGCAGCTCTCAACGAAATC TCTGCGGAGACCATCGCGCCGTATCCACCGGGTATCCCGACCGTGATCGCGGGTGAA CGTTTCACGGAATCTGTCATCGCAACCCTCCAGACCCTGCAAGAACTCGGTGCAGAA ATGGTCGGTGCGAGCGACCCTACGCTGCAGACTCTGCGTATCTGCAAAGTTTAA T. roseum lysine decarboxylase codon-optimized nucleic acid sequence SEQ ID NO: 8 ATGTCTGAAGAACAGCAACGTGCTCCGTACCTGGAGCAATGGCTGGCGTACGTTGAC GAGTGCGTTATCCCGTTTACCACTCCGGGTCACAAACAAGGTCGCGGTGCGCCACCG GAGTTCGTTGCGGCGTTCGGTGAACGTGCGCTCGCTCTGGACATTCCGCATGACGGT GGCACCTTTGACGCGCATCTGGAACATGACCCGCTCGTTGCCGCCGAACGTCTGGCT GCCGCACTGTGGGGTGCACGCGATGCGGTGTTTCTGGTTAACGGTTCCACCACTGGT AACCTGGCGGCTCTGCTCACTCTCGGTCGCCCAGGTCAGCCGATTGTTGTTACTCGTG CCATGCATAAGAGCCTGCTGGCAGGTCTGGTCCTGAGCGGTGCTCGCCCTGTCTACG TTGTACCGGCCGTACACCCAGAATCCGGTATCCTCCTCGATCTCCCTCCGGAATCTGT TGCGCAGGCGCTGGCCGCGTGGCCTGATGCGACGGCTGTAGCTCTGGTGTCCCCGAC CTACACTGGCGTTACCTCTGACACTGCTGAACTGGCAGCCCTCTGTCACGCTCATGGT GTTCCACTGTTTGTTGATGAAGCGTGGGGTCCGCACCTCCCGTTCCATCCAGCACTCC CAGCAGCAGCTATTCCGTCTGGTGCCGATCTGGCGGTTACTTCTCTGCACAAACTGG CGGGTTCCCTCACCCAAACCGCTCTCCTCCTGATGGCAGGCAACCTCGTAGACCAAG CCCAGCTGCGTGCAGCCACGGCAATGGTGCAAACCACCAGCCCTGCAGCCTTCCTGT ACGCGTCCCTGGATGCTGCCCGTCGCCGTCTCGCGCTCGAAGGTGAACAGCTCCTCG CACGTACTCTCGAGCTGGCTGAGCACGCTCGCCGTGAACTCGCCGCCATCCCGGGTC TGGAGGTGGTCGGTCCAGAAATTGTTGCGGGTCGTCCGGGTGCCGGCTTCGATCGTA CTCGCCTCGTTGTTGACGTTCAGGGTTTCGGTCTGACTGGCCTCGAAGTAAAGCGTAT CCTGCGTCGTGACTTCCGTATTGCAGCTGAAATGGCAGATCTCGTCTCTGTTGTTTTC CTCATCACCATCGGTGACACCCCAGAGACCATCGCTGCCCTGGTAGCAGCTTTCCGT GCACTCGCTGCTGACCGTACCCGTCCAGACTGTGCTGCCGGTCGTCGTGCAGTACGC GCCCTCCTCCGTTCTACCGGTCCGATCGTCGCGGGTGCTCCTCAGGCGATGACCCCGC GTGAAGCTTTCTTCGCTCCAGCTGAGCGCGTTCCGCTCGCGGATGCCGTCGGTCGTGT TGCAGCCGAGCCGGTTACCCCATATCCGCCTGGTATTCCGGTACTGGCCCCAGGTGA AGTGGTTCGCCCGGAGGTAGTTGAATTCCTCCAGGCAGGCCGTGCCGCTGGTATGCG TTTCAATGGCGCGTCTGACCCGACTCTGGCGACCCTCCGTGTCGTTCGTGCCTAA SEQ ID NO: 9 CadA polypeptide sequence MNVIAILNHMGVYFKEEPIRELHRALERLNFQIVYPNDRDDLLKLIENNARLCGVIFDWD KYNLELCEEISKMNENLPLYAFANTYSTLDVSLNDLRLQISFFEYALGAAEDIANKIKQTT DEYINTILPPLTKALFKYVREGKYTFCTPGHMGGTAFQKSPVGSLFYDFFGPNTMKSDISI SVSELGSLLDHSGPHKEAEQYIARVFNADRSYMVTNGTSTANKIVGMYSAPAGSTILIDR NCHKSLTHLMMMSDVTPIYFRPTRNAYGILGGIPQSEFQHATIAKRVKETPNATWPVHA VITNSTYDGLLYNTDFIKKTLDVKSIHFDSAWVPYTNFSPIYEGKCGMSGGRVEGKVIYE TQSTHKLLAAFSQASMIHVKGDVNEETFNEAYMMHTTTSPHYGIVASTETAAAMMKGN AGKRLINGSIERAIKFRKEIKRLRTESDGWFFDVWQPDHIDTTECWPLRSDSTWHGFKNI DNEHMYLDPIKVTLLTPGMEKDGTMSDFGIPASIVAKYLDEHGIVVEKTGPYNLLFLFSI GIDKTKALSLLRALTDFKRAFDLNLRVKNMLPSLYREDPEFYENMRIQELAQNIHKLIVH HNLPDLMYRAFEVLPTMVMTPYAAFQKELHGMTEEVYLDEMVGRINANMILPYPPGVP LVMPGEMITEESRPVLEFLQMLCEIGAHYPGFETDIHGAYRQADGRYTVKVLKEESKK SEQ ID NO: 10 Escherichia coli cadA nucleic acid sequence ATGAACGTTATTGCAATATTGAATCACATGGGGGTTTATTTTAAAGAAGAACCCATC CGTGAACTTCATCGCGCGCTTGAACGTCTGAACTTCCAGATTGTTTACCCGAACGAC CGTGACGACTTATTAAAACTGATCGAAAACAATGCGCGTCTGTGCGGCGTTATTTTT GACTGGGATAAATATAATCTCGAGCTGTGCGAAGAAATTAGCAAAATGAACGAGAA CCTGCCGTTGTACGCGTTCGCTAATACGTATTCCACTCTCGATGTAAGCCTGAATGAC CTGCGTTTACAGATTAGCTTCTTTGAATATGCGCTGGGTGCTGCTGAAGATATTGCTA ATAAGATCAAGCAGACCACTGACGAATATATCAACACTATTCTGCCTCCGCTGACTA AAGCACTGTTTAAATATGTTCGTGAAGGTAAATATACTTTCTGTACTCCTGGTCACAT GGGCGGTACTGCATTCCAGAAAAGCCCGGTAGGTAGCCTGTTCTATGATTTCTTTGG TCCGAATACCATGAAATCTGATATTTCCATTTCAGTATCTGAACTGGGTTCTCTGCTG GATCACAGTGGTCCACACAAAGAAGCAGAACAGTATATCGCTCGCGTCTTTAACGCA GACCGCAGCTACATGGTGACCAACGGTACTTCCACTGCGAACAAAATTGTTGGTATG TACTCTGCTCCAGCAGGCAGCACCATTCTGATTGACCGTAACTGCCACAAATCGCTG ACCCACCTGATGATGATGAGCGATGTTACGCCAATCTATTTCCGCCCGACCCGTAAC GCTTACGGTATTCTTGGTGGTATCCCACAGAGTGAATTCCAGCACGCTACCATTGCTA AGCGCGTGAAAGAAACACCAAACGCAACCTGGCCGGTACATGCTGTAATTACCAAC TCTACCTATGATGGTCTGCTGTACAACACCGACTTCATCAAGAAAACACTGGATGTG AAATCCATCCACTTTGACTCCGCGTGGGTGCCTTACACCAACTTCTCACCGATTTACG AAGGTAAATGCGGTATGAGCGGTGGCCGTGTAGAAGGGAAAGTGATTTACGAAACC CAGTCCACTCACAAACTGCTGGCGGCGTTCTCTCAGGCTTCCATGATCCACGTTAAA GGTGACGTAAACGAAGAAACCTTTAACGAAGCCTACATGATGCACACCACCACTTCT CCGCACTACGGTATCGTGGCGTCCACTGAAACCGCTGCGGCGATGATGAAAGGCAAT GCAGGTAAGCGTCTGATCAACGGTTCTATTGAACGTGCGATCAAATTCCGTAAAGAG ATCAAACGTCTGAGAACGGAATCTGATGGCTGGTTCTTTGATGTATGGCAGCCGGAT CATATCGATACGACTGAATGCTGGCCGCTGCGTTCTGACAGCACCTGGCACGGCTTC AAAAACATCGATAACGAGCACATGTATCTTGACCCGATCAAAGTCACCCTGCTGACT CCGGGGATGGAAAAAGACGGCACCATGAGCGACTTTGGTATTCCGGCCAGCATCGT GGCGAAATACCTCGACGAACATGGCATCGTTGTTGAGAAAACCGGTCCGTATAACCT GCTGTTCCTGTTCAGCATCGGTATCGATAAGACCAAAGCACTGAGCCTGCTGCGTGC TCTGACTGACTTTAAACGTGCGTTCGACCTGAACCTGCGTGTGAAAAACATGCTGCC GTCTCTGTATCGTGAAGATCCTGAATTCTATGAAAACATGCGTATTCAGGAACTGGC TCAGAATATCCACAAACTGATTGTTCACCACAATCTGCCGGATCTGATGTATCGCGC ATTTGAAGTGCTGCCGACGATGGTAATGACTCCGTATGCTGCATTCCAGAAAGAGCT GCACGGTATGACCGAAGAAGTTTACCTCGACGAAATGGTAGGTCGTATTAACGCCAA TATGATCCTTCCGTACCCGCCGGGAGTTCCTCTGGTAATGCCGGGTGAAATGATCAC CGAAGAAAGCCGTCCGGTTCTGGAGTTCCTGCAGATGCTGTGTGAAATCGGCGCTCA CTATCCGGGCTTTGAAACCGATATTCACGGTGCATACCGTCAGGCTGATGGCCGCTA TACCGTTAAGGTATTGAAAGAAGAAAGCAAAAAATAA