EXTRACELLULAR VESICLES COMPRISING STING-AGONIST
20210322327 · 2021-10-21
Inventors
- Su Chul JANG (Cambridge, MA, US)
- Chang Ling SIA (Cambridge, UA)
- Nuruddeen D. LEWIS (Andover, MA, US)
- Rane A. HARRISON (Arlington, MA, US)
- Raymond J. MONIZ (Brighton, MA, US)
- Sriram SATHYANARAYANAN (Lexington, MA, US)
- Douglas E. Williams (Boston, MA, US)
- Kyriakos ECONOMIDES (Grafton, MA, US)
Cpc classification
A61K39/39
HUMAN NECESSITIES
C12N2750/14122
CHEMISTRY; METALLURGY
A61K35/12
HUMAN NECESSITIES
A61K9/0019
HUMAN NECESSITIES
A61K39/3955
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K9/5068
HUMAN NECESSITIES
A61K31/7084
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
International classification
A61K9/50
HUMAN NECESSITIES
A61K31/7084
HUMAN NECESSITIES
A61K39/395
HUMAN NECESSITIES
A61K9/00
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
Provided herein are compositions comprising EV, e.g., exosome, encapsulated STING agonists and methods of producing the compositions described. Also provided herein are methods of modulating an immune response via administration of a therapeutic amount of EV, e.g., exosomes encapsulating STING agonists. The immune response may be an IENβ response or activation of myeloid dendritic cells (mDCs). Also provided herein are methods of modulating an immune response that does not induce systemic inflammation via administration of exosomes encapsulating STING agonists.
Claims
1. A composition comprising an extracellular vesicle and a stimulator of interferon genes protein (STING) agonist.
2. The composition of claim 1, wherein the extracellular vesicle is an exosome, a nanovesicle, an apoptotic body, a microvesicle, a lysosome, an endosome, a liposome, a lipid nanoparticle, a micelle, a multilamellar structure, a revesiculated vesicle, or an extruded cell.
3. (canceled)
4. The composition of claim 1, wherein the STING agonist is associated with the extracellular vesicle.
5. The composition of claim 4, wherein the STING agonist is encapsulated within the extracellular vesicle.
6. (canceled)
7. The composition of claim 5, wherein the extracellular vesicle overexpresses a prostaglandin F2 receptor negative regulator (PTGFRN) protein or a fragment thereof.
8-13. (canceled)
14. The composition of claim 7, wherein the extracellular vesicle further comprises a ligand, a cytokine, or an antibody.
15-17. (canceled)
18. The composition of claim 14, wherein the STING agonist is a cyclic dinucleotide, a non-cyclic dinucleotide, or a lipid-binding tag.
19-25. (canceled)
26. The composition of claim 18, wherein the STING agonist comprises: ##STR00036## wherein X.sub.1 is H, OH, or F; X.sub.2 is H, OH, or F; Z is OH, OR.sub.1, SF.sub.1 or SRI, wherein: i) R.sub.1 is Na or NH.sub.4, or ii) R.sub.1 is an enzyme-labile group which provides OH or SH in vivo such as pivaloyloxymethyl; B1 and B2 are bases chosen from: ##STR00037## With the proviso that: in Formula (I): X.sub.1 and X.sub.2 are not OH, in Formula (II): when X.sub.1 and X.sub.2 are OH, B.sub.1 is not Adenine and B.sub.2 is not Guanine, and in Formula (III): when X.sub.1 and X.sub.2 are OH, B.sub.1 s not Adenine, B.sub.2 is not Guanine and Z is not OH, or a pharmaceutically acceptable salt thereof.
27. The composition of claim 26, wherein the STING agonist is selected from the group consisting of: ##STR00038## ##STR00039## ##STR00040## ##STR00041## ##STR00042## and a pharmaceutically acceptable salt thereof.
28. (canceled)
29. The composition claim 1, wherein the extracellular vesicle associated with the STING agonist exhibits one or more of the following characteristics: (i) activates dendritic cells, e.g., myeloid dendritic cells; (ii) activates monocyte cells at a lesser degree than the STING agonist alone (“free STING agonist”); (iii) does not activate monocyte cells; (iv) has a wider therapeutic index compared to the free STING agonist; (v) has less systemic toxicity than the free STING agonist; (vi) has less immune cell killing than the free STING agonist; (vii) has higher cell selectivity than the free STING agonist; (viii) provides tumor protective immunity at a dose lower than the free STING agonist; (ix) induce a specific cellular response in vivo in antigen-presenting cells, e.g., dendritic cells, (x) is capable of inducing an immune response at a distal region after a local administration; and (xi) is capable of being dosed at a lower level than the free STING agonist.
30. The composition of claim 1, wherein the extracellular vesicle associated with the STING agonist, when administered to a mammal, (a) does not deplete T cells and/or macrophages in the mammal or (b) depletes T cells and/or macrophages in the mammal at a lesser degree than the free STING agonist.
31. (canceled)
32. A pharmaceutical composition comprising the composition of claim 1 and a pharmaceutically acceptable carrier.
33. A kit comprising the composition of claim 1 and instructions for use.
34. A method of producing an EV, e.g., exosome, comprising a STING agonist, the method comprising: a. Obtaining an EV, e.g., exosome; b. Mixing the EV, e.g., exosome with a STING agonist in a solution; c. Incubating the mixture of the EV, e.g., exosome and the STING agonist in a solution comprising a buffer under suitable conditions; and d. Purifying the EV, e.g., exosome comprising the STING agonist.
35-44. (canceled)
45. A method of inducing or modulating an immune response and/or an inflammatory response in a subject in need thereof, the method comprising administering to the subject a pharmaceutically effective amount of the pharmaceutical composition of claim 32.
46. A method of treating a tumor in a subject in need thereof, the method comprising administering to the subject the pharmaceutical composition of claim 32.
47-54. (canceled)
55. The method of claim 45, wherein the administration is parenterally, orally, intravenously, intramuscularly, intra-tumorally, intraperitoneally, or via any other appropriate administration route.
56. (canceled)
57. The method of claim 45, wherein the immune response is an anti-tumor response.
58-59. (canceled)
60. The method of claim 46, further comprising administering an additional therapeutic agent.
61-64. (canceled)
65. The composition of claim 26, wherein the STING agonist is ##STR00043## or a pharmaceutically acceptable salt thereof.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0161]
[0162]
[0163]
[0164]
[0165]
[0166]
[0167]
[0168]
[0169]
[0170]
[0171]
[0172]
[0173]
[0174]
[0175]
[0176]
[0177]
[0178]
[0179]
[0180]
[0181]
[0182]
[0183]
[0184]
[0185]
[0186]
[0187]
[0188]
[0189]
[0190]
[0191]
[0192]
[0193]
[0194]
[0195]
[0196]
[0197]
[0198]
[0199]
[0200]
[0201]
[0202]
[0203]
[0204]
[0205]
[0206]
[0207]
[0208]
[0209]
[0210]
[0211]
[0212]
[0213]
[0214]
[0215]
[0216]
[0217]
[0218]
[0219]
[0220]
[0221]
[0222]
[0223]
[0224]
[0225]
[0226]
[0227]
[0228]
[0229]
[0230]
[0231]
[0232]
[0233]
[0234]
[0235]
[0236]
[0237]
[0238]
[0239]
[0240]
DETAILED DESCRIPTION OF THE DISCLOSURE
[0241] Before the present invention is described in greater detail, it is to be understood that this invention is not limited to particular embodiments described, as such can, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.
[0242] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present invention, representative illustrative methods and materials are now described.
[0243] All publications and patents cited in this specification are herein incorporated by reference as if each individual publication or patent were specifically and individually indicated to be incorporated by reference and are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited.
[0244] As will be apparent to those of skill in the art upon reading this disclosure, each of the individual embodiments described and illustrated herein has discrete components and features which can be readily separated from or combined with the features of any of the other several embodiments without departing from the scope or spirit of the present invention. Any recited method can be carried out in the order of events recited or in any other order which is logically possible.
I. Definitions
[0245] It is noted that, as used herein and in the appended claims, the singular forms “a,” “an,” and “the” include plural referents unless the context clearly dictates otherwise. As such, the terms “a” (or “an”), “one or more,” and “at least one” can be used interchangeably herein. It is further noted that the claims can be drafted to exclude any optional element. As such, this statement is intended to serve as antecedent basis for use of such exclusive terminology as “solely,” “only” and the like in connection with the recitation of claim elements, or use of a negative limitation.
[0246] Furthermore, “and/or” where used herein is to be taken as specific disclosure of each of the two specified features or components with or without the other. Thus, the term “and/or” as used in a phrase such as “A and/or B” herein is intended to include “A and B,” “A or B,” “A” (alone), and “B” (alone). Likewise, the term “and/or” as used in a phrase such as “A, B, and/or C” is intended to encompass each of the following aspects: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone); B (alone); and C (alone).
[0247] It is understood that wherever aspects are described herein with the language “comprising,” otherwise analogous aspects described in terms of “consisting of” and/or “consisting essentially of” are also provided.
[0248] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure is related. For example, the Concise Dictionary of Biomedicine and Molecular Biology, Juo, Pei-Show, 2nd ed., 2002, CRC Press; The Dictionary of Cell and Molecular Biology, 3rd ed., 1999, Academic Press; and the Oxford Dictionary Of Biochemistry And Molecular Biology, Revised, 2000, Oxford University Press, provide one of skill with a general dictionary of many of the terms used in this disclosure.
[0249] Units, prefixes, and symbols are denoted in their Système International de Unites (SI) accepted form. Numeric ranges are inclusive of the numbers defining the range. Where a range of values is recited, it is to be understood that each intervening integer value, and each fraction thereof, between the recited upper and lower limits of that range is also specifically disclosed, along with each subrange between such values. The upper and lower limits of any range can independently be included in or excluded from the range, and each range where either, neither or both limits are included is also encompassed within the disclosure. Thus, ranges recited herein are understood to be shorthand for all of the values within the range, inclusive of the recited endpoints. For example, a range of 1 to 10 is understood to include any number, combination of numbers, or sub-range from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, and 10.
[0250] Where a value is explicitly recited, it is to be understood that values which are about the same quantity or amount as the recited value are also within the scope of the disclosure. Where a combination is disclosed, each subcombination of the elements of that combination is also specifically disclosed and is within the scope of the disclosure. Conversely, where different elements or groups of elements are individually disclosed, combinations thereof are also disclosed. Where any element of a disclosure is disclosed as having a plurality of alternatives, examples of that disclosure in which each alternative is excluded singly or in any combination with the other alternatives are also hereby disclosed; more than one element of a disclosure can have such exclusions, and all combinations of elements having such exclusions are hereby disclosed.
[0251] Nucleotides are referred to by their commonly accepted single-letter codes. Unless otherwise indicated, nucleotide sequences are written left to right in 5′ to 3′ orientation. Nucleotides are referred to herein by their commonly known one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Accordingly, A represents adenine, C represents cytosine, G represents guanine, T represents thymine, and U represents uracil.
[0252] Amino acid sequences are written left to right in amino to carboxy orientation. Amino acids are referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission.
[0253] The term “about” or “approximately” is used herein to mean approximately roughly, around, or in the region of. When the term “about” is used in conjunction with a numerical range, it modifies that range by extending the boundaries above and below the numerical values set forth. The term used herein means within 5% of the referenced amount, e.g., about 50% is understood to encompass a range of values from 47.5% to 52.5%.
[0254] As used herein, the term “extracellular vesicle” or “EV” refers to a cell-derived vesicle comprising a membrane that encloses an internal space. Extracellular vesicles comprise all membrane-bound vesicles (e.g., exosomes, nanovesicles) that have a smaller diameter than the cell from which they are derived. Generally extracellular vesicles range in diameter from 20 nm to 1000 nm, and can comprise various macromolecular payload either within the internal space (i.e., lumen), displayed on the external surface of the extracellular vesicle, and/or spanning the membrane. Said payload can comprise nucleic acids, proteins, carbohydrates, lipids, small molecules, and/or combinations thereof. In some embodiments, an extracellular vesicle comprises a scaffold moiety. By way of example and without limitation, extracellular vesicles include apoptotic bodies, fragments of cells, vesicles derived from cells by direct or indirect manipulation (e.g., by serial extrusion or treatment with alkaline solutions), vesiculated organelles, and vesicles produced by living cells (e.g., by direct plasma membrane budding or fusion of the late endosome with the plasma membrane). Extracellular vesicles can be derived from a living or dead organism, explanted tissues or organs, prokaryotic or eukaryotic cells, and/or cultured cells. In some embodiments, extracellular vesicles are produced by cells that express one or more transgene products.
[0255] As used herein the term “exosome” refers to a cell-derived small (between 20-300 nm in diameter, more preferably 40-200 nm in diameter) vesicle comprising a membrane that encloses an internal space (i.e., lumen), and which is generated from said cell by direct plasma membrane budding or by fusion of the late endosome with the plasma membrane. The exosome is a species of extracellular vesicle. The exosome comprises lipid or fatty acid and polypeptide and optionally comprises a payload (e.g., a therapeutic agent), a receiver (e.g., a targeting moiety), a polynucleotide (e.g., a nucleic acid, RNA, or DNA), a sugar (e.g., a simple sugar, polysaccharide, or glycan) or other molecules. In some embodiments, an exosome comprises a scaffold moiety. The exosome can be derived from a producer cell, and isolated from the producer cell based on its size, density, biochemical parameters, or a combination thereof. In some embodiments, the exosomes of the present disclosure are produced by cells that express one or more transgene products.
[0256] As used herein, the term “nanovesicle” refers to a cell-derived small (between 20-250 nm in diameter, more preferably 30-150 nm in diameter) vesicle comprising a membrane that encloses an internal space, and which is generated from said cell by direct or indirect manipulation such that said nanovesicle would not be produced by said producer cell without said manipulation. Appropriate manipulations of said producer cell include but are not limited to serial extrusion, treatment with alkaline solutions, sonication, or combinations thereof. The production of nanovesicles may, in some instances, result in the destruction of said producer cell. Preferably, populations of nanovesicles are substantially free of vesicles that are derived from producer cells by way of direct budding from the plasma membrane or fusion of the late endosome with the plasma membrane. The nanovesicle comprises lipid or fatty acid and polypeptide, and optionally comprises a payload (e.g., a therapeutic agent), a receiver (e.g., a targeting moiety), a polynucleotide (e.g., a nucleic acid, RNA, or DNA), a sugar (e.g., a simple sugar, polysaccharide, or glycan) or other molecules. In some embodiments, a nanovesicle comprises a scaffold moiety. The nanovesicle, once it is derived from a producer cell according to said manipulation, may be isolated from the producer cell based on its size, density, biochemical parameters, or a combination thereof.
[0257] The term “modified,” when used in the context of exosomes described herein, refers to an alteration or engineering of an EV, such that the modified EV is different from a naturally-occurring EV. In some embodiments, a modified EV described herein comprises a membrane that differs in composition of a protein, a lipid, a small molecular, a carbohydrate, etc. compared to the membrane of a naturally-occurring EV (e.g., membrane comprises higher density or number of natural EV proteins and/or membrane comprises proteins that are not naturally found in EVs. In certain embodiments, such modifications to the membrane changes the exterior surface of the EV. In certain embodiments, such modifications to the membrane changes the lumen of the EV.
[0258] As used herein, the term “scaffold moiety” refers to a molecule that can be used to anchor STING agonists disclosed herein or any other compound of interest (e.g., payload) to the EV either on the luminal surface or on the exterior surface of the EV. In certain embodiments, a scaffold moiety comprises a synthetic molecule. In some embodiments, a scaffold moiety comprises a non-polypeptide moiety. In other embodiments, a scaffold moiety comprises a lipid, carbohydrate, or protein that naturally exists in the EV. In some embodiments, a scaffold moiety comprises a lipid, carbohydrate, or protein that does not naturally exist in the exosome. In certain embodiments, a scaffold moiety is Scaffold X. In some embodiments, a scaffold moiety is Scaffold Y. In further embodiments, a scaffold moiety comprises both Scaffold X and Scaffold Y.
[0259] As used herein, the term “Scaffold X” refers to exosome proteins that have recently been identified on the surface of exosomes. See, e.g., U.S. Pat. No. 10,195,290, which is incorporated herein by reference in its entirety. Non-limiting examples of Scaffold X proteins include: prostaglandin F2 receptor negative regulator (“the PTGFRN protein”); basigin (“the BSG protein”); immunoglobulin superfamily member 2 (“the IGSF2 protein”); immunoglobulin superfamily member 3 (“the IGSF3 protein”); immunoglobulin superfamily member 8 (“the IGSF8 protein”); integrin beta-1 (“the ITGB1 protein); integrin alpha-4 (“the ITGA4 protein”); 4F2 cell-surface antigen heavy chain (“the SLC3A2 protein”); and a class of ATP transporter proteins (“the ATP1A1 protein,” “the ATP1A2 protein,” “the ATP1A3 protein,” “the ATP1A4 protein,” “the ATP1B3 protein,” “the ATP2B1 protein,” “the ATP2B2 protein,” “the ATP2B3 protein,” “the ATP2B protein”). In some embodiments, a Scaffold X protein can be a whole protein or a fragment thereof (e.g., functional fragment, e.g., the smallest fragment that is capable of anchoring another moiety on the exterior surface or on the luminal surface of the EV, e.g., exosome,). In some embodiments, a Scaffold X can anchor a moiety (e.g., STING agonist) to the external surface or the luminal surface of the EVs, e.g., exosomes.
[0260] As used herein, the term “Scaffold Y” refers to exosome proteins that were newly identified within the luminal surface of exosomes. See, e.g., International Appl. No. PCT/US2018/061679, which is incorporated herein by reference in its entirety. Non-limiting examples of Scaffold Y proteins include: myristoylated alanine rich Protein Kinase C substrate (“the MARCKS protein”); myristoylated alanine rich Protein Kinase C substrate like 1 (“the MARCKSL1 protein”); and brain acid soluble protein 1 (“the BASP1 protein”). In some embodiments, a Scaffold Y protein can be a whole protein or a fragment thereof (e.g., functional fragment, e.g., the smallest fragment that is capable of anchoring a moiety on the luminal surface of the EVs, e.g., exosomes,). In some embodiments, a Scaffold Y can anchor a moiety (e.g., STING agonist) to the lumen of the EVs, e.g., exosomes.
[0261] As used herein, the term “fragment” of a protein (e.g., therapeutic protein, Scaffold X, or Scaffold Y) refers to an amino acid sequence of a protein that is shorter than the naturally-occurring sequence, N- and/or C-terminally deleted or any part of the protein deleted in comparison to the naturally occurring protein. As used herein, the term “functional fragment” refers to a protein fragment that retains protein function. Accordingly, in some embodiments, a functional fragment of a Scaffold X protein retains the ability to anchor a moiety on the luminal surface and/or on the exterior surface of the EV. Similarly, in certain embodiments, a functional fragment of a Scaffold Y protein retains the ability to anchor a moiety on the luminal surface of the EV. Whether a fragment is a functional fragment can be assessed by any art known methods to determine the protein content of EVs including Western Blots, FACS analysis and fusions of the fragments with autofluorescent proteins like, e.g., GFP. In certain embodiments, a functional fragment of a Scaffold X protein retains at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90% or at least about 100% of the ability, e.g., an ability to anchor a moiety, of the naturally occurring Scaffold X protein. In some embodiments, a functional fragment of a Scaffold Y protein retains at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90% or at least about 100% of the ability, e.g., an ability to anchor another molecule, of the naturally occurring Scaffold Y protein.
[0262] As used herein, the term “variant” of a molecule (e.g., functional molecule, antigen, Scaffold X and/or Scaffold Y) refers to a molecule that shares certain structural and functional identities with another molecule upon comparison by a method known in the art. For example, a variant of a protein can include a substitution, insertion, deletion, frameshift or rearrangement in another protein.
[0263] In some embodiments, a variant of a Scaffold X comprises a variant having at least about 70% identity to the full-length, mature PTGFRN, BSG, IGSF2, IGSF3, IGSF8, ITGB1, ITGA4, SLC3A2, or ATP transporter proteins or a fragment (e.g., functional fragment) of the PTGFRN, BSG, IGSF2, IGSF3, IGSF8, ITGB1, ITGA4, SLC3A2, or ATP transporter proteins. In some embodiments, variants or variants of fragments of PTGFRN share at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity with PTGFRN according to SEQ ID NO: 1 or with a functional fragment thereof. In some embodiments variants or variants of fragments of BSG share at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity with BSG according to SEQ ID NO: 9 or with a functional fragment thereof. In some embodiments, variants or variants of fragments of IGSF2 share at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity with IGSF2 according to SEQ ID NO: 34 or with a functional fragment thereof. In some embodiments variants or variants of fragments of IGSF3 share at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity with IGSF3 according to SEQ ID NO: 20 or with a functional fragment thereof. In some embodiments variants or variants of fragments of IGSF8 share at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity with IGSF8 according to SEQ ID NO: 14 or with a functional fragment thereof. In some embodiments variants or variants of fragments of ITGB1 share at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity with ITGB1 according to SEQ ID NO: 21 or with a functional fragment thereof. In some embodiments variants or variants of fragments of ITGA4 share at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity with ITGA4 according to SEQ ID NO: 22 or with a functional fragment thereof. In some embodiments variants or variants of fragments of SLC3A2 share at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity with SLC3A2 according to SEQ ID NO: 23 or with a functional fragment thereof. In some embodiments variants or variants of fragments of ATP1A1 share at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity with ATP1A1 according to SEQ ID NO: 24 or with a functional fragment thereof. In some embodiments variants or variants of fragments of ATP1A2 share at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity with ATP1A2 according to SEQ ID NO: 25 or with a functional fragment thereof. In some embodiments variants or variants of fragments of ATP1A3 share at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity with ATP1A3 according to SEQ ID NO: 26 or with a functional fragment thereof. In some embodiments variants or variants of fragments of ATP1A4 share at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity with ATP1A4 according to SEQ ID NO: 27 or with a functional fragment thereof. In some embodiments variants or variants of fragments of ATP1B3 share at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity with ATP1B3 according to SEQ ID NO: 28 or with a functional fragment thereof. In some embodiments variants or variants of fragments of ATP2B1 share at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity with ATP2B1 according to SEQ ID NO: 29 or with a functional fragment thereof. In some embodiments variants or variants of fragments of ATP2B2 share at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity with ATP2B2 according to SEQ ID NO: 30 or with a functional fragment thereof. In some embodiments variants or variants of fragments of ATP2B3 share at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity with ATP2B3 according to SEQ ID NO: 31 or with a functional fragment thereof. In some embodiments variants or variants of fragments of ATP2B4 share at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity with ATP2B4 according to SEQ ID NO: 32 or with a functional fragment thereof. In some embodiments, the variant or variant of a fragment of Scaffold X protein disclosed herein retains the ability to be specifically targeted to EVs. In some embodiments, the Scaffold X includes one or more mutations, for example, conservative amino acid substitutions.
[0264] In some embodiments, a variant of a Scaffold Y comprises a variant having at least 70% identity to MARCKS, MARCKSL1, BASP1 or a fragment of MARCKS, MARCKSL1, or BASP1. In some embodiments variants or variants of fragments of MARCKS share at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity with MARCKS according to SEQ ID NO: 47 or with a functional fragment thereof. In some embodiments variants or variants of fragments of MARCKSL1 share at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity with MARCKSL1 according to SEQ ID NO: 48 or with a functional fragment thereof. In some embodiments variants or variants of fragments of BASP1 share at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity with BASP1 according to SEQ ID NO: 49 or with a functional fragment thereof. In some embodiments, the variant or variant of a fragment of Scaffold Y protein retains the ability to be specifically targeted to the lumen of EVs. In some embodiments, the Scaffold Y includes one or more mutations, e.g., conservative amino acid substitutions.
[0265] A “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, if an amino acid in a polypeptide is replaced with another amino acid from the same side chain family, the substitution is considered to be conservative. In another embodiment, a string of amino acids can be conservatively replaced with a structurally similar string that differs in order and/or composition of side chain family members.
[0266] The term “percent sequence identity” or “percent identity” between two polynucleotide or polypeptide sequences refers to the number of identical matched positions shared by the sequences over a comparison window, taking into account additions or deletions (i.e., gaps) that must be introduced for optimal alignment of the two sequences. A matched position is any position where an identical nucleotide or amino acid is presented in both the target and reference sequence. Gaps presented in the target sequence are not counted since gaps are not nucleotides or amino acids. Likewise, gaps presented in the reference sequence are not counted since target sequence nucleotides or amino acids are counted, not nucleotides or amino acids from the reference sequence.
[0267] The percentage of sequence identity is calculated by determining the number of positions at which the identical amino-acid residue or nucleic acid base occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity. The comparison of sequences and determination of percent sequence identity between two sequences may be accomplished using readily available software both for online use and for download. Suitable software programs are available from various sources, and for alignment of both protein and nucleotide sequences. One suitable program to determine percent sequence identity is bl2seq, part of the BLAST suite of programs available from the U.S. government's National Center for Biotechnology Information BLAST web site (blast.ncbi.nlm.nih.gov). B12seq performs a comparison between two sequences using either the BLASTN or BLASTP algorithm. BLASTN is used to compare nucleic acid sequences, while BLASTP is used to compare amino acid sequences. Other suitable programs are, e.g., Needle, Stretcher, Water, or Matcher, part of the EMBOSS suite of bioinformatics programs and also available from the European Bioinformatics Institute (EBI) at www.ebi.ac.uk/Tools/psa.
[0268] Different regions within a single polynucleotide or polypeptide target sequence that aligns with a polynucleotide or polypeptide reference sequence can each have their own percent sequence identity. It is noted that the percent sequence identity value is rounded to the nearest tenth. For example, 80.11, 80.12, 80.13, and 80.14 are rounded down to 80.1, while 80.15, 80.16, 80.17, 80.18, and 80.19 are rounded up to 80.2. It also is noted that the length value will always be an integer.
[0269] One skilled in the art will appreciate that the generation of a sequence alignment for the calculation of a percent sequence identity is not limited to binary sequence-sequence comparisons exclusively driven by primary sequence data. Sequence alignments can be derived from multiple sequence alignments. One suitable program to generate multiple sequence alignments is ClustalW2, available from www.clustal.org. Another suitable program is MUSCLE, available from www.drive5.com/muscle/. ClustalW2 and MUSCLE are alternatively available, e.g., from the EBI.
[0270] It will also be appreciated that sequence alignments can be generated by integrating sequence data with data from heterogeneous sources such as structural data (e.g., crystallographic protein structures), functional data (e.g., location of mutations), or phylogenetic data. A suitable program that integrates heterogeneous data to generate a multiple sequence alignment is T-Coffee, available at www.tcoffee.org, and alternatively available, e.g., from the EBI. It will also be appreciated that the final alignment used to calculate percent sequence identity may be curated either automatically or manually.
[0271] The polynucleotide variants can contain alterations in the coding regions, non-coding regions, or both. In one embodiment, the polynucleotide variants contain alterations which produce silent substitutions, additions, or deletions, but do not alter the properties or activities of the encoded polypeptide. In another embodiment, nucleotide variants are produced by silent substitutions due to the degeneracy of the genetic code. In other embodiments, variants in which 5-10, 1-5, or 1-2 amino acids are substituted, deleted, or added in any combination. Polynucleotide variants can be produced for a variety of reasons, e.g., to optimize codon expression for a particular host (change codons in the human mRNA to others, e.g., a bacterial host such as E. coli).
[0272] Naturally occurring variants are called “allelic variants,” and refer to one of several alternate forms of a gene occupying a given locus on a chromosome of an organism (Genes II, Lewin, B., ed., John Wiley & Sons, New York (1985)). These allelic variants can vary at either the polynucleotide and/or polypeptide level and are included in the present disclosure. Alternatively, non-naturally occurring variants can be produced by mutagenesis techniques or by direct synthesis.
[0273] Using known methods of protein engineering and recombinant DNA technology, variants can be generated to improve or alter the characteristics of the polypeptides. For instance, one or more amino acids can be deleted from the N-terminus or C-terminus of the secreted protein without substantial loss of biological function. Ron et al., J. Biol. Chem. 268: 2984-2988 (1993), incorporated herein by reference in its entirety, reported variant KGF proteins having heparin binding activity even after deleting 3, 8, or 27 amino-terminal amino acid residues. Similarly, interferon gamma exhibited up to ten times higher activity after deleting 8-10 amino acid residues from the carboxy terminus of this protein. (Dobeli et al., J Biotechnology 7:199-216 (1988), incorporated herein by reference in its entirety.)
[0274] Moreover, ample evidence demonstrates that variants often retain a biological activity similar to that of the naturally occurring protein. For example, Gayle and coworkers (J Biol. Chem 268:22105-22111 (1993), incorporated herein by reference in its entirety) conducted extensive mutational analysis of human cytokine IL-1a. They used random mutagenesis to generate over 3,500 individual IL-1a mutants that averaged 2.5 amino acid changes per variant over the entire length of the molecule. Multiple mutations were examined at every possible amino acid position. The investigators found that “[m]ost of the molecule could be altered with little effect on either [binding or biological activity].” (See Abstract.) In fact, only 23 unique amino acid sequences, out of more than 3,500 nucleotide sequences examined, produced a protein that significantly differed in activity from wild-type.
[0275] As stated above, polypeptide variants include, e.g., modified polypeptides. Modifications include, e.g., acetylation, acylation, ADP-ribosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphotidylinositol, cross-linking, cyclization, disulfide bond formation, demethylation, formation of covalent cross-links, formation of cysteine, formation of pyroglutamate, formylation, gamma-carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristoylation, oxidation, pegylation (Mei et al., Blood 116:270-79 (2010), which is incorporated herein by reference in its entirety), proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, transfer-RNA mediated addition of amino acids to proteins such as arginylation, and ubiquitination. In some embodiments, Scaffold X and/or Scaffold Y is modified at any convenient location.
[0276] As used herein the term “producer cell” refers to a cell used for generating an EV. A producer cell can be a cell cultured in vitro, or a cell in vivo. A producer cell includes, but not limited to, a cell known to be effective in generating EVs, e.g., exosomes, e.g., HEK293 cells, Chinese hamster ovary (CHO) cells, mesenchymal stem cells (MSCs), BJ human foreskin fibroblast cells, s9f cells, fHDF fibroblast cells, AGE.HN® neuronal precursor cells, CAP® amniocyte cells, adipose mesenchymal stem cells, and RPTEC/TERT1 cells. In certain embodiments, a producer cell is an antigen-presenting cell. In some embodiments, the producer cell is a bacterial cell. In some embodiments, a producer cell is a dendritic cell, a B cell, a mast cell, a macrophage, a neutrophil, a Kupffer-Browicz cell, or a cell derived from any of these cells, or any combination thereof. In some embodiments, the producer cell is not a bacterial cell. In other embodiments, the producer cell is not an antigen-presenting cell.
[0277] As used herein the term “associated with” refers to encapsulation of a first moiety, e.g., a STING agonist, into a second moiety, e.g., extracellular vesicle, or to a covalent or non-covalent bond formed between a first moiety and a second moiety, e.g., a STING agonist and an extracellular vesicle, respectively, e.g., a scaffold moiety expressed in or on the extracellular vesicle and a STING agonist, e.g., Scaffold X (e.g., a PTGFRN protein), respectively, on the luminal surface of or on the external surface of the extracellular vesicle. In one embodiment, the term “associated with” means a covalent, non-peptide bond or a non-covalent bond. For example, the amino acid cysteine comprises a thiol group that can form a disulfide bond or bridge with a thiol group on a second cysteine residue. Examples of covalent bonds include, but are not limited to, a peptide bond, a metal bond, a hydrogen bond, a disulfide bond, a sigma bond, a pi bond, a delta bond, a glycosidic bond, an agnostic bond, a bent bond, a dipolar bond, a Pi backbond, a double bond, a triple bond, a quadruple bond, a quintuple bond, a sextuple bond, conjugation, hyperconjugation, aromaticity, hapticity, or antibonding. Non-limiting examples of non-covalent bond include an ionic bond (e.g., cation-pi bond or salt bond), a metal bond, an hydrogen bond (e.g., dihydrogen bond, dihydrogen complex, low-barrier hydrogen bond, or symmetric hydrogen bond), van der Walls force, London dispersion force, a mechanical bond, a halogen bond, aurophilicity, intercalation, stacking, entropic force, or chemical polarity. In other embodiments, the term “associated with” means that a state of encapsulation by a first moiety, e.g., extracellular vesicle of a second moiety, e.g., a STING agonist. In the encapsulation state, the first moiety and the second moiety can be linked to each other. In other embodiments, the encapsulation means that the first moiety and the second moiety are not physically and/or chemically linked to each other.
[0278] As used herein the term “linked to” or “conjugated to” are used interchangeably and refer to a covalent or non-covalent bond formed between a first moiety and a second moiety, e.g., a STING agonist and an extracellular vesicle, respectively, e.g., a scaffold moiety expressed in or on the extracellular vesicle and a STING agonist, e.g., Scaffold X (e.g., a PTGFRN protein), respectively, on the luminal surface of or on the external surface of the extracellular vesicle.
[0279] The term “encapsulated”, or grammatically different forms of the term (e.g., encapsulation, or encapsulating), refers to a status or process of having a first moiety (e.g., STING agonist) inside a second moiety (e.g., an EV, e.g., exosome) without chemically or physically linking the two moieties. In some embodiments, the term “encapsulated” can be used interchangeably with “in the lumen of”. Non-limiting examples of encapsulating a first moiety (e.g., STING agonist) into a second moiety (e.g., EVs, e.g., exosomes) are disclosed elsewhere herein.
[0280] As used herein, the terms “isolate,” “isolated,” and “isolating” or “purify,” “purified,” and “purifying” as well as “extracted” and “extracting” are used interchangeably and refer to the state of a preparation (e.g., a plurality of known or unknown amount and/or concentration) of desired EVs, that have undergone one or more processes of purification, e.g., a selection or an enrichment of the desired EV preparation. In some embodiments, isolating or purifying as used herein is the process of removing, partially removing (e.g., a fraction) of the EVs from a sample containing producer cells. In some embodiments, an isolated EV composition has no detectable undesired activity or, alternatively, the level or amount of the undesired activity is at or below an acceptable level or amount. In other embodiments, an isolated EV composition has an amount and/or concentration of desired EVs at or above an acceptable amount and/or concentration. In other embodiments, the isolated EV composition is enriched as compared to the starting material (e.g., producer cell preparations) from which the composition is obtained. This enrichment can be by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, 99.9%, 99.99%, 99.999%, 99.9999%, or greater than 99.9999% as compared to the starting material. In some embodiments, isolated EV preparations are substantially free of residual biological products. In some embodiments, the isolated EV preparations are 100% free, 99% free, 98% free, 97% free, 96% free, 95% free, 94% free, 93% free, 92% free, 91% free, or 90% free of any contaminating biological matter. Residual biological products can include abiotic materials (including chemicals) or unwanted nucleic acids, proteins, lipids, or metabolites. Substantially free of residual biological products can also mean that the EV composition contains no detectable producer cells and that only EVs are detectable.
[0281] As used herein, the term “agonist” refers to a molecule that binds to a receptor and activates the receptor to produce a biological response. Receptors can be activated by either an endogenous or an exogenous agonist. Non-limiting examples of endogenous agonist include hormones, neurotransmitters, and cyclic dinucleotides. Non-limiting examples of exogenous agonist include drugs, small molecules, and cyclic dinucleotides. The agonist can be a full, partial, or inverse agonist.
[0282] As used herein, the term “antagonist” refers to a molecule that blocks or dampens an agonist mediated response rather than provoking a biological response itself upon bind to a receptor. Many antagonists achieve their potency by competing with endogenous ligands or substrates at structurally defined binding sites on the receptors. Non-limiting examples of antagonists include alpha blockers, beta-blocker, and calcium channel blockers. The antagonist can be a competitive, non-competitive, or uncompetitive antagonist.
[0283] The term “free STING agonist” as used herein means a STING agonist not associated with an extracellular vesicle, but otherwise identical to the STING agonist associated with the extracellular vesicle. Especially when compared to an extracellular vesicle associated with a STING agonist, the free STING agonist is the same STING agonist associated with the extracellular vesicle. In some embodiments, when a free STING agonist is compared to an extracellular vesicle comprising the STING agonist in its efficacy, toxicity, and/or any other characteristics, the amount of the free STING agonist compared to the STING agonist associated with the extracellular vesicle is the same as the amount of the STING agonist associated with the EV.
[0284] As used herein, the term “ligand” refers to a molecule that binds to a receptor and modulates the receptor to produce a biological response. Modulation can be activation, deactivation, blocking, or damping of the biological response mediated by the receptor. Receptors can be modulated by either an endogenous or an exogenous ligand. Non-limiting examples of endogenous ligands include antibodies and peptides. Non-limiting examples of exogenous agonist include drugs, small molecules, and cyclic dinucleotides. The ligand can be a full, partial, or inverse ligand.
[0285] As used herein, the term “antibody” encompasses an immunoglobulin whether natural or partly or wholly synthetically produced, and fragments thereof. The term also covers any protein having a binding domain that is homologous to an immunoglobulin binding domain. “Antibody” further includes a polypeptide comprising a framework region from an immunoglobulin gene or fragments thereof that specifically binds and recognizes an antigen. Use of the term antibody is meant to include whole antibodies, polyclonal, monoclonal and recombinant antibodies, fragments thereof, and further includes single-chain antibodies, humanized antibodies, murine antibodies, chimeric, mouse-human, mouse-primate, primate-human monoclonal antibodies, anti-idiotype antibodies, antibody fragments, such as, e.g., scFv, (scFv).sub.2, Fab, Fab′, and F(ab′).sub.2, F(ab1).sub.2, Fv, dAb, and Fd fragments, diabodies, and antibody-related polypeptides. Antibody includes bispecific antibodies and multispecific antibodies so long as they exhibit the desired biological activity or function.
[0286] As used herein the term “therapeutically effective amount” is the amount of reagent or pharmaceutical compound that is sufficient to a produce a desired therapeutic effect, pharmacologic and/or physiologic effect on a subject in need thereof. A therapeutically effective amount can be a “prophylactically effective amount” as prophylaxis can be considered therapy.
[0287] As used herein, the term “pharmaceutical composition” refers to one or more of the compounds described herein, such as, e.g., an EV mixed or intermingled with, or suspended in one or more other chemical components, such as pharmaceutically-acceptable carriers and excipients. One purpose of a pharmaceutical composition is to facilitate administration of preparations of EVs to a subject. The term “excipient” or “carrier” refers to an inert substance added to a pharmaceutical composition to further facilitate administration of a compound. The term “pharmaceutically-acceptable carrier” or “pharmaceutically-acceptable excipient” and grammatical variations thereof, encompasses any of the agents approved by a regulatory agency of the US Federal government or listed in the US Pharmacopeia for use in animals, including humans, as well as any carrier or diluent that does not cause the production of undesirable physiological effects to a degree that prohibits administration of the composition to a subject and does not abrogate the biological activity and properties of the administered compound. Included are excipients and carriers that are useful in preparing a pharmaceutical composition and are generally safe, non-toxic, and desirable.
[0288] As used herein, the term “payload” refers to a therapeutic agent that acts on a target (e.g., a target cell) that is contacted with the EV. Payloads that can be introduced into an EV and/or a producer cell include therapeutic agents such as, nucleotides (e.g., nucleotides comprising a detectable moiety or a toxin or that disrupt transcription), nucleic acids (e.g., DNA or mRNA molecules that encode a polypeptide such as an enzyme, or RNA molecules that have regulatory function such as miRNA, dsDNA, lncRNA, and siRNA), amino acids (e.g., amino acids comprising a detectable moiety or a toxin or that disrupt translation), polypeptides (e.g., enzymes), lipids, carbohydrates, and small molecules (e.g., small molecule drugs and toxins).
[0289] The terms “administration,” “administering” and variants thereof refer to introducing a composition, such as an EV, or agent into a subject and includes concurrent and sequential introduction of a composition or agent. The introduction of a composition or agent into a subject is by any suitable route, including intratumorally, orally, pulmonarily, intranasally, parenterally (intravenously, intra-arterially, intramuscularly, intraperitoneally, or subcutaneously), rectally, intralymphatically, intrathecally, periocularly or topically. Administration includes self-administration and the administration by another. A suitable route of administration allows the composition or the agent to perform its intended function. For example, if a suitable route is intravenous, the composition is administered by introducing the composition or agent into a vein of the subject.
[0290] The term “treat,” “treatment,” or “treating,” as used herein refers to, e.g., the reduction in severity of a disease or condition; the reduction in the duration of a disease course; the amelioration or elimination of one or more symptoms associated with a disease or condition; the provision of beneficial effects to a subject with a disease or condition, without necessarily curing the disease or condition. The term also include prophylaxis or prevention of a disease or condition or its symptoms thereof. In one embodiment, the term “treating” or “treatment” means inducing an immune response in a subject against an antigen.
[0291] The term “prevent” or “preventing,” as used herein, refers to decreasing or reducing the occurrence or severity of a particular outcome. In some embodiments, preventing an outcome is achieved through prophylactic treatment.
[0292] As used herein, the term “modulate,” “modulating”, “modify,” and/or “modulator” generally refers to the ability to alter, by increase or decrease, e.g., directly or indirectly promoting/stimulating/up-regulating or interfering with/inhibiting/down-regulating a specific concentration, level, expression, function or behavior, such as, e.g., to act as an antagonist or agonist. In some instances a modulator can increase and/or decrease a certain concentration, level, activity or function relative to a control, or relative to the average level of activity that would generally be expected or relative to a control level of activity.
[0293] As used herein, “a mammalian subject” includes all mammals, including without limitation, humans, domestic animals (e.g., dogs, cats and the like), farm animals (e.g., cows, sheep, pigs, horses and the like) and laboratory animals (e.g., monkey, rats, mice, rabbits, guinea pigs and the like).
[0294] The terms “individual,” “subject,” “host,” and “patient,” are used interchangeably herein and refer to any mammalian subject for whom diagnosis, treatment, or therapy is desired, particularly humans. The methods described herein are applicable to both human therapy and veterinary applications. In some embodiments, the subject is a mammal, and in other embodiments the subject is a human.
[0295] As used herein, the term “substantially free” means that the sample comprising EVs comprise less than 10% of macromolecules by mass/volume (m/v) percentage concentration. Some fractions may contain less than 0.001%, less than 0.01%, less than 0.05%, less than 0.1%, less than 0.2%, less than 0.3%, less than 0.4%, less than 0.5%, less than 0.6%, less than 0.7%, less than 0.8%, less than 0.9%, less than 1%, less than 2%, less than 3%, less than 4%, less than 5%, less than 6%, less than 7%, less than 8%, less than 9%, or less than 10% (m/v) of macromolecules.
[0296] As used herein, the term “macromolecule” means nucleic acids, exogenous proteins, lipids, carbohydrates, metabolites, or a combination thereof.
[0297] As used herein, the term “insubstantial,” “reduced,” or “negligible” refers to the presence, level, or amount of an inflammation response in a subject after administration of the sample comprising EVs encapsulating a STING agonist relative to the baseline inflammation response in the subject or compared to the subject inflammation response to the administration of a free STING agonist. For example, a negligible or insubstantial presence, level or amount of systemic inflammation may be less than 0.001%, less than 0.01%, less than 0.1%, less than 0.2%, less than 0.3%, less than 0.4%, less than 0.5%, less than 0.6%, less than 0.7%, less than 0.8%, less than 0.9%, less than 1%, less than 2%, less than 3%, less than 4%, less than 5%, less than 6%, less than 7%, less than 8%, less than 9%, less than 10%, less than 12%, less than 15%, less than 17%, less than 20%, or less than 25% of systemic inflammation as relative to the baseline inflammation in the subject or compared to the subject immune response to the administration of a free STING agonist. A level or amount of a systemic inflammation may be less than 0.1-fold, less than 0.5-fold, less than 0.5-fold, less than 1-fold, less than 1.5-fold, less than 2-fold relative to the baseline or compared to the inflammation response to the administration of a free STING agonist.
[0298] Ranges recited herein are understood to be shorthand for all of the values within the range, inclusive of the recited endpoints. For example, a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, and 50.
[0299] Unless otherwise indicated, reference to a compound that has one or more stereocenters intends each stereoisomer, and all combinations of stereoisomers, thereof.
II. Compositions (Vesicles) with STINGAgonist
[0300] The innate immune system recognizes pathogen associated molecular patterns (PAMPs) via pattern recognition receptors (PRRs) that induce an immune response. PRRs recognize a variety of pathogen molecules including single and double stranded RNA and DNA. PRRS such as retinoic acid-inducible gene-I (RIG-I)-like receptors (RLRs) and some toll-like receptors (TLRs) recognize RNA ligands. DNA ligands are recognized by cyclic GMP-AMP synthase (cGAS), AIM2 and other TLRs. The TLRs, RLRs, and AIM2 directly interact with other signal cascade adaptor proteins to activate transcription factors, while cGAS produces cGAMP, a cyclic dinucleotide molecule that activates the stimulator of interferon gene (STING) receptor. Both STING and the RLRs activate the adaptor kinase TBK1 which induces activation of transcription factors IRF3, and NF-κB, and result in the production of type I IFNs and pro-inflammatory cytokines.
[0301] Cyclic dinucleotides (CDNs) were first identified as bacterial signaling molecules characterized by two 3′, 5′ phosphodiester bonds, such as in the molecule c-di-GMP. While STING can be activated by bacterial CDNs, the innate immune response in mammalian cells is also mediated by the CDN signaling molecule cGAMP which is produced by cGAS. cGAMP is characterized by a mixed 2′, 5′ and 3′, 5′ phosphodiester linkage. Both bacterial and mammalian CDNs directly interact with STING to induce the pro-inflammatory signaling cascade that results in the production of type I IFNs, such as IFNα and IFN-β.
[0302] II.A. STINGAzgonists
[0303] STING agonists used in this disclosure can be cyclic dinucleotides (CDNs) or non-cyclic dinucleotide agonists. Cyclic purine dinucleotides such as, but not limited to, cGMP, cyclic di-GMP (c-di-GMP), cAMP, cyclic di-AMP (c-di-AMP), cyclic-GMP-AMP (cGAMP), cyclic di-IMP (c-di-IMP), cyclic AMP-IMP (cAIMP), and any analogue thereof, are known to stimulate or enhance an immune or inflammation response in a patient. The CDNs may have 2′2′, 2′3′, 2′5′, 3′3′, or 3′5′ bonds linking the cyclic dinucleotides, or any combination thereof.
[0304] Cyclic purine dinucleotides may be modified via standard organic chemistry techniques to produce analogues of purine dinucleotides. Suitable purine dinucleotides include, but are not limited to, adenine, guanine, inosine, hypoxanthine, xanthine, isoguanine, or any other appropriate purine dinucleotide known in the art. The cyclic dinucleotides may be modified analogues. Any suitable modification known in the art may be used, including, but not limited to, phosphorothioate, biphosphorothioate, fluorinate, and difluorinate modifications.
[0305] Non cyclic dinucleotide agonists may also be used, such as 5,6-Dimethylxanthenone-4-acetic acid (DMXAA), or any other non-cyclic dinucleotide agonist known in the art.
[0306] It is contemplated that any STING agonist may be used. Among the STING agonists are DMXAA, STING agonist-1, ML RR-S2 CDA, ML RR-S2c-di-GMP, ML-RR-S2 cGAMP, 2′3′-c-di-AM(PS)2, 2′3′-cGAMP, 2′3′-cGAMPdFHS, 3′3′-cGAMP, 3′3′-cGAMPdFSH, cAIMP, cAIM(PS)2, 3′3′-cAIMP, 3′3′-cAIMPdFSH, 2′2′-cGAMP, 2′3′-cGAM(PS)2, 3′3′-cGAMP, c-di-AMP, 2′3′-c-di-AMP, 2′3′-c-di-AM(PS)2, c-di-GMP, 2′3′-c-di-GMP, c-di-IMP, c-di-UMP or any combination thereof. In a preferred embodiment, the STING agonist is 3′3′-cAIMPdFSH, alternatively named 3-3 cAIMPdFSH. Additional STING agonists known in the art may also be used.
[0307] In some embodiments, the STING agonist useful for the present disclosure comprises a compound having the following formula:
##STR00008##
wherein:
X.SUB.1 .is H, OH, or F;
X.SUB.2 .is H, OH, or F;
[0308] Z is OH, OR.sub.1, SH or SR.sub.1, wherein:
i) R.sub.1 is Na or NH.sub.4, or
ii) R.sub.1 is an enzyme-labile group which provides OH or SH in vivo such as pivaloyloxymethyl;
B.sub.1 and B2 are bases chosen from:
##STR00009##
[0309] With proviso that: [0310] in Formula (I): X.sub.1 and X.sub.2 are not OH, [0311] in Formula (II): when X.sub.1 and X.sub.2 are OH, B.sub.1 is not Adenine and B.sub.2 is not Guanine, and [0312] in Formula (III): when X.sub.1 and X.sub.2 are OH, B.sub.1 is not Adenine, B.sub.2 is not Guanine and Z is not OH. See WO 2016/096174, the content of which is incorporated herein by reference in its entirety.
[0313] In some embodiments, the STING agonist useful for the present disclosure comprises:
##STR00010## ##STR00011##
and a pharmaceutically acceptable salt thereof. See WO 2016/096174A1.
[0314] In other embodiments, the STING agonist useful for the present disclosure comprises a compound having the following formula:
##STR00012## ##STR00013## ##STR00014## ##STR00015## ##STR00016##
or any pharmaceutically acceptable salts thereof.
[0315] In some embodiments, the STING agonist useful for the present disclosure comprises a compound having the following formula:
##STR00017##
wherein each symbol is defined in WO 2014/093936, the content of which is incorporated herein by reference in its entirety.
[0316] In some embodiments, the STING agonist useful for the present disclosure comprises a compound having the following formula:
##STR00018##
wherein each symbol is defined in WO 2014/189805, the content of which is incorporated herein by reference in its entirety.
[0317] In some embodiments, the STING agonist useful for the present disclosure comprises a compound having the following formula:
##STR00019##
wherein each symbol is defined in WO 2015/077354, the content of which is incorporated herein by reference in its entirety. See also Cell reports 11, 1018-1030 (2015).
[0318] In some embodiments, the STING agonist useful for the present disclosure comprises c-di-AMP, c-di-GMP, c-di-IMP, c-AMP-GMP, c-AMP-IMP, and c-GMP-IMP, described in WO 2013/185052 and Sci. Transl. Med. 283,283ra52 (2015), which are incorporated herein by reference in their entireties.
[0319] In some embodiments, the STING agonist useful for the present disclosure comprises a compound having the following formula:
##STR00020##
wherein each symbol is defined in WO 2014/189806, the content of which is incorporated herein by reference in its entirety.
[0320] In some embodiments, the STING agonist useful for the present disclosure comprises a compound having the following formula:
##STR00021##
wherein each symbol is defined in WO 2015/185565, the content of which is incorporated herein by reference in its entirety.
[0321] In some embodiments, the STING agonist useful for the present disclosure comprises a compound having the following formula:
##STR00022##
wherein each symbol is defined in WO 2014/179760, the content of which is incorporated herein by reference in its entirety.
[0322] In some embodiments, the STING agonist useful for the present disclosure comprises a compound having the following formula:
##STR00023## ##STR00024## ##STR00025##
wherein each symbol is defined in WO 2014/179335, the content of which is incorporated herein by reference in its entirety.
[0323] In some embodiments, the STING agonist useful for the present disclosure comprises a compound having the following formula.
##STR00026##
described in WO 2015/017652, the content of which is incorporated herein by reference in its entirety.
[0324] In some embodiments, the STING agonist useful for the present disclosure comprises a compound having the following formula:
##STR00027##
described in WO 2016/096577, the content of which is incorporated herein by reference in its entirety.
[0325] In some embodiments, the STING agonist useful for the present disclosure comprises a compound having the following formula:
##STR00028##
wherein each symbol is defined in WO 2016/120305, the content of which is incorporated herein by reference in its entirety.
[0326] In some embodiments, the STING agonist useful for the present disclosure comprises a compound having the following formula:
##STR00029##
wherein each symbol is defined in WO 2016/145102, the content of which is incorporated herein by reference in its entirety.
[0327] In some embodiments, the STING agonist useful for the present disclosure comprises a compound having the following formula:
##STR00030##
wherein each symbol is defined in WO 2017/027646, the content of which is incorporated herein by reference in its entirety.
[0328] In some embodiments, the STING agonist useful for the present disclosure comprises a compound having the following formula:
##STR00031##
wherein each symbol is defined in WO 2017/075477, the content of which is incorporated herein by reference in its entirety.
[0329] In some embodiments, the STING agonist useful for the present disclosure comprises a compound having the following formula:
##STR00032##
wherein each symbol is defined in WO 2017/027645, the content of which is incorporated herein by reference in its entirety.
[0330] In some embodiments, the STING agonist useful for the present disclosure comprises a compound having the following formula:
##STR00033##
wherein each symbol is defined in WO 2018/100558, the content of which is incorporated herein by reference in its entirety.
[0331] In some embodiments, the STING agonist useful for the present disclosure comprises a compound having the following formula:
##STR00034##
wherein each symbol is defined in WO 2017/175147, the content of which is incorporated herein by reference in its entirety.
[0332] In some embodiments, the STING agonist useful for the present disclosure comprises a compound having the following formula:
##STR00035##
wherein each symbol is defined in WO 2017/175156, the content of which is incorporated herein by reference in its entirety.
[0333] In some aspects, the STING agonist useful for the present disclosure is CL606, CL611, CL602, CL655, CL604, CL609, CL614, CL656, CL647, CL626, CL629, CL603, CL632, CL633, CL659, or a pharmaceutically acceptable salt thereof. In some aspects, the STING agonist useful for the present disclosure is CL606 or a pharmaceutically acceptable salt thereof. In some aspects, the STING agonist useful for the present disclosure is CL611 or a pharmaceutically acceptable salt thereof. In some aspects, the STING agonist useful for the present disclosure is CL602 or a pharmaceutically acceptable salt thereof. In some aspects, the STING agonist useful for the present disclosure is CL655 or a pharmaceutically acceptable salt thereof. In some aspects, the STING agonist useful for the present disclosure is CL604 or a pharmaceutically acceptable salt thereof. In some aspects, the STING agonist useful for the present disclosure is CL609 or a pharmaceutically acceptable salt thereof. In some aspects, the STING agonist useful for the present disclosure is CL614 or a pharmaceutically acceptable salt thereof. In some aspects, the STING agonist useful for the present disclosure is CL656 or a pharmaceutically acceptable salt thereof. In some aspects, the STING agonist useful for the present disclosure is CL647 or a pharmaceutically acceptable salt thereof. In some aspects, the STING agonist useful for the present disclosure is CL626 or a pharmaceutically acceptable salt thereof. In some aspects, the STING agonist useful for the present disclosure is CL629 or a pharmaceutically acceptable salt thereof. In some aspects, the STING agonist useful for the present disclosure is CL603 or a pharmaceutically acceptable salt thereof. In some aspects, the STING agonist useful for the present disclosure is CL632 or a pharmaceutically acceptable salt thereof. In some aspects, the STING agonist useful for the present disclosure is CL633 or a pharmaceutically acceptable salt thereof. In some aspects, the STING agonist useful for the present disclosure is CL659 or a pharmaceutically acceptable salt thereof.
[0334] In some aspects, the EV, e.g., exosome, comprises a cyclic dinucleotide STING agonist and/or a non-cyclic dinucleotide STING agonist. In some aspects, when several cyclic dinucleotide STING agonist are present on an EV, e.g., exosome, disclosed herein, such STING agonists can be the same or they can be different. In some aspects, when several non-cyclic dinucleotide STING agonist are present, such STING agonists can be the same or they can be different. In some aspects, an EV, e.g., exosome, composition of the present disclosure can comprise two or more populations of EVs, e.g., exosomes, wherein each population of EVs, e.g., exosomes, comprises a different STING agonist or combination thereof.
[0335] The STING agonists can also be modified to increase encapsulation of the agonist in an extracellular vesicle or EV (e.g., either unbound in the lumen). In some embodiments, the STING agonists are linked to a scaffold moiety, e.g., Scaffold Y. In certain embodiments, the modification allows better expression of the STING agonist on the exterior surface of the EV, e.g., exosome, (e.g., linked to a scaffold moiety disclosed herein, e.g., Scaffold X). This modification can include the addition of a lipid binding tag by treating the agonist with a chemical or enzyme, or by physically or chemically altering the polarity or charge of the STING agonist. The STING agonist may be modified by a single treatment, or by a combination of treatments, e.g., adding a lipid binding tag only, or adding a lipid binding tag and altering the polarity. The previous example is meant to be a non-limiting illustrative instance. It is contemplated that any combination of modifications may be practiced. The modification may increase encapsulation of the agonist in the EV by between 2-fold and 10,000 fold, between 10-fold and 1,000 fold, or between 100-fold and 500-fold compared to encapsulation of an unmodified agonist. The modification may increase encapsulation of the agonist in the EV by at least 2-fold, 5-fold, 10-fold, 20-fold, 30-fold, 40-fold, 50-fold, 60-fold, 70-fold, 80-fold, 90-fold, 100-fold, 200-fold, 300-fold, 400-fold, 500-fold, 600-fold, 700-fold, 800-fold, 900-fold, 1000-fold, 2000-fold, 3000-fold, 4000-fold, 5000-fold, 6000-fold, 7000-fold, 8000-fold, 9000-fold, or 10,000-fold compared to encapsulation of an unmodified agonist.
[0336] In some embodiments, STING agonists can be modified to allow for better expression of the agonists on the exterior surface of the EV, e.g., exosome, (e.g., linked to a scaffold moiety disclosed herein, e.g., Scaffold X). Any of the modifications described above can be used. The modification may increase encapsulation of the agonist in the EV, e.g., exosome, by about between 2-fold and 10,000 fold, about between 10-fold and 1,000 fold, or about between 100-fold and 500-fold compared to encapsulation of an unmodified agonist. The modification can increase expression of the agonist on the exterior surface of the EV, e.g., exosome, by at least about 2-fold, 5-fold, 10-fold, 20-fold, 30-fold, 40-fold, 50-fold, 60-fold, 70-fold, 80-fold, 90-fold, 100-fold, 200-fold, 300-fold, 400-fold, 500-fold, 600-fold, 700-fold, 800-fold, 900-fold, 1000-fold, 2000-fold, 3000-fold, 4000-fold, 5000-fold, 6000-fold, 7000-fold, 8000-fold, 9000-fold, or 10,000-fold compared to expression of an unmodified agonist.
[0337] The concentration of the STING agonist associated with the EV may be about 0.01 μM to 1000 μM. The concentration of the associated STING agonist may be between about 0.01-0.05 μM, 0.05-0.1 μM, 0.1-0.5 μM, 0.5-1 μM, 1-5 μM, 5-10 μM, 10-15 μM, 15-20 μM, 20-25 μM, 25-30 μM, 30-35 μM, 35-40 μM, 45-50 μM, 55-60 μM, 65-70 μM, 70-75 μM, 75-80 μM, 80-85 μM, 85-90 μM, 90-95 μM, 95-100 μM, 100-150 μM, 150-200 μM, 200-250 μM, 250-300 μM, 300-350 μM, 250-400 μM, 400-450 μM, 450-500 μM, 500-550 μM, 550-600 μM, 600-650 μM, 650-700 μM, 700-750 μM, 750-800 μM, 800-850 μM, 805-900 μM, 900-950 μM, or 950-1000 μM. The concentration of the associated STING agonist may be equal to or greater than about 0.01 μM, 0.1 μM, 0.5 μM, 1 μM, 5 μM, 10 μM, 15 μM, 20 μM, 25 μM, 30 μM, 35 μM, 40 μM, 45 μM, 50 μM, 55 μM, 60 μM, 65 μM, 70 μM, 75 μM, 80 μM, 85 μM, 90 μM, 95 μM, 100 μM, 150 μM, 200 μM, 250 μM, 300 μM, 350 μM, 400 μM, 450 μM, 500 μM, 550 μM, 600 μM, 650 μM, 700 μM, 750 μM, 800 μM, 850 μM, 900 μM, 950 μM, or 1000 μM.
[0338] II.B. Scaffold-X-Engineered EVs, e.g., Exosomes
[0339] In some embodiments, EVs of the present disclosure comprise a membrane modified in its composition. For example, their membrane compositions can be modified by changing the protein, lipid, or glycan content of the membrane.
[0340] In some embodiments, the surface-engineered EVs are generated by chemical and/or physical methods, such as PEG-induced fusion and/or ultrasonic fusion. In other embodiments, the surface-engineered EVs, e.g., exosomes, are generated by genetic engineering. EVs produced from a genetically-modified producer cell or a progeny of the genetically-modified cell can contain modified membrane compositions. In some embodiments, surface-engineered EVs, e.g., exosomes, have scaffold moiety (e.g., exosome protein, e.g., Scaffold X) at a higher or lower density (e.g., higher number) or include a variant or a fragment of the scaffold moiety.
[0341] For example, surface-engineered EVs (e.g., Scaffold X-engineered EVs) can be produced from a cell (e.g., HEK293 cells) transformed with an exogenous sequence encoding a scaffold moiety (e.g., exosome proteins, e.g., Scaffold X) or a variant or a fragment thereof. EVs including scaffold moiety expressed from the exogenous sequence can include modified membrane compositions.
[0342] Various modifications or fragments of the scaffold moiety can be used for the embodiments of the present disclosure. For example, scaffold moiety modified to have enhanced affinity to a binding agent can be used for generating surface-engineered EVs that can be purified using the binding agent. Scaffold moieties modified to be more effectively targeted to EVs, e.g., exosomes, and/or membranes can be used. Scaffold moieties modified to comprise a minimal fragment required for specific and effective targeting to EVs, e.g., exosomes, membranes can be also used.
[0343] In some embodiments, a STING agonist disclosed herein is expressed on the surface of an EV, e.g., exosome, as a fusion protein, e.g., fusion protein of a STING agonist to a Scaffold X. For example, the fusion protein can comprise a STING agonist disclosed herein linked to a scaffold moiety (e.g., Scaffold X). In certain embodiments, Scaffold X comprises the PTGFRN protein, BSG protein, IGSF2 protein, IGSF3 protein, IGSF8 protein, ITGB1 protein, ITGA4 protein, SLC3A2 protein, ATP transporter protein, or a fragment or a variant thereof.
[0344] In some embodiments, the surface-engineered EVs, e.g., exosomes (e.g., Scaffold X-engineered EVs, e.g., exosomes) described herein demonstrate superior characteristics compared to EVs, e.g., exosomes, known in the art. For example, surface (e.g., Scaffold X)-engineered contain modified proteins more highly enriched on their surface than naturally occurring EVs, e.g., exosomes, or the EVs, e.g., exosomes, produced using conventional exosome proteins. Moreover, the surface-engineered EVs, e.g., exosomes, (e.g., Scaffold X-engineered EVs, e.g., exosomes) of the present invention can have greater, more specific, or more controlled biological activity compared to naturally occurring EVs, e.g., exosomes, or the EVs, e.g., exosomes, produced using conventional exosome proteins.
[0345] In other embodiments, the EVs, e.g., exosomes, of the present disclosure contains a STING agonist and a Scaffold X, wherein the STING agonist is linked to the Scaffold X. In some embodiments, the EVs, e.g., exosomes, of the present disclosure comprises a STING agonist and a Scaffold X, wherein the STING agonist is not linked to the Scaffold X.
[0346] In some embodiments, Scaffold X useful for the present disclosure comprises Prostaglandin F2 receptor negative regulator (the PTGFRN polypeptide). The PTGFRN protein can be also referred to as CD9 partner 1 (CD9P-1), Glu-Trp-Ile EWI motif-containing protein F (EWI-F), Prostaglandin F2-alpha receptor regulatory protein, Prostaglandin F2-alpha receptor-associated protein, or CD315. The full length amino acid sequence of the human PTGFRN protein (Uniprot Accession No. Q9P2B2) is shown at Table 1 as SEQ ID NO: 1. The PTGFRN polypeptide contains a signal peptide (amino acids 1 to 25 of SEQ ID NO: 1), the extracellular domain (amino acids 26 to 832 of SEQ ID NO: 1), a transmembrane domain (amino acids 833 to 853 of SEQ ID NO: 1), and a cytoplasmic domain (amino acids 854 to 879 of SEQ ID NO: 1). The mature PTGFRN polypeptide consists of SEQ ID NO: 1 without the signal peptide, i.e., amino acids 26 to 879 of SEQ ID NO: 1. In some embodiments, a PTGFRN polypeptide fragment useful for the present disclosure comprises a transmembrane domain of the PTGFRN polypeptide. In other embodiments, a PTGFRN polypeptide fragment useful for the present disclosure comprises the transmembrane domain of the PTGFRN polypeptide and (i) at least five, at least 10, at least 15, at least 20, at least 25, at least 30, at least 40, at least 50, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, at least 130, at least 140, at least 150 amino acids at the N terminus of the transmembrane domain, (ii) at least five, at least 10, at least 15, at least 20, or at least 25 amino acids at the C terminus of the transmembrane domain, or both (i) and (ii).
[0347] In some embodiments, the fragments of PTGFRN polypeptide lack one or more functional or structural domains, such as IgV.
[0348] In other embodiments, the Scaffold X comprises an amino acid sequence at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to amino acids 26 to 879 of SEQ ID NO: 1. In other embodiments, the Scaffold X comprises an amino acid sequence at least about at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 33. In other embodiments, the Scaffold X comprises the amino acid sequence of SEQ ID NO: 33, except one amino acid mutation, two amino acid mutations, three amino acid mutations, four amino acid mutations, five amino acid mutations, six amino acid mutations, or seven amino acid mutations. The mutations can be a substitution, an insertion, a deletion, or any combination thereof. In some embodiments, the Scaffold X comprises the amino acid sequence of SEQ ID NO: 33 and 1 amino acid, two amino acids, three amino acids, four amino acids, five amino acids, six amino acids, seven amino acids, eight amino acids, nine amino acids, ten amino acids, 11 amino acids, 12 amino acids, 13 amino acids, 14 amino acids, 15 amino acids, 16 amino acids, 17 amino acids, 18 amino acids, 19 amino acids, or 20 amino acids or longer at the N terminus and/or C terminus of SEQ ID NO: 33.
[0349] In other embodiments, the Scaffold X comprises an amino acid sequence at least about at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 2, 3, 4, 5, 6, or 7. In other embodiments, the Scaffold X comprises the amino acid sequence of SEQ ID NO: 2, 3, 4, 5, 6, or 7, except one amino acid mutation, two amino acid mutations, three amino acid mutations, four amino acid mutations, five amino acid mutations, six amino acid mutations, or seven amino acid mutations. The mutations can be a substitution, an insertion, a deletion, or any combination thereof. In some embodiments, the Scaffold X comprises the amino acid sequence of SEQ ID NO: 2, 3, 4, 5, 6, or 7 and 1 amino acid, two amino acids, three amino acids, four amino acids, five amino acids, six amino acids, seven amino acids, eight amino acids, nine amino acids, ten amino acids, 11 amino acids, 12 amino acids, 13 amino acids, 14 amino acids, 15 amino acids, 16 amino acids, 17 amino acids, 18 amino acids, 19 amino acids, or 20 amino acids or longer at the N terminus and/or C terminus of SEQ ID NO: 2, 3, 4, 5, 6, or 7.
TABLE-US-00001 TABLE 1 Protein Sequence The MGRLASRPLLLALLSLALCRGRVVRVPTATLVRVVGTELVIPCNVSDYDGPSEQN PTGFRN FDWSF Protein SSLGSSFVELASTWEVGFPAQLYQERLQRGEILLRRTANDAVELHIKNVQPSDQG (SEQ ID NO: HYKCS 1) TPSTDATVQGNYEDTVQVKVLADSLHVGPSARPPPSLSLREGEPFELRCTAASASP LHTH LALLWEVHRGPARRSVLALTHEGRFHPGLGYEQRYHSGDVRLDTVGSDAYRLSV SRALSA DQGSYRCIVSEWIAEQGNWQEIQEKAVEVATVVIQPSVLRAAVPKNVSVAEGKE LDLTCN ITTDRADDVRPEVTWSFSRMPDSTLPGSRVLARLDRDSLVHSSPHVALSHVDARS YHLLV RDVSKENSGYYYCHVSLWAPGHNRSWHKVAEAVSSPAGVGVTWLEPDYQVYL NASKVPGF ADDPTELACRVVDTKSGEANVRFTVSWYYRMNRRSDNVVTSELLAVMDGDWT LKYGERSK QRAQDGDFIFSKEHTDTFNFRIQRTTEEDRGNYYCVVSAWTKQRNNSWVKSKDV FSKPVN IFWALEDSVLVVKARQPKPFFAAGNTFEMTCKVSSKNIKSPRYSVLIMAEKPVGD LSSPN ETKYIISLDQDSVVKLENWTDASRVDGVVLEKVQEDEFRYRMYQTQVSDAGLYR CMVTAW SPVRGSLWREAATSLSNPIEIDFQTSGPIFNASVHSDTPSVIRGDLIKLFCIITVEGAA L DPDDMAFDVSWFAVHSFGLDKAPVLLSSLDRKGIVTTSRRDWKSDLSLERVSVL EFLLQV HGSEDQDFGNYYCSVTPWVKSPTGSWQKEAEIHSKPVFITVKMDVLNAFKYPLLI GVGLS TVIGLLSCLIGYCSSHWCCKKEVQETRRERRRLMSMEMD The GPIFNASVHSDTPSVIRGDLIKLFCIITVEGAALDPDDMAFDVSWFAVHSFGLDKA PTGFRN PVLL protein SSLDRKGIVTTSRRDWKSDLSLERVSVLEFLLQVHGSEDQDFGNYYCSVTPWVKS Fragment PTGSW (SEQ ID NO: QKEAEIHSKPVFITVKMDVLNAFKYPLLIGVGLSTVIGLLSCLIGYCSSHWCCKKE 33) VQET RRERRRLMSMEM 687-878 of SEQ ID NO: 1 The BSG MAAALFVLLG FALLGTHGAS GAAGFVQAPL SQQRWVGGSV ELHCEAVGSP protein VPEIQWWFEG QGPNDTCSQL WDGARLDRVH IHATYHQHAA STISIDTLVE (SEQ ID NO: EDTGTYECRA SNDPDRNHLT RAPRVKWVRA QAVVLVLEPG TVFTTVEDLG 9) SKILLTCSLN DSATEVTGHR WLKGGVVLKE DALPGQKTEF KVDSDDQWGE YSCVFLPEPM GTANIQLHGP PRVKAVKSSE HINEGETAML VCKSESVPPV TDWAWYKITD SEDKALMNGS ESRFFVSSSQ GRSELHIENL NMEADPGQYR CNGTSSKGSD QAIITLRVRS HLAALWPFLG IVAEVLVLVT IIFIYEKRRK PEDVLDDDDA GSAPLKSSGQ HQNDKGKNVR QRNSS The IGSF8 MGALRPTLLP PSLPLLLLLM LGMGCWAREV LVPEGPLYRV AGTAVSISCN protein VTGYEGPAQQ NFEWFLYRPE APDTALGIVS TKDTQFSYAV FKSRVVAGEV (SEQ ID NO: QVQRLQGDAV VLKIARLQAQ DAGIYECHTP STDTRYLGSY SGKVELRVLP 14) DVLQVSAAPP GPRGRQAPTS PPRMTVHEGQ ELALGCLART STQKHTHLAV SFGRSVPEAP VGRSTLQEVV GIRSDLAVEA GAPYAERLAA GELRLGKEGT DRYRMVVGGA QAGDAGTYHC TAAEWIQDPD GSWAQIAEKR AVLAHVDVQT LSSQLAVTVG PGERRIGPGE PLELLCNVSG ALPPAGRHAA YSVGWEMAPA GAPGPGRLVA QLDlEGVGSL GPGYEGRHIA MEKVASRTYR LRLEAARPGD AGTYRCLAKA YVRGSGTRLR EAASARSRPL PVHVREEGVV LEAVAWLAGG TVYRGETASL LCNISVRGGP PGLRLAASWW VERPEDGELS SVPAQLVGGV GQDGVAELGV RPGGGPVSVE LVGPRSHRLR LHSLGPEDEG VYHCAPSAWV QHADYSWYQA GSARSGPVTV YPYMHALDTL FVPLLVGTGV ALVTGATVLG TITCCFMKRL RKR The ITGB1 MNLQPIFWIG LISSVCCVFA QTDENRCLKA NAKSCGECIQ AGPNCGWCTN protein STFLQEGMPT SARCDDLEAL KKKGCPPDDI ENPRGSKDIK KNKNVTNRSK (SEQ ID NO: GTAEKLKPED ITQIQPQQLV LRLRSGEPQT FTLKFKRAED YPIDLYYLMD 21) LSYSMKDDLE NVKSLGTDLM NEMRRITSDF RIGFGSFVEK TVMPYISTTP AKLRNPCTSE QNCTSPFSYK NVLSLTNKGE VFNELVGKQR ISGNLDSPEG GFDAIMQVAV CGSLIGWRNV TRLLVFSTDA GFHFAGDGKL GGIVLPNDGQ CHLENNMYTM SHYYDYPSIA HLVQKLSENN IQTIFAVTEE FQPVYKELKN LIPKSAVGTL SANSSNVIQL IIDAYNSLSS EVILENGKLS EGVTISYKSY CKNGVNGTGE NGRKCSNISI GDEVQFEISI TSNKCPKKDS DSFKIRPLGF TEEVEVILQY ICECECQSEG IPESPKCHEG NGTFECGACR CNEGRVGRHC ECSTDEVNSE DMDAYCRKEN SSEICSNNGE CVCGQCVCRK RDNTNEIYSG ASNGQICNGR GICECGVCKC TDPKFQGQTC EMCQTCLGVC AEHKECVQCR AFNKGEKKDT CTQECSYFNI TKVESRDKLP QPVQPDPVSH CKEKDVDDCW FYFTYSVNGN NEVMVHVVEN PECPTGPDII PIVAGVVAGI VLIGLALLLI WKLLMIIHDR REFAKFEKEK MNAKWDTGEN PIYKSAVTTV VNPKYEGK The ITGA4 MAWEARREPG PRRAAVRETV MLLLCLGVPT GRPYNVDTES ALLYQGPHNT protein LFGYSVVLHS HGANRWLLVG APTANWLANA SVINPGAIYR CRIGKNPGQT (SEQ ID NO: CEQLQLGSPN GEPCGKTCLE ERDNQWLGVT LSRQPGENGS IVTCGHRWKN 22) IFYIKNENKL PTGGCYGVPP DLR1ELSKRI APCYQDYVKK FGENFASCQA GISSFYTKDL IVMGAPGSSY WTGSLFVYNI TTNKYKAFLD KQNQVKFGSY LGYSVGAGHF RSQHTTEVVG GAPQHEQIGK AYIFSIDEKE LNILHEMKGK KLGSYFGASV CAVDLNADGF SDLLVGAPMQ STIREEGRVF VYINSGSGAV MNAMETNLVG SDKYAARFGE SIVNLGDIDN DGFEDVAIGA PQEDDLQGAI YIYNGRADGI SSTFSQRIEG LQISKSLSMF GQSISGQIDA DNNGYVDVAV GAFRSDSAVL LRTRPVVIVD ASLSHPESVN RTKFDCVENG WPSVCIDLTL CFSYKGKEVP GYIVLFYNMS LDVNRKAESP PRFYFSSNGT SDVITGSIQV SSREANCRTH QAFMRKDVRD ILTPIQIEAA YHLGPHVISK RSTEEFPPLQ PILQQKKEKD IMKKTINFAR FCAHENCSAD LQVSAKIGFL KPHENKTYLA VGSMKTLMLN VSLFNAGDDA YETTLHVKLP VGLYFIKILE LEEKQINCEV TDNSGVVQLD CSIGYIYVDH LSRIDISFLL DVSSLSRAEE DLSITVHATC ENEEEMDNLK HSRVTVAIPL KYEVKLTVHG FVNPTSFVYG SNDENEPETC MVEKMNLTFH VINTGNSMAP NVSVEIMVPN SFSPQTDKLF NILDVQTTTG ECHFENYQRV CALEQQKSAM QTLKGIVRFL SKTDKRLLYC IKADPHCLNF LCNFGKMESG KEASVHIQLE GRPSILEMDE TSALKFEIRA TGFPEPNPRV IELNKDENVA HVLLEGLHHQ RPKRYFTIVI ISSSLLLGLI VLLLISYVMW KAGFFKRQYK SILQEENRRD SWSYINSKSN DD The SLC3A2 MELQPPEASI AVVSIPRQLP GSHSEAGVQG LSAGDDSELG SHCVAQTGLE Protein, LLASGDPLPS ASQNAEMIET GSDCVTQAGL QLLASSDPPA LASKNAEVTG where TMSQDTEVDM KEVELNELEP EKQPMNAASG AAMSLAGAEK NGLVKIKVAE the first Met DEAEAAAAAK FTGLSKEELL KVAGSPGWVR TRWALLLLFW LGWLGMLAGA is processed. VVIIVRAPRC RELPAQKWWH TGALYRIGDL QAFQGHGAGN LAGLKGRLDY (SEQ ID NO: LSSLKVKGLV LGPIHKNQKD DVAQTDLLQI DPNFGSKEDF DSLLQSAKKK 23) SIRVILDLTP NYRGENSWFS TQVDTVATKV KDALEFWLQA GVDGFQVRDI ENLKDASSFL AEWQNITKGF SEDRLLIAGT NSSDLQQILS LLESNKDLLL TSSYLSDSGS TGEHTKSLVT QYLNATGNRW CSWSLSQARL LTSFLPAQLL RLYQLMLFTL PGTPVFSYGD EIGLDAAALP GQPMEAPVML WDESSFPDIP GAVSANMTVK GQSEDPGSLL SLFRRLSDQR SKERSLLHGD FHAFSAGPGL FSYIRHWDQN ERFLVVLNFG DVGLSAGLQA SDLPASASLP AKADLLLSTQ PGREEGSPLE LERLKLEPHE GLLLRFPYAA
[0350] In some embodiments, a Scaffold X useful for the present disclosure comprises Basigin (the BSG protein), represented by SEQ ID NO: 9. The BSG protein is also known as 5F7, Collagenase stimulatory factor, Extracellular matrix metalloproteinase inducer (EMMPRIN), Leukocyte activation antigen M6, OK blood group antigen, Tumor cell-derived collagenase stimulatory factor (TCSF), or CD147. The Uniprot number for the human BSG protein is P35613. The signal peptide of the BSG protein is amino acid 1 to 21 of SEQ ID NO: 9. Amino acids 138-323 of SEQ ID NO: 9 is the extracellular domain, amino acids 324 to 344 is the transmembrane domain, and amino acids 345 to 385 of SEQ ID NO: 9 is the cytoplasmic domain.
[0351] In other embodiments, the Scaffold X comprises an amino acid sequence at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to amino acids 22 to 385 of SEQ ID NO: 9. In some embodiments, the fragments of Basigin polypeptide lack one or more functional or structural domains, such as IgV, e.g., amino acids 221 to 315 of SEQ ID NO: 9. In other embodiments, the Scaffold X comprises an amino acid sequence at least about at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 10, 11, or 12. In other embodiments, the Scaffold X comprises the amino acid sequence of SEQ ID NO: 10, 11, or 12, except one amino acid mutation, two amino acid mutations, three amino acid mutations, four amino acid mutations, five amino acid mutations, six amino acid mutations, or seven amino acid mutations. The mutations can be a substitution, an insertion, a deletion, or any combination thereof. In some embodiments, the Scaffold X comprises the amino acid sequence of SEQ ID NO: 10, 11, or 12 and 1 amino acid, two amino acids, three amino acids, four amino acids, five amino acids, six amino acids, seven amino acids, eight amino acids, nine amino acids, ten amino acids, 11 amino acids, 12 amino acids, 13 amino acids, 14 amino acids, 15 amino acids, 16 amino acids, 17 amino acids, 18 amino acids, 19 amino acids, or 20 amino acids or longer at the N terminus and/or C terminus of SEQ ID NO: 10, 11, or 12.
[0352] In some embodiments, a Scaffold X useful for the present disclosure comprises Immunoglobulin superfamily member 8 (IgSF8 or the IGSF8 protein), which is also known as CD81 partner 3, Glu-Trp-Ile EWI motif-containing protein 2 (EWI-2), Keratinocytes-associated transmembrane protein 4 (KCT-4), LIR-D1, Prostaglandin regulatory-like protein (PGRL) or CD316. The full length human IGSF8 protein is accession no. Q969P0 in Uniprot and is shown as SEQ ID NO: 14 herein. The human IGSF8 protein has a signal peptide (amino acids 1 to 27 of SEQ ID NO: 14), an extracellular domain (amino acids 28 to 579 of SEQ ID NO: 14), a transmembrane domain (amino acids 580 to 600 of SEQ ID NO: 14), and a cytoplasmic domain (amino acids 601 to 613 of SEQ ID NO: 14).
[0353] In other embodiments, the Scaffold X comprises an amino acid sequence at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to amino acids 28 to 613 of SEQ ID NO: 14. In some embodiments, the IGSF8 protein lack one or more functional or structural domains, such as IgV. In other embodiments, the Scaffold X comprises an amino acid sequence at least about at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 15, 16, 17, or 18. In other embodiments, the Scaffold X comprises the amino acid sequence of SEQ ID NO: 15, 16, 17, or 18, except one amino acid mutation, two amino acid mutations, three amino acid mutations, four amino acid mutations, five amino acid mutations, six amino acid mutations, or seven amino acid mutations. The mutations can be a substitution, an insertion, a deletion, or any combination thereof. In some embodiments, the Scaffold X comprises the amino acid sequence of SEQ ID 15, 16, 17, or 18 and 1 amino acid, two amino acids, three amino acids, four amino acids, five amino acids, six amino acids, seven amino acids, eight amino acids, nine amino acids, ten amino acids, 11 amino acids, 12 amino acids, 13 amino acids, 14 amino acids, 15 amino acids, 16 amino acids, 17 amino acids, 18 amino acids, 19 amino acids, or 20 amino acids or longer at the N terminus and/or C terminus of SEQ ID NO: 15, 16, 17, or 18.
[0354] In some embodiments, a Scaffold X that can be used with STING agonists disclosed herein comprises Immunoglobulin superfamily member 3 (IgSF3 or the IGSF3 protein), which is also known as Glu-Trp-Ile EWI motif-containing protein 3 (EWI-3), and is shown as the amino acid sequence of SEQ ID NO: 20. The human IGSF3 protein has a signal peptide (amino acids 1 to 19 of SEQ ID NO: 20), an extracellular domain (amino acids 20 to 1124 of SEQ ID NO: 20), a transmembrane domain (amino acids 1125 to 1145 of SEQ ID NO: 20), and a cytoplasmic domain (amino acids 1146 to 1194 of SEQ ID NO: 20).
[0355] In other embodiments, the Scaffold X comprises an amino acid sequence at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to amino acids 28 to 613 of SEQ ID NO: 20. In some embodiments, the IGSF3 protein lack one or more functional or structural domains, such as IgV.
[0356] In some embodiments, a Scaffold X useful for the present disclosure comprises Integrin beta-1 (the ITGB1 protein), which is also known as Fibronectin receptor subunit beta, Glycoprotein IIa (GPIIA), VLA-4 subunit beta, or CD29, and is shown as the amino acid sequence of SEQ ID NO: 21. The human ITGB1 protein has a signal peptide (amino acids 1 to 20 of SEQ ID NO: 21), an extracellular domain (amino acids 21 to 728 of SEQ ID NO: 21), a transmembrane domain (amino acids 729 to 751 of SEQ ID NO: 21), and a cytoplasmic domain (amino acids 752 to 798 of SEQ ID NO: 21).
[0357] In other embodiments, a Scaffold X comprises an amino acid sequence at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to amino acids 21 to 798 of SEQ ID NO: 21. In some embodiments, the ITGB1 protein lack one or more functional or structural domains, such as IgV.
[0358] In other embodiments, a Scaffold X comprises the ITGA4 protein, which comprises an amino acid sequence at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 22 without the signal peptide (amino acids 1 to 33 of SEQ ID NO: 22). In some embodiments, the ITGA4 protein lacks one or more functional or structural domains, such as IgV.
[0359] In other embodiments, a Scaffold X comprises the SLC3A2 protein, which comprises an amino acid sequence at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 23 without the signal peptide. In some embodiments, the SLC3A2 protein lacks one or more functional or structural domains, such as IgV.
[0360] In other embodiments, a Scaffold X comprises the ATP1A1 protein, which comprises an amino acid sequence at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 24 without the signal peptide. In some embodiments, the ATP1A1 protein lacks one or more functional or structural domains, such as IgV.
[0361] In other embodiments, a Scaffold X comprises the ATP1A2 protein, which comprises an amino acid sequence at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 25 without the signal peptide. In some embodiments, the ATP1A2 protein lacks one or more functional or structural domains, such as IgV.
[0362] In other embodiments, a Scaffold X comprises the ATP1A3 protein, which comprises an amino acid sequence at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 26 without the signal peptide. In some embodiments, the ATP1A3 protein lacks one or more functional or structural domains, such as IgV.
[0363] In other embodiments, a Scaffold X comprises the ATP1A4 protein, which comprises an amino acid sequence at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 27 without the signal peptide. In some embodiments, the ATP1A4 protein lacks one or more functional or structural domains, such as IgV.
[0364] In other embodiments, a Scaffold X comprises the ATP1A5 protein, which comprises an amino acid sequence at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 28 without the signal peptide. In some embodiments, the ATP1A5 protein lacks one or more functional or structural domains, such as IgV.
[0365] In other embodiments, a Scaffold X comprises the ATP2B1 protein, which comprises an amino acid sequence at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 29 without the signal peptide. In some embodiments, the ATP2B1 protein lacks one or more functional or structural domains, such as IgV.
[0366] In other embodiments, a Scaffold X comprises the ATP2B2 protein, which comprises an amino acid sequence at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 30 without the signal peptide. In some embodiments, the ATP2B2 protein lacks one or more functional or structural domains, such as IgV.
[0367] In other embodiments, a Scaffold X comprises the ATP2B3 protein, which comprises an amino acid sequence at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 31 without the signal peptide. In some embodiments, the ATP2B3 protein lacks one or more functional or structural domains, such as IgV.
[0368] In other embodiments, a Scaffold X comprises the ATP2B4 protein, which comprises an amino acid sequence at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 32 without the signal peptide. In some embodiments, the ATP2B4 protein lacks one or more functional or structural domains, such as IgV.
[0369] In other embodiments, a Scaffold X comprises the IGSF2 protein, which comprises an amino acid sequence at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 34 without the signal peptide. In some embodiments, the IGSF2 protein lacks one or more functional or structural domains, such as IgV.
[0370] Non-limiting examples of other Scaffold X proteins that can be used to link a STING agonist to the surface of EVs, e.g., exosomes, can be found at U.S. Pat. No. 10,195,290 B1, issued Feb. 5, 2019, which is incorporated by reference in its entirety.
[0371] In some embodiments, a Scaffold X protein useful for the present disclosure lacks at least 5, 10, 50, 100, 200, 300, 400, 500, 600, 700, or 800 amino acids from the N-terminus of the native protein. In some embodiments, a Scaffold X lacks at least 5, 10, 50, 100, 200, 300, 400, 500, 600, 700, or 800 amino acids from the C-terminus of the native protein. In some embodiments, a Scaffold X lacks at least 5, 10, 50, 100, 200, 300, 400, 500, 600, 700, or 800 amino acids from both the N-terminus and C-terminus of the native protein. In some embodiments, a Scaffold X lacks one or more functional or structural domains of the native protein.
[0372] In some embodiments, Scaffold X described herein can also be used to link a STING agonist on the luminal surface and/or on the exterior surface of the EVs, e.g., exosomes, at the same time. For example, the PTGFRN polypeptide can be used to link a STING agonist inside the lumen in addition to the surface of the EV, e.g., exosome. In some embodiments, a Scaffold X can be used to link a STING agonist and an additional therapeutic agent to the EVs, e.g., exosomes, (e.g., payload). Therefore, in certain embodiments, Scaffold X disclosed herein can be used for dual purposes.
[0373] Scaffold-Y-Engineered EVs, e.g., Exosomes
[0374] In some embodiments, EVs, e.g., exosomes, of the present disclosure comprise an internal space (i.e., lumen) that is different from that of the naturally occurring EVs, e.g., exosomes. For example, the EV, e.g., exosome, can be changed such that the composition in the luminal side of the EV, e.g., exosome, has the protein, lipid, or glycan content different from that of the naturally-occurring EVs, e.g., exosomes.
[0375] In some embodiments, engineered EVs, e.g., exosomes, can be produced from a cell transformed with an exogenous sequence encoding a scaffold moiety (e.g., exosome proteins, e.g., Scaffold Y) or a modification or a fragment of the scaffold moiety that changes the composition or content of the luminal side of the EV, e.g., exosome. Various modifications or fragments of the exosome protein that can be expressed in the luminal side of the EV, e.g., exosome, can be used for the embodiments of the present disclosure.
[0376] In some embodiments, a STING agonist disclosed herein is in the lumen of the EV, e.g., exosome (i.e., encapsulated). In some embodiments, a STING agonist is linked to the luminal surface of the EV, e.g., exosome. As used herein, when a molecule (e.g., antigen or adjuvant) is described as “in the lumen” of the EV, e.g., exosome, it means that the molecule is located within the EV, e.g., exosome (e.g., associated), but is not linked to any molecule on the luminal surface of EVs. In other embodiments, a STING agonist is expressed on the luminal surface of the EV, e.g., exosome as a fusion molecule, e.g., fusion molecule of a STING agonist to a scaffold moiety (e.g., Scaffold Y). In certain embodiments, Scaffold Y comprises the MARCKS protein, MARCKSL1 protein, BASP1 protein, or any combination thereof.
[0377] In other embodiments, the EVs, e.g., exosomes, of the present disclosure contain a STING agonist and a Scaffold Y, wherein the STING agonist is linked to Scaffold Y. In some embodiments, the EVs, e.g., exosomes, of the present disclosure comprise a STING agonist and a Scaffold Y, wherein the STING agonist is not linked to Scaffold Y.
[0378] In some embodiments, scaffold moieties (e.g., Scaffold Y) that can change the luminal side of the EVs, e.g., exosomes, include, but are not limited to the MARCKS protein, MARCKSL1 protein, BASP1 protein, or any combination thereof. In some embodiments, Scaffold Y comprises Brain Acid Soluble Protein 1 (the BASP1 protein). The BASP1 protein is also known as 22 kDa neuronal tissue-enriched acidic protein or neuronal axonal membrane protein NAP-22. The full-length human BASP1 protein sequence (isomer 1) is shown in Table 2. An isomer produced by an alternative splicing is missing amino acids 88 to 141 from SEQ ID NO: XX (isomer 1).
TABLE-US-00002 TABLE 2 Protein Sequence The BASP1 MGGKLSKKKK GYNVNDEKAK EKDKKAEGAA protein (SEQ TEEEGTPKES EPQAAAEPAE AKEGKEKPDQ ID NO: 49) DAEGKAEEKE GEKDAAAAKE EAPKAEPEKT EGAAEAKAEP PKAPEQEQAA PGPAAGGEAP KAAEAAAAPA ESAAPAAGEE PSKEEGEPKK TEAPAAPAAQ ETKSDGAPAS DSKPGSSEAA PSSKETPAAT EAPSSTPKAQ GPAASAEEPK PVEAPAANSD QTVTVKE
[0379] The mature BASP1 protein sequence is missing the first Met from SEQ ID NO: 49 and thus contains amino acids 2 to 227 of SEQ ID NO: 49.
[0380] In other embodiments, Scaffold Y useful for the present disclosure comprises an amino acid sequence at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to amino acids 2 to 227 of SEQ ID NO: 49. In other embodiments, the Scaffold X comprises an amino acid sequence at least about at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 50-155. In other embodiments, a Scaffold Y useful for the present disclosure comprises the amino acid sequence of SEQ ID NO: 50-155, except one amino acid mutation, two amino acid mutations, three amino acid mutations, four amino acid mutations, five amino acid mutations, six amino acid mutations, or seven amino acid mutations. The mutations can be a substitution, an insertion, a deletion, or any combination thereof. In some embodiments, a Scaffold Y useful for the present disclosure comprises the amino acid sequence of SEQ ID NO: 50-155 and 1 amino acid, two amino acids, three amino acids, four amino acids, five amino acids, six amino acids, seven amino acids, eight amino acids, nine amino acids, ten amino acids, 11 amino acids, 12 amino acids, 13 amino acids, 14 amino acids, 15 amino acids, 16 amino acids, 17 amino acids, 18 amino acids, 19 amino acids, or 20 amino acids or longer at the N terminus and/or C terminus of SEQ ID NO: 50-155.
[0381] In some embodiments, a Scaffold Y useful for the present disclosure is the MARCKS protein, which comprises an amino acid sequence at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 47 without the signal peptide. In certain embodiments, the MARCKS protein lacks one or more functional or structural domains.
[0382] In some embodiments, a Scaffold Y comprises the MARCKSL1 protein, which comprises an amino acid sequence at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to SEQ ID NO: 48 without the signal peptide. In certain embodiments, the MARCKS protein lacks one or more functional or structural domains.
[0383] In some embodiments, a Scaffold Y useful for the present disclosure comprises a peptide with the MGXKLSKKK, where X is alanine or any other amino acid (SEQ ID NO: 163). In some embodiments, an EV, e.g., exosome, comprises a peptide with sequence of (M)(G)(π)(ξ)(Φ/π)(S/A/G/N)(+)(+), wherein each parenthetical position represents an amino acid, and wherein 7L is any amino acid selected from the group consisting of (Pro, Gly, Ala, Ser), ξ is any amino acid selected from the group consisting of (Asn, Gln, Ser, Thr, Asp, Glu, Lys, His, Arg), Φ is any amino acid selected from the group consisting of (Val, Ile, Leu, Phe, Trp, Tyr, Met), and (+) is any amino acid selected from the group consisting of (Lys, Arg, His); and wherein position five is not (+) and position six is neither (+) nor (Asp or Glu). In further embodiments, an EV, e.g., exosome, described herein (e.g., engineered EVs, e.g., exosomes) comprises a peptide with sequence of (M)(G)(π)(X)(Φ/π)(π)(+)(+), wherein each parenthetical position represents an amino acid, and wherein 7L is any amino acid selected from the group consisting of (Pro, Gly, Ala, Ser), X is any amino acid, D is any amino acid selected from the group consisting of (Val, Ile, Leu, Phe, Trp, Tyr, Met), and (+) is any amino acid selected from the group consisting of (Lys, Arg, His); and wherein position five is not (+) and position six is neither (+) nor (Asp or Glu).
[0384] In some embodiments, a Scaffold Y that can be used to express a STING agonist on the luminal surface of an EV, e.g., exosome, comprises an amino acid sequence at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to any one of SEQ ID NO: 7-155.
[0385] Scaffold Y-engineered EVs, e.g., exosomes, described herein can be produced from a cell transformed with a sequence set forth in SEQ ID NOs: 47-155.
[0386] II.C. Linker
[0387] The EVs of the present disclosure can comprises one or more linkers that link the STING agonist to EVs or to a scaffold moiety, e.g., Scaffold X on the exterior surface of the EVs. In some embodiments, the STING agonist is linked to the EVs directly or in a scaffold moiety on the EVs by a linker. The linker can be any chemical moiety known in the art.
[0388] In some embodiments, the term “linker” refers to a peptide or polypeptide sequence (e.g., a synthetic peptide or polypeptide sequence) or to a non-polypeptide. In some aspects, two or more linkers can be linked in tandem. Generally, linkers provide flexibility or prevent/ameliorate steric hindrances. Linkers are not typically cleaved; however in certain aspects, such cleavage can be desirable. Accordingly, in some aspects a linker can comprise one or more protease-cleavable sites, which can be located within the sequence of the linker or flanking the linker at either end of the linker sequence.
[0389] In some embodiments, the linker is a peptide linker. In some embodiments, the peptide linker can comprise at least about two, at least about three, at least about four, at least about five, at least about 10, at least about 15, at least about 20, at least about 25, at least about 30, at least about 35, at least about 40, at least about 45, at least about 50, at least about 55, at least about 60, at least about 65, at least about 70, at least about 75, at least about 80, at least about 85, at least about 90, at least about 95, or at least about 100 amino acids.
[0390] In some embodiments, the peptide linker is synthetic, i.e., non-naturally occurring. In one aspect, a peptide linker includes peptides (or polypeptides) (e.g., natural or non-naturally occurring peptides) which comprise an amino acid sequence that links or genetically fuses a first linear sequence of amino acids to a second linear sequence of amino acids to which it is not naturally linked or genetically fused in nature. For example, in one aspect the peptide linker can comprise non-naturally occurring polypeptides which are modified forms of naturally occurring polypeptides (e.g., comprising a mutation such as an addition, substitution or deletion).
[0391] Linkers may be susceptible to cleavage (“cleavable linker”) thereby facilitating release of the STING Agonist or other payloads. In some aspects, the linker is a “reduction-sensitive linker.” In some aspects, the reduction-sensitive linker contains a disulfide bond. In some aspects, the linker is an “acid labile linker.” In some aspects, the acid labile linker contains hydrazone. Suitable acid labile linkers also include, for example, a cis-aconitic linker, a hydrazide linker, a thiocarbamoyl linker, or any combination thereof. In some aspects, the linker comprises a non-cleavable liker.
[0392] II.D. Producer Cells and Modifications
[0393] EVs, e.g., exosomes, can be produced from a cell grown in vitro or a body fluid of a subject. When EVs, e.g., exosomes, are produced from in vitro cell culture, various producer cells, e.g., HEK293 cells, can be used. Additional cell types that can be used for the production of the lumen-engineered EVs, e.g., exosomes, described herein include, without limitation, mesenchymal stem cells, T-cells, B-cells, dendritic cells, macrophages, and cancer cell lines. Further examples include: Chinese hamster ovary (CHO) cells, mesenchymal stem cells (MSCs), BJ human foreskin fibroblast cells, fHDF fibroblast cells, AGE.HN® neuronal precursor cells, CAP® amniocyte cells, adipose mesenchymal stem cells, and RPTEC/TERT1 cells. In certain embodiments, a producer cell is not a dendritic cell, macrophage, B cell, mast cell, neutrophil, Kupffer-Browicz cell, cell derived from any of these cells, or any combination thereof.
[0394] Some embodiments may also include genetically modifying the EV, e.g., exosome, to comprise one or more exogenous sequences to produce modified EVs that express exogenous proteins on the vesicle surface. The exogenous sequences can comprise a sequence encoding the EV, e.g., exosome, protein or a modification or a fragment of the EV protein. An extra copy of the sequence encoding the EV, e.g., exosome, protein can be introduced to produce a surface-engineered EV having a higher density of the EV protein. An exogenous sequence encoding a modification or a fragment of the EV, e.g., exosome, protein can be introduced to produce a modified EV containing the modification or the fragment of the EV protein. An exogenous sequence encoding an affinity tag can be introduced to produce a modified EV, e.g., exosome, containing a fusion protein comprising the affinity tag attached to the EV protein.
[0395] In some embodiments, the exogenous sequence encodes for Scaffold X (e.g., a PTGFRN protein, a BSG protein, an IGSF2 protein, an IGSF3 protein, an IGSF8 protein, an ITGB1 protein, an ITGA4 protein, a SLC3A2 protein, an ATP transporter protein, or a fragment or a variant thereof). In some embodiments the modified EV, e.g., exosome, overexpresses Scaffold X (e.g., a PTGFRN protein, a BSG protein, an IGSF2 protein, an IGSF3 protein, an IGSF8 protein, an ITGB1 protein, an ITGA4 protein, a SLC3A2 protein, an ATP transporter protein, or a fragment or a variant thereof). In other embodiments, the EV, e.g., exosome, is produced by a cell that overexpresses Scaffold X (e.g., a PTGFRN protein, a BSG protein, an IGSF2 protein, an IGSF3 protein, an IGSF8 protein, an ITGB1 protein, an ITGA4 protein, a SLC3A2 protein, an ATP transporter protein, or a fragment or a variant thereof).
[0396] In some embodiments, the exogenous sequence encodes for Scaffold Y (e.g., the MARCKS protein, MARCKSL1 protein, BASP1 protein, or a fragment or variant thereof). In some embodiments, the modified EV, e.g., exosome, overexpresses Scaffold Y (e.g., the MARCKS protein, MARCKSL1 protein, BASP1 protein, or a fragment or variant thereof). In other embodiments, the EV, e.g., exosome, is produced by a cell that overexpresses Scaffold Y (e.g., the MARCKS protein, MARCKSL1 protein, BASP1 protein, or a fragment or variant thereof).
[0397] The exogenous sequence may be transiently or stabled expressed in the producer cell or cell line via transfection, transformation, transduction, electroporation, or any other appropriate method of gene delivery or combination thereof known in the art. The exogenous sequence may be integrated into the producer cell genome, or remain extra chromosomal. The exogenous sequence can be transformed as a plasmid. The exogenous sequences can be stably integrated into a genomic sequence of the producer cell, at a targeted site or in a random site. The exogenous sequences can be inserted into a genomic sequence of the producer cell, located within, upstream (5′-end) or downstream (3′-end) of an endogenous sequence encoding the EV, e.g., exosome, protein. Various methods known in the art can be used for the introduction of the exogenous sequences into the producer cell. For example, cells modified using various gene editing methods (e.g., methods using a homologous recombination, transposon-mediated system, loxP-Cre system, CRISPR/Cas9 CRISPR/Cfp1, CRISPR/C2c1, C2c2, or C2c3, CRISPR/CasY or CasX, TAL-effector nuclease or TALEN, or zinc finger nuclease (ZFN) systems) are within the scope of various embodiments.
[0398] In some embodiments, the producer cell is further modified to comprise an additional exogenous sequence. For example, an additional exogenous sequence can be included to modulate endogenous gene expression, modulate the immune response or immune signaling, or produce an EV, e.g., exosome, including a certain polypeptide as a payload or additional surface expressed ligand. In some embodiments, the producer cell can be further modified to comprise an additional exogenous sequence conferring additional functionalities to EVs, e.g., exosomes, for example, specific targeting capabilities, delivery functions, enzymatic functions, increased or decreased half-life in vivo, etc. In some embodiments, the producer cell is modified to comprise two exogenous sequences, one encoding the exosome protein or a modification or a fragment of the exosome protein, and the other encoding a protein conferring the additional functionalities to exosomes.
[0399] More specifically, the EV, e.g., exosome, of the present can be produced from a cell transformed with a sequence encoding one or more additional exogenous proteins including, but not limited to ligands, cytokines, or antibodies, or any combination thereof. These additional exogenous proteins may enable activation or modulation of additional immune stimulatory signals in combination with the STING agonist. Exemplary additional exogenous proteins contemplated for use include the proteins, ligands, and other molecules described in detail in U.S. Patent Application 62/611,140, which is incorporated herein by reference in its entirety. In some embodiments, the EV, e.g., exosome, is further modified with a ligand comprising CD40L, OX40L, or CD27L. In some embodiments, the EV, e.g., exosome, is further modified with a cytokine comprising IL-7, IL-12, or IL-15. Any of the one or more exosome proteins described herein can be expressed from a plasmid, an exogenous sequence inserted into the genome or other exogenous nucleic acid such as a synthetic messenger RNA (mRNA).
[0400] In some embodiments, the EV, e.g., exosome, is further modified to display an antagonistic antibody or an agonistic antibody or a fragment thereof on the EV, e.g., exosome, surface to direct EV uptake, activate, or block cellular pathways to enhance the combinatorial effect of the STING agonist. In some specific embodiments, the antibody or fragment thereof is an antibody against DEC205, CLEC9A, CLEC6, DCIR, DC-SIGN, LOX-1, or Langerin. The producer cell may be modified to comprise an additional exogenous sequence encoding for an antagonistic antibody or an agonistic antibody. Alternatively, the antagonistic antibody or agonistic antibody may be covalently linked or conjugated to the EV, e.g., exosome, via any appropriate linking chemistry known in the art. Non-limiting examples of appropriate linking chemistry include amine-reactive groups, carboxyl-reactive groups, sulfhydryl-reactive groups, aldehyde-reactive groups, photoreactive groups, ClickIT chemistry, biotin-streptavidin or other avidin conjugation, or any combination thereof.
[0401] II.D.1. Glycan Modification of Producer Cells or EVs, e.g., Exosomes
[0402] In some embodiments the EV, e.g., exosome, is glycan modified via enzymatic or chemical treatment. In one embodiment, the EV, e.g., exosome, is derived from a glycan modified producer cell. In another embodiment, the glycan modification of the producer cell comprises an enzymatic or a chemical modification. In various embodiments, the glycan modification of the producer cell is treatment with kifunensine or knockout of a sialyltransferase or cytidylyltransferase gene. In one embodiment, the glycan modification of the producer cell comprises knockout of the cytidylyltransferase gene Cytidine Monophosphate N-Acetylneuraminic Acid Synthetase (CMAS). In one embodiment, the glycan modification of the producer cell comprises knockout of the mannose biosynthesis gene Mannosidase Alpha Class 1A Member 1 (MAN1A1). In one embodiment, the glycan modification of the producer cell comprises knockout of the mannose biosynthesis gene Mannosidase Alpha Class 2A Member 1 (MAN2A1).
[0403] Glycan modification may be deglycosylation or desialylation of the producer cell or of the isolated or purified EVs, e.g., exosomes. The EVs, e.g., exosomes, may be glycan modified before encapsulation of the STING agonist or after encapsulation of the STING agonist. The producer cell or EV, e.g., exosome, may be glycan modified (e.g. deglycosylated or desialylated) about or more than 99%, 95%, 90%, 85%, 80%, 75%, 70%, 65%, 60%, 55%, 50%, 45%, 40%, 35%, 30%, 25%, 20%, 15%, 10%, or 5% relative to an unmodified producer cell or EV, e.g., exosome. The producer cell or EV, e.g., exosome, may be glycan modified between 95-100%, 90-95%, 85-95%, 80-85%, 75-80%, 70-75%, 65-70%, 60-65%, 55-60%, 50-55%, 45-50%, 40-45%, 35-40%, 30-35%, 25-30%, 20-25%, 15-20%, 10-15%, or 5-10% relative to an unmodified producer cell or EV, e.g., exosome.
[0404] The producer cell or EV, e.g., exosome, may be glycan modified via chemical, enzymatic, or genetic editing techniques. Glycan modification may include treating producer cells with chemicals, small molecules, or enzymes that alter or inhibit glycosyltransferases, galactosyltransferases, sialyltransferase, or cytidylyltransferase enzymes in the producer cell, resulting in EVs, e.g., exosomes, derived from the producer cell that are glycan modified. Glycan modification may also include treating EVs, e.g., exosomes, with chemicals or enzymes that alter the glycans on the EV surface, such as small molecule inhibitors or glycoside hydrolases such as sialidase or neuraminidase enzymes, as well as any other appropriate chemical or enzyme glycan modification treatments.
[0405] In some embodiments, the producer cell or EVs, e.g., exosomes, is glycan modified via treatment with kifunensine. Kifunensine is a mannosidase I inhibitor that inhibits mannosidase I from removing mannose residues from precursor glycoproteins. Treatment of cells with kifunensine results in glycoproteins with terminal mannose residues. Another mannosidase I inhibitor that may be used is 1-deoxymannojirimycin. Other small molecules that inhibit alpha-mannosidase I or II or beta-mannosidase enzymes may also be used, such as swainsonine.
[0406] Some embodiments may also include treatment of producer cells or EVs, e.g., exosomes, with glycoside hydrolases such as sialidases, neuraminidases, or mannosidases. Any glycoside hydrolase known in the art may be used, including but not limited to, exo-α-sialidases, endo-α-sialidases, N-acetylneuraminidase, sialidase 1, sialidase 2, sialidase, 3, or sialidase 4, any other appropriate sialidase, α-mannosidases, β-mannosidases, or any combination thereof.
[0407] In addition, glycan modification may include genetically altering the producer cell via an appropriate genome editing technique to have altered glycan enzyme expression, such as knockout or knock down of glycosyltransferases, galactosyltransferases, sialyltransferase or cytidylyltransferase enzymes in the producer cell. Any genome editing technique known in the art may be used, including, but not limited to, CRISPR/Cas9, CRISPR/Cfp1, CRISPR/C2c1, C2c2, or C2c3, CRISPR/CasY or CasX, TAL-effector nuclease or TALEN, or zinc finger nuclease (ZFN) systems, or any combination thereof.
[0408] Exemplary genes that may be altered include Cytidine Monophosphate N-Acetylneuraminic Acid Synthetase (CMAS), and the mannose biosynthesis genes Mannosidase Alpha Class 1A Member 1 (MANIA1) and Mannosidase Alpha Class 2A Member 1 (MAN2A1).
[0409] The glycan modified EVs, e.g., exosomes, may also be derived from a PTGFRN overexpressing producer cell line that has also ben glycan modified. In such an example, the producer cell line may be transformed, transfected, transduced, or otherwise genetically modified to express the PTGFRN gene and gene product and to have altered glycan transferase enzyme expression. In one embodiment, the producer cell is altered to overexpress the PTGFRN gene and gene product and knockdown or knock out of the cytidylyltransferase gene CMAS. Alternatively, the producer cell line may be genetically modified to express the PTGFRN gene and gene product and treated with kifunensine or other mannosidase, glycosyltransferase, galactosyltransferase, sialyltransferase or cytidylyltransferase inhibitors known in the art, or any combination thereof, thereby resulting in a producer cell that both overexpresses the PTGFRN gene and gene product, and has altered glycan expression.
III. Method of Producing EVs with STING Agonists
[0410] III.A. Methods for Encapsulating STING Agonists in EVs
[0411] STING agonists can be encapsulated in EVs, e.g., exosomes, via any appropriate technique known in the art. It is contemplated that all known manners of loading biomolecules into EVs, e.g., exosomes, are deemed suitable for use herein. Such techniques include passive diffusion, electroporation, chemical or polymeric transfection, viral transduction, mechanical membrane disruption or mechanical shear, or any combination thereof. The STING agonist and an EV, e.g., exosome, may be incubated in an appropriate buffer during encapsulation.
[0412] In one embodiment, a STING agonist is encapsulated by an EV, e.g., exosome, by passive diffusion. The STING agonist and the EV, e.g., exosome, may be mixed together and incubated for a time period sufficient for the STING agonist to diffuse through the vesicle lipid bilayer, thereby becoming encapsulated in the EV, e.g., exosome. The STING agonist and the EV, e.g., exosome, may be incubated together for between about 1 to 30 hours, 2 to 24 hours, 4 to 18 hours, 6 to 16 hours, 8 to 14 hours, 10 to 12 hours, 6 to 12 hours, 12 to 20 hours, 14 to 18 hours, or 20 to 30 hours. The STING agonist and the EV, e.g., exosome, may be incubated together for about 2 hours, 4 hours, 6, hours, 8, hours, 10, hours, 12 hours, 14 hours, 16 hours, 18 hours, 20 hours, 22 hours, 24 hours, 26 hours, or 30 hours.
[0413] The buffer conditions of the solution of EVs, e.g., exosomes, may also be altered to optimize encapsulation of the STING agonist. In one embodiment, the buffer may be a phosphate buffered saline (PBS) with sucrose. PBS is a well-known buffer to those skilled in the art. Additional buffer modifications may also be used, such as shear protectants, viscosity modifiers, and/or solutes that affect vesicle structural properties. Excipients may also be added to improve the efficiency of the STING agonist encapsulation such as membrane softening materials and molecular crowding agents. Other modifications to the buffer may include specific pH ranges and/or concentrations of salts, organic solvents, small molecules, detergents, zwitterions, amino acids, polymers, and/or any combination of the above including multiple concentrations.
[0414] The temperature of the solution of EVs, e.g., exosomes, and STING agonists during incubation may be changed to optimize encapsulation of the STING agonist. The temperature may be room temperature. The temperature may be between about 15° C. to 90° C., 15-30° C., 30-50° C., 50-90° C. The temperature may be about 15° C., 20° C., 35° C., 30° C., 35° C., 37° C., 40° C., 45° C., 50° C., 55° C., 60° C., 65° C., 70° C., 75° C., 80° C., 85° C., or 90° C.
[0415] The concentration of STING agonist during the incubation of the agonist with the EVs, e.g., exosomes, may also be altered to optimize encapsulation of the STING agonist. The concentration of agonist may be between at least 0.01 mM and 100 mM STING agonist. The concentration of the agonist may be at least 0.01-1 mM, 1-10 mM, 10-50 mM, or 50-100 mM. The concentration of the agonist may be at least 0.01 mM, 0.02 mM, 0.03 mM, 0.04 mM, 0.05 mM, 0.06 mM, 0.07 mM, 0.08 mM, 0.09 mM, 0.1 mM, 0.2 mM, 0.3 mM, 0.4 mM, 0.5 mM, 0.6 mM, 0.7 mM, 0.8 mM, 0.9 mM, 1 mM, 2 mM, 3 mM, 4 mM, 5 mM, 6 mM, 7 mM, 8 mM, 9 mM, 10 mM, 15 mM, 20 mM 30 mM, 35 mM, 40 mM, 45 mM, 50 mM, 55 mM, 60 mM, 65 mM, 70 mM, 75 mM, 80 mM, 85 mM, 90 mM, 95 mM, or 100 mM.
[0416] The number of extracellular particles incubated with the STING agonist may also be altered to optimize encapsulation of the STING agonist. The number of purified EV, e.g., exosome, particles may be between at least about 10.sup.6 to at least about 10.sup.20 total particles of purified vesicles. The number of purified particles may be between about 10.sup.8 to 10.sup.18, 10.sup.10 to 10.sup.16, 10.sup.8 to 10.sup.14, or 10.sup.10 to 10.sup.12 total particles of purified vesicles. The number of purified particles may be at least about 10.sup.6, 10.sup.8, 10.sup.10, 10.sup.2, 10.sup.14, 10.sup.16, 10.sup.18, or 10.sup.20 total particles of purified vesicles.
[0417] In some embodiments, the one or more moieties can be introduced into suitable producer cells using synthetic macromolecules, such as cationic lipids and polymers (Papapetrou et al., Gene Therapy 12: S118-S130 (2005)). In some embodiments, the cationic lipids form complexes with the one or more moieties through charge interactions. In some of these embodiments, the positively charged complexes bind to the negatively charged cell surface and are taken up by the cell by endocytosis. In some other embodiments, a cationic polymer can be used to transfect producer cells. In some of these embodiments, the cationic polymer is polyethylenimine (PEI). In certain embodiments, chemicals such as calcium phosphate, cyclodextrin, or polybrene, can be used to introduce the one or more moieties to the producer cells. The one or more moieties can also be introduced into a producer cell using a physical method such as particle-mediated transfection, “gene gun”, biolistics, or particle bombardment technology (Papapetrou et al., Gene Therapy 12: S118-S130 (2005)). A reporter gene such as, for example, beta-galactosidase, chloramphenicol acetyltransferase, luciferase, or green fluorescent protein can be used to assess the transfection efficiency of the producer cell.
[0418] In some embodiments, the one or more moieties are introduced to the producer cell by viral transduction. A number of viruses can be used as gene transfer vehicles, including moloney murine leukemia virus (MMLV), adenovirus, adeno-associated virus (AAV), herpes simplex virus (HSV), lentiviruses, and spumaviruses. The viral mediated gene transfer vehicles comprise vectors based on DNA viruses, such as adenovirus, adeno-associated virus and herpes virus, as well as retroviral based vectors.
[0419] In some embodiments, the one or more moieties are introduced to the producer cell by electroporation. Electroporation creates transient pores in the cell membrane, allowing for the introduction of various molecules into the cell. In some embodiments, DNA and RNA as well as polypeptides and non-polypeptide therapeutic agents can be introduced into the producer cell by electroporation.
[0420] In some embodiments, the one or more moieties are introduced to the producer cell by microinjection. In some embodiments, a glass micropipette can be used to inject the one or more moieties into the producer cell at the microscopic level.
[0421] In some embodiments, the one or more moieties are introduced to the producer cell by extrusion.
[0422] In some embodiments, the one or more moieties are introduced to the producer cell by sonication. In some embodiments, the producer cell is exposed to high intensity sound waves, causing transient disruption of the cell membrane allowing loading of the one or more moieties.
[0423] In some embodiments, the one or more moieties are introduced to the producer cell by cell fusion. In some embodiments, the one or more moieties are introduced by electrical cell fusion. In other embodiments, polyethylene glycol (PEG) is used to fuse the producer cells. In further embodiments, sendai virus is used to fuse the producer cells.
[0424] In some embodiments, the one or more moieties are introduced to the producer cell by hypotonic lysis. In such embodiments, the producer cell can be exposed to low ionic strength buffer causing them to burst allowing loading of the one or more moieties. In other embodiments, controlled dialysis against a hypotonic solution can be used to swell the producer cell and to create pores in the producer cell membrane. The producer cell is subsequently exposed to conditions that allow resealing of the membrane.
[0425] In some embodiments, the one or more moieties are introduced to the producer cell by detergent treatment. In certain embodiments, producer cell is treated with a mild detergent which transiently compromises the producer cell membrane by creating pores allowing loading of the one or more moieties. After producer cells are loaded, the detergent is washed away thereby resealing the membrane.
[0426] In some embodiments, the one or more moieties introduced to the producer cell by receptor mediated endocytosis. In certain embodiments, producer cells have a surface receptor which upon binding of the one or more moieties induces internalization of the receptor and the associated moieties.
[0427] In some embodiments, the one or more moieties are introduced to the producer cell by filtration. In certain embodiments, the producer cells and the one or more moieties can be forced through a filter of pore size smaller than the producer cell causing transient disruption of the producer cell membrane and allowing the one or more moieties to enter the producer cell.
[0428] In some embodiments, the producer cell is subjected to several freeze thaw cycles, resulting in cell membrane disruption allowing loading of the one or more moieties.
IV. EV Purification
[0429] The EVs, e.g., exosomes, prepared for the present disclosure can be isolated from the producer cells. It is contemplated that all known manners of isolation of EVs, e.g., exosomes, are deemed suitable for use herein. For example, physical properties of EVs, e.g., exosomes, may be employed to separate them from a medium or other source material, including separation on the basis of electrical charge (e.g., electrophoretic separation), size (e.g., filtration, molecular sieving, etc), density (e.g., regular or gradient centrifugation), Svedberg constant (e.g., sedimentation with or without external force, etc). Alternatively, or additionally, isolation may be based on one or more biological properties, and include methods that may employ surface markers (e.g., for precipitation, reversible binding to solid phase, FACS separation, specific ligand binding, non-specific ligand binding, etc.). In yet further contemplated methods, the EVs, e.g., exosomes, may also be fused using chemical and/or physical methods, including PEG-induced fusion and/or ultrasonic fusion.
[0430] The EVs, e.g., exosomes, may also be purified after incubation with the STING agonist to remove free, unencapsulated STING agonist from the composition. All manners of previously disclosed methods are also deemed suitable for use herein, including separation on the basis of physical or biological properties of EVs, e.g., exosomes.
[0431] Isolation, purification, and enrichment can be done in a general and non-selective manner (typically including serial centrifugation). Alternatively, isolation, purification, and enrichment can be done in a more specific and selective manner (e.g., using producer cell-specific surface markers). For example, specific surface markers may be used in immunoprecipitation, FACS sorting, affinity purification, bead-bound ligands for magnetic separation etc.
[0432] In some embodiments, size exclusion chromatography can be utilized to isolate or purify the EVs, e.g., exosomes. Size exclusion chromatography techniques are known in the art. Exemplary, non-limiting techniques are provided herein. In some embodiments, a void volume fraction is isolated and comprises the EVs, e.g., exosomes, of interest. In some embodiments, for example, density gradient centrifugation can be utilized to further isolate the EVs, e.g., exosomes. Still further, in some embodiments, it can be desirable to further separate the producer cell-derived EVs, e.g., exosomes, from EVs of other origin. For example, the producer cell-derived EVs, e.g., exosomes, can be separated from non-producer cell-derived EVs, e.g., exosomes, by immunosorbent capture using an antigen antibody specific for the producer cell.
[0433] In some embodiments, the isolation of EVs, e.g., exosomes, may involve size exclusion chromatography or ion chromatography, such as anion exchange, cation exchange, or mixed mode chromatography. In some embodiments, the isolation of EVs, e.g., exosomes, may involve desalting, dialysis, tangential flow filtration, ultrafiltration, or diafiltration, or any combination thereof. In some embodiments, the isolation of EVs, e.g., exosomes, may involve combinations of methods that include, but are not limited to, differential centrifugation, size-based membrane filtration, concentration and/or rate zonal centrifugation. In some embodiments, the isolation of EVs, e.g., exosomes, may involve one or more centrifugation steps. The centrifugation may be performed at about 50,000 to 150,000×g. The centrifugation may be performed at about 50,000×g, 75,000×g, 100,000×g, 125,000×g, or 150,000×g.
V. Therapeutic Administration
[0434] V.A. Immune Modulation and Dosage
[0435] Provided herein are methods for inducing and/or modulating an immune or inflammatory response in a subject by administering a pharmaceutically effective amount of an EV, e.g., exosome, comprising a STING agonist.
[0436] Dendritic cells (DCs) are a population of antigen present cells derived from a hematopoietic cell lineage that link the innate and adaptive immune systems. DCs share a common myeloid precursor with monocytes and macrophages and are generally separated into two major groups: plasmacytoid DCs (pDCs) and myeloid DCs (mDCs), which are also known as conventional DCs (cDCs). mDCs are further classified based on their development from myeloid or lymphoid precursors and expression levels of CD8a, CD4, and C11b. A third population of DCs are monocyte-derived DCs (moDCs) which arise from a monocyte precursor, not a DC progenitor like pDCs and cDCs. moDCs develop after receiving inflammatory cues. Immature DCs reside in peripheral tissue before maturation. Several signaling pathways lead to DC maturation, including the signaling cascades induced by pattern recognition receptors (PRRs). Each subset of immature DCs varies in the protein expression patterns of PRRs which allows the immature DC populations to respond differently upon activation of the same PRR. This results in modulation of the immune response mediated by DCs. PRRs present in DCs include Toll-like receptors (TLRs), C-type lectin receptors, retinoic-acid inducible gene (RIG)-I-like receptors (RLRs), NOD-like receptors (NLRs), and STING.
[0437] The STING pathway is the dominant DNA sensing pathway in both mDCs and pDCs. Activation of the STING pathway in DCs results in Type I IFN and pro inflammatory cytokine production via TBK1, IRF3, and NF-κB signaling. Binding of IFN to their receptors on cells results in activation of IFN-stimulated response elements and the transcription of IFN-sensitive genes that result in the immune and inflammatory response. IFN signaling also cross-primes DCs to promote antigen persistence, alters the antigen repertoire available for MHCI presentation, enhances MHCI presentation of antigens, and increases the overall surface expression of MHCI, MHCII, and co-stimulatory molecules CD40, CD80, and CD86. These actions result in increased priming of tumor specific CD8+ T cells and initiation of the adaptive immune response.
[0438] In some embodiments, the method of administering an EV, e.g., exosome, encapsulating a STING agonist and/or expressing a STING agonist on the surface to a subject in need thereof activates or induces dendritic cells, thereby inducing or modulating an immune or inflammatory response in the subject. In some embodiments, the dendritic cells activated are myeloid dendritic cells. In some embodiments, the dendritic cells are plasmacytoid dendritic cells.
[0439] In some embodiments, the method induces interferon (IFN)-β production. Administration of EVs, e.g., exosomes, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) may result in between 2-fold and 10,000-fold greater IFN-β induction compared to administration of a STING agonist alone. Administration of EVs, e.g., exosomes, comprising a STING agonist (e.g., encapsulated or expressed on the surface) may result in between about 2-5 fold, 5-10 fold, 10-20 fold, 20-30 fold, 30-40 fold, 40-50 fold, 50-60 fold, 60-70 fold, 70-80 fold, 80-90 fold, 90-100 fold, 100-200 fold, 200-300 fold, 300-400 fold, 400-500 fold, 500-600 fold, 600-700 fold, 700-800 fold, 800-900 fold, 900-1000 fold, 1000-2000 fold, 2000-3000 fold, 3000-4000 fold, 4000-5000 fold, 5000-6000 fold, 6000-7000 fold, 7000-8000 fold, 8000-9000 fold, or 9000-10,000 fold greater IFN-β induction compared to administration of a STING agonist alone. Administration of EVs, e.g., exosomes, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) may result in greater than about 2-fold, >5 fold, >10-fold, >20-fold, >30-fold, >40-fold, >50-fold, >60-fold, >70-fold, >80-fold, >90-fold, >100-fold, >200-fold, >300-fold, >400-fold, >500-fold, >600-fold, >700-fold, >800-fold, >900-fold, >1000-fold, >2000-fold, >3000-fold, >4000-fold, >5000-fold, >6000-fold, >7000-fold, >8000-fold, >9000-fold, or >10,000-fold IFN-β induction compared to administration of a STING agonist alone. Administration of EVs, e.g., exosomes, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) may result in between 2-fold and 10,000-fold greater IFN-β induction compared to the subject's baseline IFN-β production. Administration of EVs, e.g., exosomes, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) may result in between about 2-5 fold, 5-10 fold, 10-20 fold, 20-30 fold, 30-40 fold, 40-50 fold, 50-60 fold, 60-70 fold, 70-80 fold, 80-90 fold, 90-100 fold, 100-200 fold, 200-300 fold, 300-400 fold, 400-500 fold, 500-600 fold, 600-700 fold, 700-800 fold, 800-900 fold, 900-1000 fold, 1000-2000 fold, 2000-3000 fold, 3000-4000 fold, 4000-5000 fold, 5000-6000 fold, 6000-7000 fold, 7000-8000 fold, 8000-9000 fold, or 9000-10,000 fold greater IFN-β induction compared to the subject's baseline IFN-β production. Administration of EVs, e.g., exosomes, comprising a STING agonist may result in greater than about 2-fold, >5 fold, >10-fold, >20-fold, >30-fold, >40-fold, >50-fold, >60-fold, >70-fold, >80-fold, >90-fold, >100-fold, >200-fold, >300-fold, >400-fold, >500-fold, >600-fold, >700-fold, >800-fold, >900-fold, >1000-fold, >2000-fold, >3000-fold, >4000-fold, >5000-fold, >6000-fold, >7000-fold, >8000-fold, >9000-fold, or >10,000-fold IFN-β induction compared to the subject's baseline IFN-β production.
[0440] In some embodiments, administering an EV, e.g., exosome, disclosed herein to a subject can also regulate the levels of other immune modulators (e.g., cytokines or chemokines). In certain embodiments, the method disclosed herein can increase the level of IFN-γ, CXCL9, and/or CXCL10. In some embodiments, administration of EVs, e.g., exosomes, described herein (can result in between about 2-5 fold, 5-10 fold, 10-20 fold, 20-30 fold, 30-40 fold, 40-50 fold, 50-60 fold, 60-70 fold, 70-80 fold, 80-90 fold, 90-100 fold, 100-200 fold, 200-300 fold, 300-400 fold, 400-500 fold, 500-600 fold, 600-700 fold, 700-800 fold, 800-900 fold, 900-1000 fold, 1000-2000 fold, 2000-3000 fold, 3000-4000 fold, 4000-5000 fold, 5000-6000 fold, 6000-7000 fold, 7000-8000 fold, 8000-9000 fold, or 9000-10,000 fold greater amount of IFN-γ, CXCL9, and/or CXCL10 compared to a free STING agonist.
[0441] In some embodiments, the method induces myeloid dendritic cell (mDC) activation. Administration of EVs, e.g., exosomes, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) may result in between 2-fold and 50,000-fold greater mDC activation compared to administration of a STING agonist alone. Administration of EVs, e.g., exosomes, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) may result in between about 2-5 fold, 5-10 fold, 10-20 fold, 20-30 fold, 30-40 fold, 40-50 fold, 50-60 fold, 60-70 fold, 70-80 fold, 80-90 fold, 90-100 fold, 100-200 fold, 200-300 fold, 300-400 fold, 400-500 fold, 500-600 fold, 600-700 fold, 700-800 fold, 800-900 fold, 900-1000 fold, 1000-2000 fold, 2000-3000 fold, 3000-4000 fold, 4000-5000 fold, 5000-6000 fold, 6000-7000 fold, 7000-8000 fold, 8000-9000 fold, 9000-10,000 fold, 10,000-15,000 fold, 15,000-20,000 fold, 20,000-25,000 fold, 25,000-30,000 fold, 30,000-35,000 fold, 35,000-40,000 fold, 40,000-45,000 fold, or 45,000-50,000 fold greater mDC activation compared to administration of a STING agonist alone. Administration of EVs, e.g., exosomes, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) may result in greater than about 2-fold, >5 fold, >10-fold, >20-fold, >30-fold, >40-fold, >50-fold, >60-fold, >70-fold, >80-fold, >90-fold, >100-fold, >200-fold, >300-fold, >400-fold, >500-fold, >600-fold, >700-fold, >800-fold, >900-fold, >1000-fold, >2000-fold, >3000-fold, >4000-fold, >5000-fold, >6000-fold, >7000-fold, >8000-fold, >9000-fold, >10,000-fold, >15,000-fold, >20,000-fold, >25,000-fold, >30,000-fold, >35,000-fold, >40,000-fold, >45,000-fold, or >50,000-fold mDC activation compared to administration of a STING agonist alone.
[0442] Administration of EVs, e.g., exosomes, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) may result in between 2-fold and 10,000-fold greater mDC activation compared to the subject's baseline mDC activation. Administration of EVs, e.g., exosomes, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) may result in between about 2-5 fold, 5-10 fold, 10-20 fold, 20-30 fold, 30-40 fold, 40-50 fold, 50-60 fold, 60-70 fold, 70-80 fold, 80-90 fold, 90-100 fold, 100-200 fold, 200-300 fold, 300-400 fold, 400-500 fold, 500-600 fold, 600-700 fold, 700-800 fold, 800-900 fold, 900-1000 fold, 1000-2000 fold, 2000-3000 fold, 3000-4000 fold, 4000-5000 fold, 5000-6000 fold, 6000-7000 fold, 7000-8000 fold, 8000-9000 fold, 9000-10,000 fold, 10,000-15,000 fold, 15,000-20,000 fold, 20,000-25,000 fold, 25,000-30,000 fold, 30,000-35,000 fold, 35,000-40,000 fold, 40,000-45,000 fold, or 45,000-50,000 fold greater mDC activation compared to the subject's baseline mDC activation. Administration of EVs, e.g., exosomes, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) may result in greater than about 2-fold, >5 fold, >10-fold, >20-fold, >30-fold, >40-fold, >50-fold, >60-fold, >70-fold, >80-fold, >90-fold, >100-fold, >200-fold, >300-fold, >400-fold, >500-fold, >600-fold, >700-fold, >800-fold, >900-fold, >1000-fold, >2000-fold, >3000-fold, >4000-fold, >5000-fold, >6000-fold, >7000-fold, >8000-fold, >9000-fold, >10,000-fold, >15,000-fold, >20,000-fold, >25,000-fold, >30,000-fold, >35,000-fold, >40,000-fold, >45,000-fold, or >50,000-fold mDC activation compared to the subject's baseline mDC activation.
[0443] In some embodiments, the method of administering an EV, e.g., exosome, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) does not induce monocyte activation as compared to the subject's baseline monocyte activation. In some embodiments, the administration of an EV, e.g., exosome, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) results in less than less than about 2-fold, <5 fold, <10-fold, <20-fold, <30-fold, <40-fold, <50-fold, <60-fold, <70-fold, <80-fold, <90-fold, <100-fold, <200-fold, <300-fold, <400-fold, <500-fold, <600-fold, <700-fold, <800-fold, <900-fold, <1000-fold, <2000-fold, <3000-fold, <4000-fold, <5000-fold, <6000-fold, <7000-fold, <8000-fold, <9000-fold, <10,000-fold, <15,000-fold, <20,000-fold, <25,000-fold, <30,000-fold, <35,000-fold, <40,000-fold, <45,000-fold, <50,000-fold, <55,000-fold, <60,000-fold, <65,000-fold, <70,000-fold, <75,000-fold, <80,000-fold, <85,000-fold, <90,000-fold, <95,000-fold, <100,000-fold, <200,000-fold, <300,000-fold, <400,000-fold, <500,000-fold, <600,000-fold, <700,000-fold, <800,000-fold, <900,000-fold, or <1,000,000-fold induction of monocyte activation relative to the subject's baseline monocyte activation. In some embodiments, the administration of an EV, e.g., exosome, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) to a subject results in less than about 2-5 fold, 5-10 fold, 10-20 fold, 20-30 fold, 30-40 fold, 40-50 fold, 50-60 fold, 60-70 fold, 70-80 fold, 80-90 fold, 90-100 fold, 100-200 fold, 200-300 fold, 300-400 fold, 400-500 fold, 500-600 fold, 600-700 fold, 700-800 fold, 800-900 fold, 900-1000 fold, 1000-2000 fold, 2000-3000 fold, 3000-4000 fold, 4000-5000 fold, 5000-6000 fold, 6000-7000 fold, 7000-8000 fold, 8000-9000 fold, 9000-10,000 fold, 10,000-15,000 fold, 15,000-20,000 fold, 20,000-25,000 fold, 25,000-30,000 fold, 30,000-35,000 fold, 35,000-40,000 fold, 40,000-45,000 fold, 45,000-50,000 fold, 55,000-60,000 fold, 60,000-65,000 fold, 65,000-70,000 fold, 70,000-75,000 fold, 75,000-80,000 fold, 80,000-85,000 fold, 85,000-90,000 fold, 90,000-95,000 fold, 95,000-100,000 fold, 100,000-200,000 fold, 200,000-300,000 fold, 300,000-400,000 fold, 400,000-500,000 fold, 500,000-600,000 fold, 600,000-700,000 fold, 700,000-800,000 fold, 800,000-900,000 fold, or 900,000-1,000,000 fold induction of monocyte activation relative to the subject's baseline monocyte activation.
[0444] In some embodiments, the method of administering an EV, e.g., exosome, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) to a subject does not induce monocyte activation as compared to administration of the STING agonist alone. In some embodiments, the administration of an EV, e.g., exosome, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) results in less than less than about 2-fold, <5 fold, <10-fold, <20-fold, <30-fold, <40-fold, <50-fold, <60-fold, <70-fold, <80-fold, <90-fold, <100-fold, <200-fold, <300-fold, <400-fold, <500-fold, <600-fold, <700-fold, <800-fold, <900-fold, <1000-fold, <2000-fold, <3000-fold, <4000-fold, <5000-fold, <6000-fold, <7000-fold, <8000-fold, <9000-fold, <10,000-fold, <15,000-fold, <20,000-fold, <25,000-fold, <30,000-fold, <35,000-fold, <40,000-fold, <45,000-fold, or <50,000-fold induction of monocyte activation relative to the amount of monocyte activation after administration of the free STING agonist. In some embodiments, the administration of an EV, e.g., exosome, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) to a subject results in less than about 2-5 fold, 5-10 fold, 10-20 fold, 20-30 fold, 30-40 fold, 40-50 fold, 50-60 fold, 60-70 fold, 70-80 fold, 80-90 fold, 90-100 fold, 100-200 fold, 200-300 fold, 300-400 fold, 400-500 fold, 500-600 fold, 600-700 fold, 700-800 fold, 800-900 fold, 900-1000 fold, 1000-2000 fold, 2000-3000 fold, 3000-4000 fold, 4000-5000 fold, 5000-6000 fold, 6000-7000 fold, 7000-8000 fold, 8000-9000 fold, 9000-10,000 fold, 10,000-15,000 fold, 15,000-20,000 fold, 20,000-25,000 fold, 25,000-30,000 fold, 30,000-35,000 fold, 35,000-40,000 fold, 40,000-45,000 fold, or 45,000-50,000 fold induction of monocyte activation relative to the amount of monocyte activation after administration of the free STING agonist. Monocyte activation may be measured by the surface expression of CD86 on the monocyte, or by any other appropriate monocyte activation marker known in the art.
[0445] Because of the improved therapeutic effects associated with EVs, e.g., exosomes, described herein, in some embodiments, lower dosages of the EV, e.g., exosome, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) can be delivered compared to the free STING agonist. Moreover, non-selective delivery of high doses of STING agonists can attenuate desirable immune stimulatory responses. Accordingly, because the EVs, e.g., exosomes, described herein can be administered at lower doses, in some embodiments, they can operate in a wider therapeutic window and reduce the liabilities (e.g., systemic toxicity, immune cell killing, lack of cell selectivity) observed with free STING agonists.
[0446] The compositions described herein may be administered in a dosage sufficient to ameliorate the disease, disorder, condition, or symptom of the subject in need thereof. In some embodiments, the dosage of the EV, e.g., exosome, comprising a STING agonist administered to a subject in need is between about 0.01 to 0.1 μM, 0.1 to 1 μM, 1 to 10 μM, 10 to 100 μM, or 100 to 1000 μM. In certain embodiments, the dosage of the EV, e.g., exosome, comprising a STING agonist administered to a subject in need is about 0.01 μM, 0.05 μM, 0.1 μM, 0.2 μM, 0.3 μM, 0.4 μM, 0.5 μM, 0.6 μM, 0.7 μM, 0.8 μM, 0.9 μM, 1 μM, 2 μM, 3 μM, 4 μM, 5 μM, 6 μM, 7 μM, 8 μM, 9 μM, 10 μM, 11 μM, 12 μM, 13 μM, 14 μM, 15 μM, 16 μM, 17 μM, 18 μM, 19 μM, 20 μM, 25 μM, 30 μM, 35 μM, 40 μM, 45 μM, 40 μM, 55 μM, 60 μM, 65 μM, 70 μM, 75 μM, 80 μM, 85 μM, 90 μM, 95 μM, 100 μM, 150 μM, 200 μM, 250 μM, 300 μM, 350 μM, 400 μM, 450 μM, 500 μM, 550 μM, 600 μM, 650 μM, 700 μM, 750 μM, 800 μM, 850 μM, 900 μM, 950 μM, or 1000 μM.
[0447] In some embodiments, the amount of the EV, e.g., exosome, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) administered to a subject in need is less than 2-fold, <5 fold, <10-fold, <20-fold, <30-fold, <40-fold, <50-fold, <60-fold, <70-fold, <80-fold, <90-fold, <100-fold, <200-fold, <300-fold, <400-fold, <500-fold, <600-fold, <700-fold, <800-fold, <900-fold, <1000-fold, <2000-fold, <3000-fold, <4000-fold, <5000-fold, <6000-fold, <7000-fold, <8000-fold, <9000-fold, <10,000-fold, <15,000-fold, <20,000-fold, <25,000-fold, <30,000-fold, <35,000-fold, <40,000-fold, <45,000-fold, or <50,000-fold relative to the amount of a free STING agonist required to effect the same ameliorative results in a subject in need. In some embodiments, the amount of the EV, e.g., exosome, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) administered to a subject in need is between less than about 2-5 fold, 5-10 fold, 10-20 fold, 20-30 fold, 30-40 fold, 40-50 fold, 50-60 fold, 60-70 fold, 70-80 fold, 80-90 fold, 90-100 fold, 100-200 fold, 200-300 fold, 300-400 fold, 400-500 fold, 500-600 fold, 600-700 fold, 700-800 fold, 800-900 fold, 900-1000 fold, 1000-2000 fold, 2000-3000 fold, 3000-4000 fold, 4000-5000 fold, 5000-6000 fold, 6000-7000 fold, 7000-8000 fold, 8000-9000 fold, 9000-10,000 fold, 10,000-15,000 fold, 15,000-20,000 fold, 20,000-25,000 fold, 25,000-30,000 fold, 30,000-35,000 fold, 35,000-40,000 fold, 40,000-45,000 fold, or 45,000-50,000 fold less relative to the amount of a free STING agonist required to effect the same ameliorative results in a subject in need.
[0448] In some embodiments, the method of administering an EV, e.g., exosome, comprising a STING agonist does not induce systemic inflammation as compared to the subject's baseline systemic inflammation. In some embodiments, the administration of an EV, e.g., exosome, comprising a STING agonist results in less than less than about 2-fold, <5 fold, <10-fold, <20-fold, <30-fold, <40-fold, <50-fold, <60-fold, <70-fold, <80-fold, <90-fold, <100-fold, <200-fold, <300-fold, <400-fold, <500-fold, <600-fold, <700-fold, <800-fold, <900-fold, <1000-fold, <2000-fold, <3000-fold, <4000-fold, <5000-fold, <6000-fold, <7000-fold, <8000-fold, <9000-fold, <10,000-fold, <15,000-fold, <20,000-fold, <25,000-fold, <30,000-fold, <35,000-fold, <40,000-fold, <45,000-fold, or <50,000-fold induction of systemic inflammation relative to the subject's baseline systemic inflammation. In some embodiments, the administration of an EV, e.g., exosome, comprising a STING agonist to a subject results in less than about 2-5 fold, 5-10 fold, 10-20 fold, 20-30 fold, 30-40 fold, 40-50 fold, 50-60 fold, 60-70 fold, 70-80 fold, 80-90 fold, 90-100 fold, 100-200 fold, 200-300 fold, 300-400 fold, 400-500 fold, 500-600 fold, 600-700 fold, 700-800 fold, 800-900 fold, 900-1000 fold, 1000-2000 fold, 2000-3000 fold, 3000-4000 fold, 4000-5000 fold, 5000-6000 fold, 6000-7000 fold, 7000-8000 fold, 8000-9000 fold, 9000-10,000 fold, 10,000-15,000 fold, 15,000-20,000 fold, 20,000-25,000 fold, 25,000-30,000 fold, 30,000-35,000 fold, 35,000-40,000 fold, 40,000-45,000 fold, or 45,000-50,000 fold induction of systemic inflammation relative to the subject's baseline systemic inflammation.
[0449] In some embodiments, the method of administering an EV, e.g., exosome, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) to a subject does not induce systemic inflammation as compared to administration of the STING agonist alone. In some embodiments, the administration of an EV, e.g., exosome, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) results in less than less than about 2-fold, <5 fold, <10-fold, <20-fold, <30-fold, <40-fold, <50-fold, <60-fold, <70-fold, <80-fold, <90-fold, <100-fold, <200-fold, <300-fold, <400-fold, <500-fold, <600-fold, <700-fold, <800-fold, <900-fold, <1000-fold, <2000-fold, <3000-fold, <4000-fold, <5000-fold, <6000-fold, <7000-fold, <8000-fold, <9000-fold, <10,000-fold, <15,000-fold, <20,000-fold, <25,000-fold, <30,000-fold, <35,000-fold, <40,000-fold, <45,000-fold, or <50,000-fold induction of systemic inflammation relative to the amount of systemic inflammation after administration of the free STING agonist. In some embodiments, the administration of an EV, e.g., exosome, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) to subject results in less than about 2-5 fold, 5-10 fold, 10-20 fold, 20-30 fold, 30-40 fold, 40-50 fold, 50-60 fold, 60-70 fold, 70-80 fold, 80-90 fold, 90-100 fold, 100-200 fold, 200-300 fold, 300-400 fold, 400-500 fold, 500-600 fold, 600-700 fold, 700-800 fold, 800-900 fold, 900-1000 fold, 1000-2000 fold, 2000-3000 fold, 3000-4000 fold, 4000-5000 fold, 5000-6000 fold, 6000-7000 fold, 7000-8000 fold, 8000-9000 fold, 9000-10,000 fold, 10,000-15,000 fold, 15,000-20,000 fold, 20,000-25,000 fold, 25,000-30,000 fold, 30,000-35,000 fold, 35,000-40,000 fold, 40,000-45,000 fold, or 45,000-50,000 fold induction of systemic inflammation relative to the amount of systemic inflammation after administration of the free STING agonist. Systemic inflammation may be quantified or measured by any appropriate method known in the art.
[0450] In some embodiments, the method of administering an EV, e.g., exosome, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) to a subject additionally comprises administering an additional therapeutic agent. In some embodiments, the additional therapeutic agent is an immunomodulating agent. In some embodiments, the immunomodulating component is an inhibitor for a negative checkpoint regulator or an inhibitor for a binding partner of a negative checkpoint regulator. In some of these embodiments, the negative checkpoint regulator is selected from the group consisting of: cytotoxic T-lymphocyte-associated protein 4 (CTLA-4), programmed cell death protein 1 (PD-1), lymphocyte-activated gene 3 (LAG-3), T-cell immunoglobulin mucin-containing protein 3 (TIM-3), B and T lymphocyte attenuator (BTLA), T cell immunoreceptor with Ig and ITIM domains (TIGIT), V-domain Ig suppressor of T cell activation (VISTA), adenosine A2a receptor (A2aR), killer cell immunoglobulin like receptor (KIR), indoleamine 2,3-dioxygenase (IDO), CD20, CD39, and CD73. In various embodiments, the additional therapeutic agent is an antibody or antigen-binding fragment thereof. In some embodiments, the antibody or antigen-binding fragment thereof is one or more whole antibodies, polyclonal, monoclonal and recombinant antibodies, fragments thereof, and further includes single-chain antibodies, humanized antibodies, murine antibodies, chimeric, mouse-human, mouse-primate, primate-human monoclonal antibodies, anti-idiotype antibodies, antibody fragments, such as, e.g., scFv, (scFv)2, Fab, Fab′, and F(ab′)2, F(abl)2, Fv, dAb, and Fd fragments, diabodies, and antibody-related polypeptides. The term antibody includes bispecific antibodies and multispecific antibodies so long as they exhibit the desired biological activity or function. In some embodiments, the additional therapeutic agent is a therapeutic antibody or antigen-binding fragment thereof that is an inhibitor of CTLA-4, PD-1, PD-L1, PD-L2, TIM-3, or LAG3.
[0451] In some embodiments, the additional therapeutic agent is an agent that prevents or treats T cell exhaustion. Such agents may increase, decrease, or modulate the expression of genes associated with T cell exhaustion, including Prdm1, Bhlhe40, Irf4, Ikzj2, Zeb2, Lass6, Egr2, Tox, Eomes, Nfatc1, Nfatc2, Zbtb32, Rbpj, Hifla, Lag3, Tnfrsf9, Ptger2, Havcr2, Alcam, Tigit, Ctla4, Ptger4, Tnfrsflb, Ccl4, CD109, CD200, Tnfsf9, Nrpl, Sema4c, Ptprj, 1121, Tspan2, Rgs16, Sh2d2a, Nucbl, Plscrl, Ptpn11, Prkca, Plscr4, Casp3, Gpd2, Gas2, Sh3rfl, Nhedc2, Plek, Tnfaip2, and Ctsb, or any combination thereof. Therapeutic agents may also increase, decrease, or modulate a protein associated with T cell exhaustion, including NFAT-1 or NFAT-2.
[0452] V.B. Method of Treating Cancer
[0453] Provided herein are methods of treating cancer in a subject. The method comprises administering to the subject a therapeutically effective amount of the compositions disclosed herein, wherein the composition is capable of up-regulating a STING-mediated immune response in the subject, thereby enhancing the tumor targeting of the subject's immune system. In some embodiments, the composition is administered intra-tumorally to the subject. In some embodiments, the composition is administered parenterally, orally, intravenously, intramuscularly, intraperitoneally, or via any other appropriate administration route.
[0454] Also provided herein are methods of preventing metastasis of cancer in a subject. The method comprises administering to the subject a therapeutically effective amount of the compositions disclosed herein, wherein the composition is capable of preventing one or more tumors at one location in the subject from promoting the growth of one or more tumors at another location in the subject. In some embodiments, the composition is administered intratumorally in a first tumor in one location, and the composition administered in a first tumor prevents metastasis of one or more tumors at a second location.
[0455] In some embodiments, administering an EV, e.g., exosome, disclosed herein inhibits and/or reduces tumor growth in a subject. In some embodiments, the tumor growth (e.g., tumor volume or weight) is reduced by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or about 100% compared to a reference (e.g., tumor volume in a corresponding subject after administration of free STING agonist or an EV, e.g., exosome, without the STING agonist).
[0456] In some embodiments, the cancer being treated is characterized by infiltration of leukocytes (T-cells, B-cells, macrophages, dendritic cells, monocytes) into the tumor microenvironment, or so-called “hot tumors” or “inflammatory tumors”. In some embodiments, the cancer being treated is characterized by low levels or undetectable levels of leukocyte infiltration into the tumor microenvironment, or so-called “cold tumors” or “non-inflammatory tumors”. In some embodiments, an EV, e.g., exosome, is administered in an amount and for a time sufficient to convert a “cold tumor” into a “hot tumor”, i.e., said administering results in the infiltration of leukocytes (such as T-cells) into the tumor microenvironment. In certain embodiments, cancer comprises bladder cancer, cervical cancer, renal cell cancer, testicular cancer, colorectal cancer, lung cancer, head and neck cancer, and ovarian, lymphoma, liver cancer, glioblastoma, melanoma, myeloma, leukemia, pancreatic cancers, or combinations thereof. The term “distal tumor” or “distant tumor” as used herein refers to a tumor that has spread from the original (or primary) tumor to distant organs or distant tissues, e.g., lymph nodes. In some embodiments, the EVs, e.g., exosomes, of the disclosure treats a tumor after the metastatic spread.
[0457] Non-limiting examples of cancers (or tumors) that can be treated with methods disclosed herein include squamous cell carcinoma, small-cell lung cancer (SCLC), non-small cell lung cancer, squamous non-small cell lung cancer (NSCLC), nonsquamous NSCLC, gastrointestinal cancer, renal cancer (e.g., clear cell carcinoma), ovarian cancer, liver cancer (e.g., hepatocellular carcinoma), colorectal cancer, endometrial cancer, kidney cancer (e.g., renal cell carcinoma (RCC)), prostate cancer (e.g., hormone refractory prostate adenocarcinoma), thyroid cancer, pancreatic cancer, cervical cancer, stomach cancer, bladder cancer, hepatoma, breast cancer, colon carcinoma, and head and neck cancer (or carcinoma), gastric cancer, germ cell tumor, pediatric sarcoma, sinonasal natural killer, melanoma (e.g., metastatic malignant melanoma, such as cutaneous or intraocular malignant melanoma), bone cancer, skin cancer, uterine cancer, cancer of the anal region, testicular cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, cancer of the esophagus (e.g., gastroesophageal junction cancer), cancer of the small intestine, cancer of the endocrine system, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, solid tumors of childhood, cancer of the ureter, carcinoma of the renal pelvis, tumor angiogenesis, pituitary adenoma, Kaposi's sarcoma, epidermoid cancer, squamous cell cancer, T-cell lymphoma, environmentally-induced cancers including those induced by asbestos, virus-related cancers or cancers of viral origin (e.g., human papilloma virus (HPV-related or -originating tumors)), and hematologic malignancies derived from either of the two major blood cell lineages, i.e., the myeloid cell line (which produces granulocytes, erythrocytes, thrombocytes, macrophages and mast cells) or lymphoid cell line (which produces B, T, NK and plasma cells), such as all types of leukemias, lymphomas, and myelomas, e.g., acute, chronic, lymphocytic and/or myelogenous leukemias, such as acute leukemia (ALL), acute myelogenous leukemia (AML), chronic lymphocytic leukemia (CLL), and chronic myelogenous leukemia (CML), undifferentiated AML (MO), myeloblastic leukemia (M1), myeloblastic leukemia (M2; with cell maturation), promyelocytic leukemia (M3 or M3 variant [M3V]), myelomonocytic leukemia (M4 or M4 variant with eosinophilia [M4E]), monocytic leukemia (M5), erythroleukemia (M6), megakaryoblastic leukemia (M7), isolated granulocytic sarcoma, and chloroma; lymphomas, such as Hodgkin's lymphoma (HL), non-Hodgkin's lymphoma (NHL), B cell hematologic malignancy, e.g., B-cell lymphomas, T-cell lymphomas, lymphoplasmacytoid lymphoma, monocytoid B-cell lymphoma, mucosa-associated lymphoid tissue (MALT) lymphoma, anaplastic (e.g., Ki1.sup.+) large-cell lymphoma, adult T-cell lymphoma/leukemia, mantle cell lymphoma, angio immunoblastic T-cell lymphoma, angiocentric lymphoma, intestinal T-cell lymphoma, primary mediastinal B-cell lymphoma, precursor T-lymphoblastic lymphoma, T-lymphoblastic; and lymphoma/leukaemia (T-Lbly/T-ALL), peripheral T-cell lymphoma, lymphoblastic lymphoma, post-transplantation lymphoproliferative disorder, true histiocytic lymphoma, primary effusion lymphoma, B cell lymphoma, lymphoblastic lymphoma (LBL), hematopoietic tumors of lymphoid lineage, acute lymphoblastic leukemia, diffuse large B-cell lymphoma, Burkitt's lymphoma, follicular lymphoma, diffuse histiocytic lymphoma (DHL), immunoblastic large cell lymphoma, precursor B-lymphoblastic lymphoma, cutaneous T-cell lymphoma (CTLC) (also called mycosis fungoides or Sezary syndrome), and lymphoplasmacytoid lymphoma (LPL) with Waldenstrom's macroglobulinemia; myelomas, such as IgG myeloma, light chain myeloma, nonsecretory myeloma, smoldering myeloma (also called indolent myeloma), solitary plasmocytoma, and multiple myelomas, chronic lymphocytic leukemia (CLL), hairy cell lymphoma; hematopoietic tumors of myeloid lineage, tumors of mesenchymal origin, including fibrosarcoma and rhabdomyoscarcoma; seminoma, teratocarcinoma, tumors of mesenchymal origin, including fibrosarcoma, rhabdomyoscaroma, and osteosarcoma; and other tumors, including melanoma, xeroderma pigmentosum, keratoacanthoma, seminoma, thyroid follicular cancer and teratocarcinoma, hematopoietic tumors of lymphoid lineage, for example T-cell and B-cell tumors, including but not limited to T-cell disorders such as T-prolymphocytic leukemia (T-PLL), including of the small cell and cerebriform cell type; large granular lymphocyte leukemia (LGL) of the T-cell type; a/d T-NHL hepatosplenic lymphoma; peripheral/post-thymic T cell lymphoma (pleomorphic and immunoblastic subtypes); angiocentric (nasal) T-cell lymphoma; cancer of the head or neck, renal cancer, rectal cancer, cancer of the thyroid gland; acute myeloid lymphoma, and any combinations thereof.
[0458] In some embodiments, a cancer (or tumor) that can be treated comprises a breast cancer, head and neck cancer, uterine cancer, brain cancer, skin cancer, renal cancer, lung cancer, colorectal cancer, prostate cancer, liver cancer, bladder cancer, kidney cancer, peritoneal cancer, pancreatic cancer, thyroid cancer, esophageal cancer, eye cancer, stomach (gastric) cancer, gastrointestinal cancer, carcinoma, sarcoma, leukemia, lymphoma, myeloma, or a combination thereof. In certain embodiments, a cancer that can be treated with the present disclosure is a pancreatic cancer and/or a peritoneal cancer.
[0459] In some embodiments, the methods described herein can also be used for treatment of metastatic cancers, unresectable, refractory cancers (e.g., cancers refractory to previous cancer therapy), and/or recurrent cancers.
[0460] In some embodiments, EVs, e.g., exosomes, disclosed herein can be used in combination with one or more additional anti-cancer and/or immunomodulating agents. Such agents can include, for example, chemotherapy drugs, small molecule drugs, or antibodies that stimulate the immune response to a given cancer. In some embodiments, the methods described herein are used in combination with a standard of care treatment (e.g., surgery, radiation, and chemotherapy).
[0461] In some embodiments, a method for treating a cancer disclosed herein can comprise administering an EV, e.g., exosome, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) with one or more immuno-oncology agents, such that multiple elements of the immune pathway can be targeted. Non-limiting of such combinations include: a therapy that enhances tumor antigen presentation (e.g., dendritic cell vaccine, GM-CSF secreting cellular vaccines, CpG oligonucleotides, imiquimod); a therapy that inhibits negative immune regulation e.g., by inhibiting CTLA-4 and/or PD1/PD-L1/PD-L2 pathway and/or depleting or blocking Tregs or other immune suppressing cells (e.g., myeloid-derived suppressor cells); a therapy that stimulates positive immune regulation, e.g., with agonists that stimulate the CD-137, OX-40, and/or CD40 or GITR pathway and/or stimulate T cell effector function; a therapy that increases systemically the frequency of anti-tumor T cells; a therapy that depletes or inhibits Tregs, such as Tregs in the tumor, e.g., using an antagonist of CD25 (e.g., daclizumab) or by ex vivo anti-CD25 bead depletion; a therapy that impacts the function of suppressor myeloid cells in the tumor; a therapy that enhances immunogenicity of tumor cells (e.g., anthracyclines); adoptive T cell or NK cell transfer including genetically modified cells, e.g., cells modified by chimeric antigen receptors (CAR-T therapy); a therapy that inhibits a metabolic enzyme such as indoleamine dioxigenase (IDO), dioxigenase, arginase, or nitric oxide synthetase; a therapy that reverses/prevents T cell anergy or exhaustion; a therapy that triggers an innate immune activation and/or inflammation at a tumor site; administration of immune stimulatory cytokines; or blocking of immuno repressive cytokines.
[0462] In some embodiments, an immuno-oncology agent that can be used in combination with EVs, e.g., exosomes, disclosed herein comprises an immune checkpoint inhibitor (i.e., blocks signaling through the particular immune checkpoint pathway). Non-limiting examples of immune checkpoint inhibitors that can be used in the present methods comprise a CTLA-4 antagonist (e.g., anti-CTLA-4 antibody), PD-1 antagonist (e.g., anti-PD-1 antibody, anti-PD-L1 antibody), TIM-3 antagonist (e.g., anti-TIM-3 antibody), or combinations thereof.
[0463] In some embodiments, an immuno-oncology agent comprises an immune checkpoint activator (i.e., promotes signaling through the particular immune checkpoint pathway). In certain embodiments, immune checkpoint activator comprises OX40 agonist (e.g., anti-OX40 antibody), LAG-3 agonist (e.g. anti-LAG-3 antibody), 4-1BB (CD137) agonist (e.g., anti-CD137 antibody), GITR agonist (e.g., anti-GITR antibody), or any combination thereof.
[0464] In some embodiments, a combination of an EV, e.g., exosome, disclosed herein and a second agent discussed herein (e.g., immune checkpoint inhibitor) can be administered concurrently as a single composition in a pharmaceutically acceptable carrier. In other embodiments, a combination of an EV, e.g., exosome, and a second agent discussed herein (e.g., immune checkpoint inhibitor) can be administered concurrently as separate compositions. In further embodiments, a combination of an EV, e.g., exosome, and a second agent discussed herein (e.g., immune checkpoint inhibitor) can be administered sequentially. In some embodiments, an EV, e.g., exosome, is administered prior to the administration of a second agent (e.g., immune checkpoint inhibitor).
[0465] V.C. Pharmaceutical Compositions
[0466] Provided herein are pharmaceutical compositions comprising EVs, e.g., exosomes, that are suitable for administration to a subject. The pharmaceutical compositions generally comprise a plurality of EVs, e.g., exosomes, comprising a STING agonist (e.g., encapsulated or expressed on the luminal or exterior surface) and a pharmaceutically-acceptable excipient or carrier in a form suitable for administration to a subject. Pharmaceutically-acceptable excipients or carriers are determined in part by the particular composition being administered, as well as by the particular method used to administer the composition. Accordingly, there is a wide variety of suitable formulations of pharmaceutical compositions comprising a plurality of EVs, e.g., exosomes. (See, e.g., Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton, Pa. 18th ed. (1990)). The pharmaceutical compositions are generally formulated sterile and in full compliance with all Good Manufacturing Practice (GMP) regulations of the U.S. Food and Drug Administration.
[0467] In some embodiments, the pharmaceutical composition comprises one or more STING agonist and the EVs, e.g., exosomes, described herein.
[0468] Pharmaceutically-acceptable excipients include excipients that are generally safe (GRAS), non-toxic, and desirable, including excipients that are acceptable for veterinary use as well as for human pharmaceutical use.
[0469] Examples of carriers or diluents include, but are not limited to, water, saline, Ringer's solutions, dextrose solution, and 5% human serum albumin. The use of such media and compounds for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or compound is incompatible with the EVs, e.g., exosomes, described herein, use thereof in the compositions is contemplated. Supplementary therapeutic agents may also be incorporated into the compositions. Typically, a pharmaceutical composition is formulated to be compatible with its intended route of administration. The EVs, e.g., exosomes, can be administered by intratumoral, parenteral, topical, intravenous, oral, subcutaneous, intraarterial, intradermal, transdermal, rectal, intracranial, intraperitoneal, intranasal; intramuscular route or as inhalants. In one embodiment, the pharmaceutical composition comprising EVs, e.g., exosomes, is administered intravenously, e.g. by injection. The EVs, e.g., exosomes, can optionally be administered in combination with other therapeutic agents that are at least partly effective in treating the disease, disorder or condition for which the EVs, e.g., exosomes, are intended.
[0470] Solutions or suspensions can include the following components: a sterile diluent such as water, saline solution, fixed oils, polyethylene glycols, glycerin, propylene glycol or other synthetic solvents; antibacterial compounds such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating compounds such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetates, citrates or phosphates, and compounds for the adjustment of tonicity such as sodium chloride or dextrose. The pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide. The preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
[0471] Pharmaceutical compositions suitable for injectable use include sterile aqueous solutions (if water soluble) or dispersions and sterile powders. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, Cremophor EL™ (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS). The composition is generally sterile and fluid to the extent that easy syringeability exists. The carrier can be a solvent or dispersion medium containing, e.g., water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, e.g., by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal compounds, e.g., parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. If desired, isotonic compounds, e.g., sugars, polyalcohols such as mannitol, sorbitol, sodium chloride can be added to the composition. Prolonged absorption of the injectable compositions can be brought about by including in the composition a compound which delays absorption, e.g., aluminum monostearate and gelatin.
[0472] Sterile injectable solutions can be prepared by incorporating the EVs, e.g., exosomes, in an effective amount and in an appropriate solvent with one or a combination of ingredients enumerated herein, as desired. Generally, dispersions are prepared by incorporating the EVs, e.g., exosomes, into a sterile vehicle that contains a basic dispersion medium and any desired other ingredients. In the case of sterile powders for the preparation of sterile injectable solutions, methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof. The EVs, e.g., exosomes, can be administered in the form of a depot injection or implant preparation which can be formulated in such a manner to permit a sustained or pulsatile release of the EVs, e.g., exosomes.
[0473] Systemic administration of compositions comprising EVs, e.g., exosomes, can also be by transmucosal or transdermal means. For transmucosal or transdermal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art, and include, e.g., for transmucosal administration, detergents, bile salts, and fusidic acid derivatives. Transmucosal administration can be accomplished through the use of nasal sprays or suppositories. For transdermal administration, the modified EVs, e.g., exosomes, are formulated into ointments, salves, gels, or creams as generally known in the art.
[0474] This PCT application claims the priority benefit of U.S. Provisional Application Nos. 62/647,491, filed Mar. 23, 2018; 62/680,501, filed Jun. 4, 2018; 62/688,600, filed Jun. 22, 2018; and 62/756,247, filed Nov. 6, 2018, each of which is incorporated herein by reference in its entirety.
EXAMPLES
[0475] The following examples are provided for illustrative purposes only, and are not to be construed as limiting the scope or content of the invention in any way. The practice of the current invention will employ, unless otherwise indicated, conventional methods of protein chemistry, biochemistry, recombinant DNA techniques and pharmacology, within the skill of the art. Such techniques are explained fully in the literature. See, e.g., T. E. Creighton, Proteins: Structures and Molecular Properties (W.H. Freeman and Company, 1993); Green & Sambrook et al., Molecular Cloning: A Laboratory Manual, 4th Edition (Cold Spring Harbor Laboratory Press, 2012); Colowick & Kaplan, Methods In Enzymology (Academic Press); Remington: The Science and Practice of Pharmacy, 22nd Edition (Pharmaceutical Press, 2012); Sundberg & Carey, Advanced Organic Chemistry: Parts A and B, 5th Edition (Springer, 2007).
Methods
Exosome Purification
[0476] HEK293SF cells were grown to high density in chemically defined medium for 7 days. Conditioned cell culture media was collected and centrifuged at 300-800×g for 5 minutes at room temperature to remove cells and large debris. Media supernatant was then supplemented with 1000 U/L BENZONASE® and incubated at 37° C. for 1 hour in a water bath. Supernatant was collected and centrifuged at 16,000×g for 30 minutes at 4° C. to remove residual cell debris and other large contaminants. Supernatant was then ultracentrifuged at 133,900×g for 3 hours at 4° C. to pellet the exosomes. Supernatant was discarded and any residual media was aspirated from the bottom of the tube. The pellet was resuspended in 200-1000 μL PBS (—Ca—Mg).
[0477] To further enrich exosome populations, the pellet was processed via density gradient purification (sucrose or OPTIPREP™). For sucrose gradient purification, the exosome pellet was layered on top of a sucrose gradient as defined in Table 3 below.
TABLE-US-00003 TABLE 3 WORKING 65% STOCK MILLI-Q PERCENTAGE (%) VOL. (ML) VOL. (ML) 50 3.85 1.15 40 3.08 1.92 25 1.92 3.08 10 0.46 2.54
[0478] The gradient was spun at 200,000×g for 16 hours at 4° C. in a 12 mL Ultra-Clear (344059) tube placed in a SW 41 Ti rotor to separate the exosome fraction.
[0479] The exosome layer was gently removed from the top layer and diluted in ˜32.5 mL PBS in a 38.5 mL Ultra-Clear (344058) tube and ultracentrifuged again at 133,900×g for 3 hours at 4° C. to pellet the purified exosomes. The resulting pellet was resuspended in a minimal volume of PBS (˜200 μL) and stored at 4° C.
[0480] For OPTIPREP™ gradient, a 3-tier sterile gradient is prepared with equal volumes of 10%, 30%, and 45% OPTIPREP™ in a 12 mL Ultra-Clear (344059) tube for a SW 41 Ti rotor. The pellet was added to the OPTIPREP™ gradient and ultracentrifuged at 200,000×g for 16 hours at 4° C. to separate the exosome fraction. The exosome layer was then gently collected from the top ˜3 mL of the tube.
[0481] The exosome fraction was diluted in ˜32 mL PBS in a 38.5 mL Ultra-Clear (344058) tube and ultracentrifuged at 133,900×g for 3 hours at 4° C. to pellet the purified exosomes. The pelleted exosomes were then resuspended in a minimal volume of PBS (˜200 μL) and store at 4° C.
In Vivo Intratumoral Microinjection Studies with CIVO®
Tumor Cell Culture
[0482] A20 cells (ATCC Lot #70006082) were cultured in RPMI 1640 with L-Glutamine (ThermoFisher), 10% fetal bovine serum (Thermofisher) and 50 nanomolar BME at 37 degrees Celsius, 5% CO.sub.2. IMPACT III testing (IDEXX Bioresearch) was carried out to confirm mycoplasma- and pathogen-free status. Cells were expanded and cryopreserved following 2-3 passages after obtaining from vendor. After thawing, cells were maintained for a maximum of 8 weeks by sub-culturing 3 times a week and replenished from a fresh frozen stock thereafter.
In Vivo Studies
[0483] All experiments in mice were approved by IACUC Board of Presage Biosciences, Seattle, Wash. (Protocol number PR-001) and were performed at Presage in accordance with relevant guidelines and regulations. All relevant procedures were performed under anesthesia and all efforts were made to minimize pain and suffering. Female BALB/cAnNHsd mice (Envigo) with an average weight of 18 gm were used for experiments at 5-7 weeks of age. For generating A20 allografts, mice were inoculated with 1 million A20 cells in 100 μl inoculation volume.
CIVO® Intra-Tumoral Microinjections
[0484] CIVO intra-tumoral microinjections were performed as described in Klinghoffer et al. (2016) Science Translational Medicine. Briefly, mice (n=6 per time point, 4 and 24 hours) were enrolled in microinjection studies when implanted tumors reached the following approximate dimensions: 14 mm (length), 10 mm (width) and 7 mm (depth). The CIVO device was configured with 6 thirty-gauge injection needles with a total volume delivery of 2.0 μl. Presage's fluorescent tracking marker (FTM, 5% by volume) was added to the injection contents for spatial orientation. Agents microinjected were as follows: control PTGFRN++ GFP exosomes, ML RR-S2 CDA loaded PTGFRN++ GFP Exosomes, ML RR-S2 CDA loaded PTGFRN++ GFP Desialylated exosomes, ML RR-S2 CDA loaded native exosomes, all at 10 ng/μl ML RR-S2 CDA such that the total amount delivered was 20 ng. Free ML RR-S2 CDA was microinjected at both 20 ng and 2 μg. At 4 and 24 hours following CIVO microinjections, mice were euthanized using CO.sub.2 inhalation for biomarker analyses.
Histology, Immunohistochemistry and In Situ Hybridization
[0485] Resected tumors were cut into 2 mm thick sections perpendicular to the injection columns, fixed in 10% buffered formalin for 48 hours. UV imaging was used to confirm CIVO microinjections based on signal from the FTM injected at each CIVO site. 2 mm-thick tissue sections were then processed for standard paraffin embedding. 4 μm thick sections were for used for all histological assays as described below. Hematoxylin-Eosin (H&E) staining was performed using standard methods.
Immunohistochemistry
[0486] Formalin-fixed, paraffin embedded tumors were cut onto slides with a thickness of 4 μm. Slides were baked for 1 hour at 60° C., deparaffinized in xylene, and rehydrated via graded alcohols.
[0487] Slides underwent a 20-minute target retrieval solution incubation at 100° C., followed by a 20-minute cool down to room temperature. Serum Block (5% Normal Goat Serum in TBST) was performed for 1 hr at room temperature. Primary antibody staining was carried out with appropriate primary antibody in 5% NGS TBS diluent overnight at room temperature. Corresponding isotype controls were included in each batch. Secondary antibody staining was carried out with appropriate secondary antibody in 5% NGS TBS diluent overnight at room temperature. The slides were counterstained with DAPI for 10 minutes and coverslipped with Prolong Gold mounting medium (Invitrogen). Stained slides were imaged using a digital, automated, high resolution scanner.
[0488] In situ hybridization was completed using the RNAscope multiplex fluorescent reagent kit v2 (Advanced Cell Diagnostics). Formalin-fixed, paraffin embedded tumors were cut onto slides with a thickness of 4 μm. Slides were baked for 1 hour at 60° C., deparaffinized in xylene, and rehydrated via graded alcohols. Hydrogen peroxide was added for 10 minutes to quench endogenous peroxidase activity. Slides underwent a 15-minute target retrieval solution incubation at 100° C., followed by a 15-minute protease digestion at 40° C. The RNAscope ISH assay was completed with a mouse Ifnb1 probe (Advanced Cell Diagnostics) and TSA Plus Cyanine 5 detection (Perkin Elmer). The slides were counterstained with DAPI for 10 minutes and coverslipped with Prolong Gold mounting medium (Invitrogen). Stained slides were imaged using a digital, automated, high resolution scanner.
Whole-Slide Scanning and Image Analysis
[0489] Images of every cell from each tissue section stained were captured by digital, automated, high-resolution whole-tissue scanning (3D Histech Panoramic 250 Flash). Tumor responses were quantified from image files from each tissue section using Presage's custom CIVO Analyzer image analysis platform. Whole-tissue section images captured by the slide scanners were automatically processed by CIVO Analyzer. Each cell from each tissue section was segmented based on the nuclear (DAPI) signal and classified as biomarker-negative or -positive using Cell Profiler (Broad Institute). Following cellular segmentation and classification, circular regions of interest (ROI) were localized around each microinjection site in each image around the FTM at each position, with the largest ROI no greater than 2000 μm in radius. In order to mitigate the influence of pre-existing necrosis on biomarker measurements, injection sites that fall within largely acellular tumor regions are excluded prior to quantitative analysis.
Example 1: Exosome-Encapsulated STING Agonists
Encapsulation of STING Agonist
[0490] 1 mM STING agonist including ML RR-S2 CDA ammonium salt (MedChem Express, Cat. No. HY-12885B) and (3-3 cAIMPdFSH; InvivoGen, Cat. No. tlrl-nacairs) was incubated with purified exosomes (1E12 total particles) in 300 ul of PBS at 37° C. overnight. The mixture was then washed twice in PBS and purified by ultra-centrifugation at 100,000×g (
Quantification of the Cyclic Dinucleotide STING Agonist
Sample Preparation for LC-MS Analysis
[0491] All samples were received in either phosphate-buffered saline (PBS) buffer or PBS and 5% sucrose. Prior to analysis, the particle concentration (P/mL) was measured by Nanoparticle Tracking Analysis (NTA) on the NanoSight NS300. All standards and samples were prepared such that each injection contained a virtually identical number of particles. This was achieved through a combination of diluting samples and spiking exosomes into standards to reach a final concentration of 1.0-4.0E+11 P/mL, depending on the initial particle concentrations of the samples.
[0492] Standard curves were prepared by spiking a known concentration of STING agonist into PBS buffer, then preparing additional standards through serial dilution. Separate standards were typically prepared such that the final concentrations (after all sample preparation steps) were 25, 50, 250, 500, 1250, 2500, and 5000 nM STING agonist. First, 75.0 μL of each appropriately diluted sample and each matrix-matched standard was prepared in a separate 1.5 mL microcentrifuge tube. Next, 25.0 μL of exosome lysis buffer (60 mM Tris, 400 mM GdmCl, 100 mM EDTA, 20 mM TCEP, 1.0% Triton X-100) was added to each tube, then all tubes were vortexed to mix and briefly centrifuged to settle. Finally, 1.0 μL of concentrated Proteinase K enzyme solution (Dako, reference S3004) was added to each tube, and again all tubes were vortexed and then briefly centrifuged, followed by incubation at 55° C. for 60 minutes. Prior to injection on the LC-MS, samples were allowed to cool to room temperature and were transferred to HPLC vials.
LC-MS Analysis
[0493] 20.0 μL of standards and samples were injected neat into an UltiMate 3000 RSCLnano (Thermo Fisher Scientific) low flow chromatography system without cleanup. Separation of analytes was performed using a Phenomenex Kinetex EVO C18 core-shell analytical column (50×2.1 mm, 2.6 μm particle size, 100 Å pore size) and the loading pumps delivering a gradient of mobile phase A (MPA: water, 0.1% formic acid) and mobile phase B (MPB: acetonitrile, 0.1% formic acid) at a flowrate of 500 μL/min. The gradient began at 2% MPB, which was held for 2 minutes to load and desalt the STING agonist analyte. The percentage MPB then increased from 2-30% over 3 minutes to elute the STING agonist analyte. The percentage MPB then increased from 30-95% over 1 minute, held at 95% for 3 minutes, decreased from 95-2% over 1 minute, and then held at 2% for another 3 minutes to re-equilibrate the column. The total runtime for the method was 13 minutes, and LC flow was only directed into the MS between 2.5-4.5 minutes. Typical carry-over was less than 0.05% of the peak area of the previous injection, therefore blank injections were not performed between analytical injections.
[0494] Mass analyses were performed with a Q Exactive Basic (Thermo Fisher Scientific) mass spectrometer with the Ion Max source and a HESI-II probe operating in negative ion mode, and mass spectra were collected using Full MS-SIM mode scanning from 500-800 Da with an AGC target of 1E+6 ions, a maximum injection time of 200 ms, and a resolution of 35,000. STING agonist quantitation was performed using the monoisotopic-1 STING agonist peak by selectively extracting all ions within the m/z range from 688.97-689.13 Da, and then integrating the resulting peak at a retention time between 3.80-3.90 minutes. The concentration of STING agonist in a given sample was determined by comparing the STING agonist peak area in that sample to STING agonist peak areas generated by standards, which is typical of relative quantitation.
Example 2: Increased Potency of STING Agonist Loaded in Exosomes
[0495] Exosome-encapsulated STING agonist and free STING agonist were tested for activity in human peripheral blood mononuclear cells (PBMCs). PBMCs were isolated from fresh human blood by centrifugation over a layer of Lymphoprep at 1000×g for 15 minutes. The resulting buffy coat was washed in PBS and counted. PBMCs were plated in 96-well U-bottom plates. Titrations of the exosome-encapsulated (Exo-STING agonist) or free STING agonist were prepared in a separate U-bottom plate to perform dose-response studies. The exosome-encapsulated or free STING agonist was added to the PBMCs and incubated at 37° C. overnight. General activation of PBMCs by the STING agonist was detected by measuring the amount of IFNβ in the supernatant. As shown in
[0496] To understand the extent that different immune cell types are activated by STING agonists, specific activation of T cells, B cells, and NK cells was assessed by measuring the amount of CD69 on the cell surface by flow cytometry. Activation of antigen-presenting cells (APCs) including monocytes, myeloid dendritic cells, plasmacytoid dendritic cells, and B cells was assessed by measuring the amount of CD80, CD86, HLA-DR, or CD83 on the cell surface by flow cytometry. As shown in
Example 3: Enhancing STING Exosome Activity by PTGFRN Overexpression and Exosome Glycan Modification
[0497] The results in Examples 1 and 2 suggest that exosome surface molecules may mediate the increased potency of Exo-STING agonist compared to free STING agonist. Previous results have demonstrated that prostaglandin F2 receptor negative regulator (PTGFRN) is an abundant glycoprotein on the luminal or exterior surface of exosomes. When PTGFRN is overexpressed in a producer cell, PTGFRN is the predominant glycoprotein on the luminal or exterior surface of exosomes. To determine whether PTGFRN played a role in mediating Exo-STING agonist activation of immune cells, exosomes with modified glycan profiles or engineered to express higher levels of PTGFRN were compared to free STING agonist. Similar to the results in
[0498] The results in
Kifunensine Pre-Treatment to Modulate STING Activation
[0499] To determine whether any perturbation of exosomal surface glycans can alter immune cell uptake, producer cell lines were treated with the alkaloid agent kifunensine, which prevents the trimming of high mannose sugar residues during protein glycosylation, and prevents complete glycosylation. The resulting exosomes from kifunensine-treated cells have altered glycosylation status and are enriched in high mannose. Kifunensine-treated exosomes were loaded with STING agonist and administered to PBMCs from two donors. This resulted in a partial attenuation of STING agonistic activity compared to wild-type exosomes. Specifically, monocyte and mDC activation were largely unchanged (
Example 4: Optimizing Loading of Exosomes with STING Agonist
[0500] In the previous examples, the exosomes were loaded with STING agonist by incubating at 37° C. overnight. To determine the kinetics of STING agonist loading, exosomes were incubated with 1 mM STING agonist for 2 hours, 6 hours, or overnight, and added to PBMCs to measure IFNβ production. As shown in
Example 5: Comparative Potency of Different Exosome-Encapsulated STING Agonist Cyclic Dinucleotides
[0501] HEK293SF cells overexpressing PTGFRN were grown in shake flasks and the resulting exosomes were purified by Optiprep™ density gradient ultracentrifugation as described in the Methods. The purified exosomes were loaded with either of the STING agonists ML RR-S2 CDA (MedChem Express, Cat. No. HY-12885B) or 3-3 cAIMPdFSH (InvivoGen, Cat. No. tlrl-nacairs) according to the methods in Example 1. Loading was quantified as described in Example 1. The exosome-encapsulated or free STING agonists were added to human PBMCs and incubated at 37° C. overnight. Activation of PBMCs by the STING agonists was detected by measuring the amount of IFNβ in the supernatant. As shown in
Example 6: In Vivo Potency and Systemic Effects of Free STING Agonists Compared to Exosome-Encapsulated STING Agonists in Tumor-Bearing Mice
[0502] Four groups of C57BL/6 mice (3-4 mice per group) were inoculated subcutaneously with 5×10.sup.5 B16F10 tumor cells. Eight days post-inoculation the mice were injected with a single intratumoral dose of PBS, 20 μg of free ML RR-S2 CDA, 0.2 μg of free ML RR-S2 CDA, or 0.2 μg of ML RR-S2 CDA loaded in PTGFN-overexpressing exosomes (exo ML RR-S2 CDA). Four hours post-injection the tumors, draining lymph nodes, spleens, and serum were collected and cytokine levels were measured. IFNβ gene expression levels in the tumor were comparable in the 20 μg free STING agonist and 0.2 μg exosome-STING agonist groups, which were both higher than the 0.2 μg free STING agonist and PBS groups (
[0503] STING agonists are very potent pro-inflammatory molecules, and one potential clinical liability of these compounds is their induction of systemic toxicity due to free compound escaping the tumor injection site and diffusing into circulation. The draining lymph nodes of the exosome-STING agonist-treated tumor bearing mice showed comparable or slightly elevated IFNβ (
[0504] To confirm that the effects observed in
Example 7: Comparative Local and Systemic Activation of STING Pathway after Intratumoral and Intraperitoneal Administration of Free STING Agonist and Exosome-Encapsulated STING Agonist in Tumor-Bearing Mice
[0505] Five groups of C57BL/6 mice (n=4 mice per group) were inoculated subcutaneously with 5×10.sup.5 B16F10 murine melanoma cells. Eight days post-inoculation the mice were injected intraperitoneally (IP) with a single dose of either PBS, 20 μg ML RR-S2, 0.2 μg ML RR-S2, 0.2 μg ML RR-S2 loaded in PTGFRN-overexpressing exosomes (Exo STING IP), or intratumorally (IT) with a single dose of 0.2 μg ML RR-S2 loaded in PTGFRN-overexpressing exosomes (Exo STING IT). The exosome-encapsulated STING agonist formulations were loaded and quantitated as described in Example 1. High-dose free STING agonist injected IP induced IFNβ expression in the tumor, pancreas, and spleen above the PBS-treated group. Exo STING IP, at a 100-fold lower dose, led to superior IFNβ expression in the pancreas (
Example 8: Differential STING Pathway Signaling in Naïve Mice In Vivo with Exosome-Encapsulated STING Agonists and Free STING Agonists
[0506] Naïve C57BL/6 mice were injected intraperitoneally (IP) with a single dose of either PBS, 20 μg ML RR-S2, 0.2 μg ML RR-S2, or 0.2 μg ML RR-S2 loaded in PTGFRN-overexpressing exosomes (Exo STING), which were formulated and quantitated as described in Example 1 (n=5 mice per group). Lung, spleen, pancreas, and serum were isolated four hours post-injection and analyzed for gene expression and cytokine production. IFNβ, CXCL9, and CXCL10 expression were dramatically higher in the lungs (
[0507] A second experiment similar to the previous study was carried out with single-dose IP administration, and extended to 24 hours. Peritoneal cells and splenocytes were isolated from treated mice, and cell activation was measured by detection of CD86. High doses of free STING agonist resulted in activation of peritoneal B cells, macrophages, monocytes and conventional dendritic cells (cDCs), while Exo STING at a 100-fold lower dose induced greater activation of macrophages, similar activation of cDCs, and attenuated activation of B-cells and monocytes (
Example 9: Comparative In Vivo Efficacy of STING Agonist-Loaded Exosomes and Free STING Agonist in a Murine Model of Melanoma
[0508] The results of the previous Examples suggest that Exo STING may be a more potent anti-tumor formulation than equal or greater amounts of soluble STING agonist. To test this hypothesis, C57BL/6 mice were inoculated subcutaneously with 5×10.sup.5 B16F10 murine melanoma cells (n=5 mice per group). Five, eight, and eleven days post-inoculation the mice were injected intratumorally with PBS, 20 μg ML RR-S2, 0.2 μg ML RR-S2, or 0.2 μg ML RR-S2 loaded in PTGFRN-overexpressing exosomes Tumor volumes were measured daily until day 39, and animals were sacrificed when tumor volume reached 2000 mm.sup.3. Compared to the PBS control group, tumor growth was moderately potentiated after treatment with 0.2 μg free STING agonist and almost completely eliminated upon treatment with 20 μg free STING agonist at day 25. Surprisingly, treatment with 0.2 μg of Exo STING resulted in dramatically improved tumor regression compared to the concentration-matched free STING agonist group and to a similar extent as the high-dose free STING agonist group at day 25. Notably, treatment with Exo STING and high dose free STING agonist led to a complete response (defined as undetectable tumors at the site of inoculation; CR) in three out of five animals in each group (
[0509] STING pathway activation leads to memory T-cell recruitment and ultimately a durable adaptive immune response. To determine whether the anti-tumor effects in this study led to an immune response, the five animals in the high dose STING agonist and Exo STING groups were re-challenged on day 21 by transplantation of 5×10.sup.5 B16F10 cells on the opposite flank. Five additional naïve mice were inoculated with the same tumor cell preparation and treated daily with PBS to ensure cell viability and growth kinetics. By day 39 (18 days post-challenge) all mice in the PBS group were sacrificed. Tumors in animals from the high-dose free STING agonist group failed to grow in four out of 5 animals, while remarkably, tumor growth was undetectable in all five mice in the Exo STING group (
Example 10: Dose-Dependent Anti-Tumor Response of STING Agonist-Loaded Exosomes in a Murine Model of Melanoma
[0510] The results in Example 9 demonstrate that Exo STING can induce an anti-tumor effect in vivo to a similar extent as a 100-fold greater dose of free STING agonist. To determine the relationship between injected dose of Exo STING and tumor growth, an in vivo dose-titration experiment was carried out. C57BL/6 mice were inoculated subcutaneously with 5×10.sup.5 B16F10 murine melanoma cells (n=5 mice per group). Six, nine, and twelve days post-inoculation the mice were injected intratumorally with PBS and either 200 ng, 40 ng, or 8 ng of ML RR-S2 loaded in PTGFRN-overexpressing exosomes). Tumor volumes were measured daily until day 18, and animals were sacrificed when tumor volume reached 2000 mm.sup.3. Four out of five mice in the PBS control group were sacrificed by day 18, while none of the Exo STING-treated mice in any group were sacrificed during the course of the study. There were two complete responses in the 200 ng Exo STING group and one complete response in the 40 ng Exo STING group. Surprisingly, there was a substantial reduction in tumor growth in the 8 ng Exo STING group compared to the PBS group, demonstrating that a very low dose of Exo STING can have a measurable pharmacological impact in an aggressive tumor model (
Example 11: Induction of an Antigen-Specific T-Cell Response by Free STING Agonist and STING Agonist-Loaded Exosomes
[0511] STING pathway agonism in dendritic cells enhances antigen presentation, IFNβ production, and recruits CD8+ memory T-cells to elicit a durable adaptive immune response. To determine whether Exo STING could induce a memory T-cell response to a defined antigen, an antigen-specific T-cell response study was carried out using purified ovalbumin (OVA). A diagram of the experimental overview is shown in
[0512] As an orthogonal method to measure antigen-specific immunity, IFNγ-expression was measured by ELISpot according to standard protocols (ImmunoSpot®; Cellular Technology Limited). Splenocytes were homogenized to a single-cell suspension and plated (200,000 cells/well) in a plate coated with an anti-IFNγ antibody. The OVA peptide SIINFEKL was added to the cells for 18 hours to induce IFNγ production, cells were washed from the plate, and plate-bound IFNγ was detected using an orthogonal antibody (
Example 12: Anti-Tumor Efficacy and Antigen-Specific Immune Response in a Model of Murine T-Cell Lymphoma
[0513] The in vivo efficacy results shown in Examples 9 and 10 and the immune response induction shown in Example 11 suggest that Exo STING may be sufficient to induce an antigen-specific tumor-killing response and subsequent immune response in vivo. To test this hypothesis, C57BL/6 mice were inoculated subcutaneously with 1×10.sup.6 E.G7-OVA cells (ATCC®; CRL-2113™), a murine T-cell lymphoma cell line engineered to stably express OVA and allow for modeling antigen-specific T-cell responses in mice (n=5 mice per group). Ten, 13, and 16 days post-inoculation the mice were injected intratumorally with PBS, 20 μg ML RR-S2, 0.2 μg ML RR-S2, or 0.2 μg ML RR-S2 loaded in PTGFRN-overexpressing exosomes). Similar to the effects observed in the B16F10 model (
Example 13: PTGFRN-Overexpressing Exosomes Enhance Stability of STING Agonist Compared to Native Exosomes
[0514] Exosomes from HEK293SF cells (native exo STING) and from HEK293SF cells overexpressing PTGFRN-GFP (PTGFRN exo STING) were loaded with ML RR-S2, purified, and quantitated as described in Example 1. Fresh samples of native exo STING and PTGFRN exo STING induced similar IFNβ levels in PBMCs from a single donor, and both provided a potency enhancement over free STING agonist (
[0515] Fresh and frozen preparations of PTGFRN exo STING were incubated with PBMCs, and cellular uptake profiles for DCs, NK cells, and monocytes were measured by cell-specific surface markers and GFP positivity. There was no difference in uptake profile between fresh (
Example 14: Induction of Protective Immunity and Reduction of Metastasis by Intratumoral Administration of STING Agonist-Loaded Exosomes
[0516] Activation of the STING pathway promotes antigen presentation and induces a durable T-cell response, as shown in Examples 11 and 12. Thus, the immune memory response induced by EXOSTING™ may be sufficient to prevent tumor metastasis after a local administration in a primary tumor. To test this hypothesis, exosomes purified from HEK293SF cells overexpressing PTGFRN were loaded with the cyclic dinucleotide 3-3 cAIMPdFSH as described in Example 1. C57BL/6 mice were inoculated subcutaneously with 1×10.sup.6 B16F10 melanoma cells on day zero and challenged with an additional tail vein injection of 1×10.sup.5 B16F10 melanoma cells to seed lung metastases (n=8 mice per group). Five, eight, and eleven days post-inoculation the mice were injected intratumorally at the subcutaneous tumor with PBS, 20 μg 3-3 cAIMPdFSH, 120 ng 3-3 cAIMPdFSH, or either 120 ng, 12 ng, or 1.2 ng 3-3 cAIMPdFSH loaded in PTGFRN-overexpressing exosomes (Exo STING Agonist). By day 17, the primary tumors in the 20 μg STING Agonist and 120 ng Exo STING Agonist groups did not grow. There was a dose-response relationship in the 12 ng and 1.2 ng Exo STING Agonist groups, but no tumor regression observed in the PBS or 120 ng STING Agonist groups (
Example 15: Exosome-Mediated Delivery of STING Agonists Synergizes with Immune Checkpoint Blockade Immunotherapy and Relies on T-Cell-Mediated Tumor Killing
[0517] Activation of the STING pathway induces the upregulation of immune pathway checkpoints, which subsequently reduce T-cell-mediated cell killing, and thus moderate the effects of STING pathway agonism as a therapeutic rationale (Cell Rep. 2015 May 19; 11(7):1018-30). Therefore, it may be beneficial to combine inhibitors of immune checkpoint regulation to further improve immune-mediated clearance of tumor cells. To test this hypothesis, exosomes purified from HEK293SF cells overexpressing PTGFRN were loaded with the cyclic dinucleotide ML RR-S2 CDA as described in Example 1. C57BL/6 mice were inoculated subcutaneously with 1×10.sup.6 B16F10 melanoma cells (n=6 mice per group). Five, eight, and eleven days post-inoculation the mice were injected intraperitoneally with a control antibody (α-IgG; 10 mg/kg; BioLegend, Catalog #400559, Clone RTK3758) or an antagonistic antibody against PD-1 (a PD-1; 10 mg/kg; BioLegend, Catalog #114111, Clone RMPI-14) with or without an intratumoral injection of 30 ng ML RR-S2 CDA loaded in PTGFRN-overexpressing exosomes (EXOSTING™). B16F10 tumors are poorly immune cell infiltrated and refractory to checkpoint blockade. The suboptimal dose of 30 ng of EXOSTING™ led to partial tumor reduction, which was amplified by treatment with a PD-1, but not a IgG (
[0518] In a separate study, C57BL/6 mice were inoculated subcutaneously with 1×10.sup.6 B16F10 melanoma cells (n=6 mice per group). Five, eight, 11, and 14 days post-inoculation the mice were injected intraperitoneally with IgG (10 mg/kg) or anti-CD8 antibody (10 mg/kg). Six, nine, and 12 days after the IP administration of the antibodies, the mice were intratumorally treated with Exosomes or ExoSTING (3-3 cAIMPdFSH, 100 ng).
[0519] The mice were treated with a T-cell-depleting a CD8 antibody (10 mg/kg; BioLegend, Catalog #100769, Clone 53-6.7) prior to intratumoral administration of EXOSTING™ (3_3 cAIMPdFSH) according to the schematic shown in
[0520] In a separate study, C57BL/6 mice Groups (n=5 for each time point) were treated intratumorally with PBS (day 8 only), 0.2 μg ML RR-S2 CDA (days 5 and 8), 20 μg ML RR-S2 CDA (days 5 and 8), and 0.2 μg exoSTING (days 5 and 8). 48 hours after the injection on day 8, tumors and spleens were isolated and dissociated into single cell suspensions utilizing Miltenyi mouse digestions kits (CAT #130-096-730 and 130-095-926, respectively) following the manufacturer's suggested protocol on a gentleMACS instrument. Cells were filtered, washed twice, and then subjected to flow cytometry analysis or culture for ELISPOT to detect specific reactivity against antigens from the B16F10 tumor cells. ELISPOT was carried out using the Mabtech Mouse IFNγ ELISpot PLUS (HRP) according to the manufacturer's protocol. Briefly, 5×10.sup.5 splenocytes were incubated with 10 g/ml of three B16F10 peptides, namely GP100 amino acids 25-33 (AnaSpec, Catalog #AS-62589), Tyrosinase amino acids 368-376 (AnaSpec, Catalog #AS-61456), and TRP2 amino acids 180-188 (AnaSpec, Catalog #AS-61058). As shown in
Example 16: Exosomal PTGFRN Levels Correlate with the Potency of Exosomes Loaded with STING Agonists
[0521] The results in Examples 3 and 13 suggest that PTGFRN overexpression enhances the activity of STING Agonist-loaded exosomes. To determine if PTGFRN levels correlate with EXOSTING™ activity, HEK293SF cells were genetically engineered by CRISPR/Cas9 to delete the endogenous PTGFRN loci (as described in International Patent Application No. PCT/US2018/048026). Exosomes were purified from WT HEK293SF cells (WT Exo), PTGFRN overexpressing HEK293SF cells (PTGFRN O/E Exo) and PTGFRN knockout cells (PTGFRN KO Exo) and loaded with 3-3 cAIMPdFSH as described above. Compared to soluble 3-3 cAIMPdFSH, all EXOSTING™ formulations were more potent activators of IFNβ production in PBMC cultures (n=2 replicates). Interestingly, PTGFRN O/E EXOSTING™ was the most potent activator of IFNβ and resulted in the greatest C.sub.max of the EXOSTING™ formulations. WT EXOSTING™ was attenuated compared to PTGFRN O/E EXOSTING™, and PTGFRN KO EXOSTING™ resulted in the mildest IFNβ response (
Example 17: Exosomes Loaded with STING Agonists Are Engulfed by Antigen Presenting Cells and Are Not Toxic to Tumor-Resident Immune Effector Cells
[0522] Constitutive activation of the STING pathway results in robust pro-inflammatory signaling and may be toxic to cells and tissues (N Engl J Med. 2014 Aug. 7; 371(6): 507-518). Non-selective delivery of STING agonists in a tumor microenvironment may result in a robust IFNβ response, but if response is too strong or originates in undesired cell populations, effector cells such as CD8.sup.+ T-cells may be killed or otherwise attenuated. B16F10 melanoma tumors were injected with PTGFRN-overexpressing exosomes labeled with Alexa Fluor™ 488 and removed one hour post-injection. Tumor-infiltrating lymphocytes were purified and measured for fluorescence at 488 nm to track exosome uptake. Only ˜20% of T-cells engulfed exosomes, while ˜90% and ˜70% of macrophages and dendritic cells, respectively, engulfed exosomes (
Example 18: High-Resolution Imaging of Intratumorally Administered STING Agonist-Loaded Exosomes Demonstrate Increased Potency and Reduced Toxicity Compared to Free STING Agonist
[0523] The measurements of EXOSTING™ activity shown in the previous examples demonstrate that exosomes, particularly PTGFRN-overexpressing exosomes, can enhance the activity of STING agonist molecules. The bulk measurements, from homogenized tissues or isolated serum, provide meaningful data on the potency and selectivity of EXOSTING™ in various applications, but do not allow for direct comparison between samples in the same tumor or to the local effects at the site of injection. To answer this question a microdosing intratumoral injection study was completed using a multi-injector apparatus (CIVO®; Presage Biosciences, Seattle, Wash.). As described in the Methods above, A20 lymphoma cells were implanted subcutaneously in mice and injected simultaneously with up to six different agents. Single dose injections were done with 2 g free ML RR-S2 CDA, 200 ng ML RR-S2 CDA, PTGFRN overexpressing exosomes, wild-type exosomes containing 20 ng ML RR-S2 CDA, or PTGFRN overexpressing exosomes containing 20 ng of ML RR-S2 CDA. Tumors were collected at four hours and 24 hours post-injection, processed, and stained for the presence of IFNβ mRNA (by in situ hybridization) and cleaved caspase 3 protein (Jackson Immunoresearch, antibody #111-605-144). At four hours post-injection, IFNβ levels were comparable between the high dose STING agonist and the PTGFRN O/E EXOSTING™ groups, and much higher than the low dose free STING agonist or empty exosome groups (
[0524] In another study, single dose injections were done with 2 g free 3-3 cAIMPdFSH, 20 ng free 3-3 cAIMPdFSH, 0.4 ng, 2.2 ng, 6.6 ng, or 20 ng of 3-3 cAIMPdFSH loaded in PTGFN-overexpressing exosomes into A20 tumors. Tumors were collected at four hours post-injection, processed, stained for the presence of IFNβ or CXCL10 mRNA (by in situ hybridization), and radial response analysis was conducted. IFNβ (
Example 19: Comparative Potency of Different Exosome-Encapsulated Cyclic Dinucleotides or Non-Cyclic Dinucleotides STING Agonist
[0525] HEK293SF cells overexpressing PTGFRN were grown in shake flasks and the resulting exosomes were purified by Optiprep™ density gradient ultracentrifugation as described in the Methods. The purified exosomes were loaded with STING agonists including ML RR-S2 CDA, 2-3 cGAMP, 3-3 cAIMPdFSH, 3-3 cAIM(PS)2, cAIMPmFSH, cAIMPdF, cAIMP, CP214, CP201, and CP204 according to the methods in Example 1. The 3-3 cAIMPdFSH, 3-3 cAIM(PS)2, cAIMPdF, cAIMP correspond to compound 53, 13, 52, and 51 from a paper (J Med Chem. 2016 Nov. 23; 59(22):10253-10267), respectively. The CP214 is 2-3 cAMPmFSH. The CP201 and CP204 are analogues of compounds from patent WO2017/175156 and WO2017/175147, respectively. Loading was quantified as described in Example 1. The exosome-encapsulated or free STING agonists were added to human PBMCs and incubated at 37° C. overnight. Activation of PBMCs by the STING agonists was detected by measuring the amount of IFNβ in the supernatant. As shown in
Example 20: In Vivo Potency of Free STING Agonists Compared to Exosome-Encapsulated STING Agonists in Tumor-Bearing Mice (C57BL/6) and STING Knock-Out Mice (C57BL/6-Tmem173′)
[0526] Three groups of C57BL/6 mice and C57BL/6-Tmem173.sup.gt mice (4-5 mice per group) were inoculated subcutaneously with 1×10.sup.6 B16F10 tumor cells. Eight days post-inoculation the mice were injected with a single intratumoral dose of PBS, 20 μg of free 3-3 cAIMPdFSH, or 0.1 μg of 3-3 cAIMPdFSH loaded in PTGFN-overexpressing exosomes (exeSTING). Four hours post-injection the tumors, draining lymph nodes, spleens, and serum were collected and cytokine levels were measured. IFNβ gene expression levels in the tumors (
[0527] To confirm that the effects observed in
Example 21: Comparative In Vivo Efficacy of STING Agonist-Loaded Exosomes and Free STING Agonist in an Advanced Murine Model of Melanoma
[0528] Previous data (
Example 22: Anti-Tumor Efficacy in a Model of Murine Colorectal Cancer Model
[0529] To test and expand in vivo efficacy to other types of tumors, BALB/c mice were inoculated subcutaneously with 5×10.sup.5 CT26.CL25 cells (ATCC®; CRL-2639™), a murine colorectal cancer cell line engineered to stably express beta-galactosidase, or 5×10.sup.5 CT26.WT cells (ATCC®; CRL-2638™) (n=5-7 mice per group). Thirteen, sixteen, and nineteen days post-inoculation the mice were injected intratumorally into CT26.CL25 tumor with exosomes, 0.012 μg of free 3-3 cAIMPdFSH, or 0.012 μg-3 cAIMPdFSH loaded in PTGFRN-overexpressing exosomes and into CT26.WT tumor with PBS, exosomes, 100 μg of free ML RR-S2 CDA, or 0.2 μg-3 cAIMPdFSH loaded in PTGFRN-overexpressing exosomes. Similar to the effects observed in the B16F10 model (
Example 23: Comparative In Vivo Abscopal Efficacy of STING Agonist-Loaded Exosomes and Free STING Agonist in a Dual Flank Murine Model of Melanoma Model
[0530] STING pathway activation leads to induce systemic tumor specific T-cell responses, which resulted in abscopal anti-tumor activity (Cell Rep. 2018 Dec. 11; 25(11):3074-3085). In addition, activation of the STING pathway induces the upregulation of immune pathway checkpoints, which subsequently reduce T-cell-mediated cell killing, and thus moderate the effects of STING pathway agonism as a therapeutic rationale (Cell Rep. 2015 May 19; 11(7):1018-30). To test both hypotheses, C57BL/6 mice were inoculated subcutaneously with 1×10.sup.6 and 5×10.sup.5 B16F10 murine melanoma cells into right and left flank of mice, respectively (n=5 mice per group). Seven, ten, and thirteen days post-inoculation, the tumor at right flank were injected intratumorally with exosomes, 20 μg of free 3-3 cAIMPdFSH, 0.1 μg of free 3-3 cAIMPdFSH, or 0.1 μg 3-3 cAIMPdFSH loaded in PTGFRN-overexpressing exosomes, with a control antibody (α-IgG; 10 mg/kg; BioLegend, Catalog #400559, Clone RTK3758) or an antagonistic antibody against PD-1 (a PD-1; 10 mg/kg; BioLegend, Catalog #114111, Clone RMPI-14). Antibodies were injected intraperitoneally. Tumor volumes were measured daily until day 21, and animals were sacrificed when tumor volume reached 2000 mm.sup.3. In the injected tumor, compared to exosomes control group (both with IgG or Anti-PD1), tumor growth was moderately potentiated after treatment with both 0.1 μg free STING agonist+IgG and 0.1 μg free STING agonist+Anti-PD1. Almost completely eliminated upon treatment with 20 μg free STING agonist and 0.1 μg of EXOSTING™ was observed regardless of anti-PD1 (
Example 24: Tumor Pharmacokinetics Analysis of STING Agonist-Loaded Exosomes and Free STING Agonist in a Murine Model of Melanoma
[0531] To examine the tumor pharmacokinetics of STING agonist, C57BL/6 mice were inoculated subcutaneously with 1×10.sup.6 B16F10 murine melanoma cells (n=3 mice per group and time). Eight days post-inoculation, the tumors were injected intratumorally with 30 μg of free 3-3 cAIMPdFSH, 0.3 μg of free 3-3 cAIMPdFSH, or 0.3 μg 3-3 cAIMPdFSH loaded in PTGFRN-overexpressing exosomes. Five minutes, thirty minutes, two hours, 6 hours, 24 hours, and 48 hours after injection, tumors were excised and lysed with 6 volume of plasma. The concentration of 3-3 cAIMPdFSH was measured by LC-MS/MS, as described in Example 1. Free 3-3 cAIMPdFSH in both 30 μg and 0.3 μg was disappeared quickly from tumor, having half-life of around 10 minutes. Surprisingly, half-life of 3-3 cAIMPdFSH was greatly enhanced (˜120 minutes) when delivered by exosomes (
Example 25: Pharmacokinetics Analysis of STING Agonist-Loaded Exosomes and Free STING Agonist in Mouse Plasma
[0532] To examine the pharmacokinetics of STING agonist in mouse plasma, naïve C57BL/6 mice were injected intravenously with 20 μg of free 3-3 cAIMPdFSH, or 0.1 μg, 0.3 μg, 0.6 μg 3-3 cAIMPdFSH loaded in PTGFRN-overexpressing exosomes. One, five, ten, and thirty minutes injection, blood was taken, and plasma were prepared. The concentration of 3-3 cAIMPdFSH was measured by LC-MS/MS, as described in Example 1. Free 3-3 cAIMPdFSH was disappeared quickly from circulation, having half-life of 1.2 minutes (
Example 26: Comparative In Vivo Activity of STING Agonist-Loaded Exosomes and Free STING Agonist in Mouse after Intravenous Injection
[0533] To compare in vivo activity of free STING agonist and STING agonist-loaded exosomes beyond intratumoral dosing, naïve C57BL/6 mice were injected intravenously with 20 μg of free 3-3 cAIMPdFSH or 0.2 μg 3-3 cAIMPdFSH loaded in PTGFRN-overexpressing exosomes. Thirty minutes, two hours, six hours, and twenty-four hours after injection, livers, spleens and serum were collected and cytokine levels were measured. Surprisingly, all cytokine gene expression levels that have been tested here including IFNβ, CXCL9, CXCL10, IFNγ were significantly higher in 0.2 μg EXOSTING™, compared to 20 g free STING agonist, in liver (
Example 27: Comparative In Vivo Activity of STING Agonist-Loaded Exosomes and Free STING Agonist in Mouse after Subcutaneous Injection
[0534] To compare in vivo activity of free STING agonist and STING agonist-loaded exosomes beyond intratumoral dosing, naïve C57BL/6 mice were injected subcutaneously with PBS, exosomes, 20 μg of free 3-3 cAIMPdFSH or 0.2 μg 3-3 cAIMPdFSH loaded in PTGFRN-overexpressing exosomes. Four hours post-injection, lymph nodes, spleens, livers, and serum were collected and cytokine levels were measured. IFNβ gene expression levels in the lymph nodes (
Example 28: In Vivo Potency and Systemic Effects of Free STING Agonists Compared to Exosome-Encapsulated STING Agonists in Tumor-Bearing Mice
[0535] Four groups of C57BL/6 mice (5 mice per group) were inoculated subcutaneously with 1×10.sup.6 B16F10 tumor cells. Eight days post-inoculation the mice were injected intratumorally with dose of exosomes, 20 μg of free 3-3 cAIMPdFSH, 0.1 μg of free 3-3 cAIMPdFSH, or 0.1 μg of 3-3 cAIMPdFSH loaded in PTGFN-overexpressing exosomes (EXOSTING™). Half of the mice were injected again intratumorally at day 11 after the inoculation. Four- or 24-hours post-injection of each injection, the tumors were collected, cytokine levels were measured by in situ hybridization, and CD8 or F4/80 positive cells were counted by immunohistochemistry. Tumor area and stroma area were identified histologically. IFNβ gene expression levels in the tumor (
Example 29: Comparative In Vivo Efficacy of STING Agonist-Loaded Exosomes and Free STING Agonist in a Murine Model of Melanoma to Show Durable T Cell Responses
[0536] The results of the previous Example 9 suggest that EXOSTING™ that loaded with ML RR-S2 CDA exhibited the durable T cell responses that block the growth of re-challenged tumor. Here, to determine whether EXOSTING™ that loaded with 3-3 cAIMPdFSH exhibit same responses, C57BL/6 mice were inoculated subcutaneously with 1×10.sup.6 B16F10 murine melanoma cells (n=5˜10 mice per group). Six, nine, and twelve days post-inoculation, the tumors were injected intratumorally with PBS, exosomes, 100 μg of free ML RR-S2 CDA, or 0.2 μg 3-3 cAIMPdFSH loaded in PTGFRN-overexpressing exosomes.
INCORPORATION BY REFERENCE
[0537] All publications, patents, patent applications and other documents cited in this application are hereby incorporated by reference in their entireties for all purposes to the same extent as if each individual publication, patent, patent application or other document were individually indicated to be incorporated by reference for all purposes.
EQUIVALENTS
[0538] The present disclosure provides, inter alia, compositions of exosomes encapsulating STING agonists for use as therapeutics. The present disclosure also provides methods of producing exosomes encapsulating STING agonists and methods of administering such exosomes as therapeutics. While various specific embodiments have been illustrated and described, the above specification is not restrictive. It will be appreciated that various changes can be made without departing from the spirit and scope of the invention(s). Many variations will become apparent to those skilled in the art upon review of this specification.