ORAL VACCINES EXPRESSED IN YEAST FOR COVID-19

20210322540 · 2021-10-21

    Inventors

    Cpc classification

    International classification

    Abstract

    Nucleic acid constructs for heterologous expression of a SARS-CoV-2 antigen on the surface of a yeast cell and related polypeptides, recombinant yeast cells, vaccine compositions, oral dosage formulations, and methods of inducing antigen-specific immune response to SARS-CoV-2.

    Claims

    1. A nucleic acid construct for heterologous expression of a SARS CoV-2 antigen on the surface of a yeast cell, the nucleic acid construct comprising: (a) a promoter element active in a yeast cell; and (b) one or more heterologous polynucleotides encoding (i) one or more SARS-CoV-2 antigens and (ii) a yeast surface display polypeptide or fragment thereof, wherein the one or more heterologous polynucleotides are operably linked to the promoter element.

    2. The nucleic acid construct of claim 1, wherein the one or more SARS-CoV-2 antigens are from the SARS-CoV-2 S protein.

    3. The nucleic acid construct of claim 2, wherein the polynucleotide encodes a polypeptide having at least 75% sequence identity to the amino acid sequence set forth in SEQ ID NO: 4.

    4. The nucleic acid construct of claim 2, wherein the one or more SARS-CoV-2 antigens are from the SARS-CoV-2 S1 subunit.

    5. The nucleic acid construct of claim 4, wherein the polynucleotide encodes a polypeptide having at least 75% sequence identity to the amino acid sequence set forth in SEQ ID NO: 5.

    6. The nucleic acid construct of claim 4, wherein the one or more SARS-CoV-2 antigens are from the SARS-CoV-2 RBD.

    7. The nucleic acid construct of claim 6, wherein the polynucleotide encodes a polypeptide having at least 75% sequence identity to the amino acid sequence set forth in SEQ ID NO: 6.

    8. The nucleic acid construct of claim 1, wherein the yeast surface display polypeptide is an a-agglutinin polypeptide or fragment thereof.

    9. The nucleic acid construct of claim 8, wherein the a-agglutinin polypeptide or fragment thereof is an Aga2 peptide.

    10. The nucleic acid construct of any one of claim 1, wherein the one or more heterologous polynucleotides encode a polypeptide having the yeast surface display polypeptide at a first terminus and a signal peptide at a second terminus, and wherein cleavage of the signal peptide results in a mature polypeptide having the SARS-CoV-2 antigen at the second terminus.

    11. The nucleic acid construct of claim 10, wherein the one or more heterologous polynucleotides encodes a polypeptide comprising, in the N.fwdarw.C direction: (a) an Aga2 signal peptide; (b) the one or more SARS-CoV-2 antigens; (c) a linker peptide sequence; and (d) an Aga2 peptide; wherein cleavage of the Aga2 signal peptide results in a mature polypeptide having the SARS-CoV-2 antigen at the N-terminus.

    12. The nucleic acid construct of claim 1, wherein the one or more heterologous polynucleotides encodes a polypeptide comprising, in the N.fwdarw.C direction: (a) an Aga2 signal peptide, (b) an Aga2 peptide, (c) a linker peptide, and (d) the one or more SARS-CoV-2 antigens, wherein cleavage of the Aga2 signal peptide results in a mature polypeptide having the Aga2 peptide at the N-terminus.

    13. A nucleic acid construct for heterologous expression of a SARS CoV-2 antigen on the surface of a yeast cell, the nucleic acid construct comprising: (a) a promoter element active in a yeast cell; and (b) one or more heterologous polynucleotides encoding (i) a SARS-CoV-2 antigen; and (ii) a yeast surface display polypeptide or fragment thereof, wherein the one or more heterologous polynucleotides are operably linked to the promoter element, and wherein the one or more heterologous polynucleotides encodes a polypeptide comprising, in the N.fwdarw.C direction: (1) an Aga2 signal peptide having the amino acid sequence of SEQ ID NO: 10; (2) the SARS-CoV-2 antigen; and (3) a polypeptide having the amino acid sequence of SEQ ID NO: 12.

    14. The nucleic acid construct of claim 13, wherein the one or more heterologous polynucleotides encodes a polypeptide consisting of, in the N.fwdarw.C direction: (1) an Aga2 signal peptide having the amino acid sequence of SEQ ID NO: 10; (2) the SARS-CoV-2 antigen; and (3) a polypeptide having the amino acid sequence of SEQ ID NO: 12.

    15. The nucleic acid construct of claim 13, wherein the SARS-CoV-2 antigen comprises a sequence selected from the group consisting of SEQ ID NO: 4, SEQ ID NO: 5, and SEQ ID NO: 6.

    16. The nucleic acid construct of claim 15, wherein the one or more heterologous polynucleotides encodes a polypeptide comprising a sequence as set forth in SEQ ID NO: 13.

    17. The nucleic acid construct of claim 16, wherein the one or more heterologous polynucleotides comprises a sequence at least 99% identical to SEQ ID NO: 20.

    18. The nucleic acid construct of claim 15, wherein the one or more heterologous polynucleotides encodes a polypeptide comprising a sequence as set forth in SEQ ID NO: 14.

    19. The nucleic acid construct of claim 18, wherein the one or more heterologous polynucleotides comprises a sequence at least 99% identical to SEQ ID NO: 21.

    20. The nucleic acid construct of claim 15, wherein the one or more heterologous polynucleotides encodes a polypeptide comprising a sequence as set forth in SEQ ID NO: 15.

    21. The nucleic acid construct of claim 20, wherein the one or more heterologous polynucleotides comprises a sequence at least 99% identical to SEQ ID NO: 22.

    22. A polypeptide expressed by the nucleic acid construct of claim 1, or a mature version thereof.

    23. A recombinant yeast comprising the nucleic acid construct of claim 1.

    24. The recombinant yeast of claim 23, wherein the recombinant yeast displays the one or more SARS-CoV-2 antigens on its cell surface.

    25. The recombinant yeast of claim 24, wherein the one or more SARS-CoV-2 antigens is from the SARS-CoV-2 S protein.

    26. The recombinant yeast of claim 25, wherein the one or more SARS-CoV-2 antigens is from the SARS-CoV-2 S1 subunit.

    27. The recombinant yeast of claim 26, wherein the one or more SARS-CoV-2 antigens is from the SARS-CoV-2 RBD.

    28. A vaccine composition comprising an effective amount of the recombinant yeast of claim 23, or an extract thereof.

    29. An oral dosage formulation comprising the vaccine composition of claim 28.

    30. A method of inducing an antigen-specific immune response to SARS-CoV-2 in a subject, comprising administering to the subject an effective amount of a vaccine composition of claim 28.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0029] FIG. 1 is a schematic showing the elements of a polypeptide expressed from a nucleic acid construct disclosed herein. The depicted construct is based on a pYD5 vector. Amino acid sequences for the Aga2 signal peptide (SEQ ID NO: 10), V5 epitope (SEQ ID NO: 9), (G.sub.4S).sub.3 linker (SEQ ID NO: 12), and Aga2 mature peptide (SEQ ID NO: 7) are shown.

    [0030] FIG. 2 depicts a yeast surface display system that includes a mature polypeptide expressed from a nucleic construct disclosed herein. The mature polypeptide comprises a Aga2 subunit of a-agglutinin, which interacts via disulfide bridges with the Aga1 a-agglutinin subunit expressed on the surface of a yeast cell, such as the EBY100 cell.

    DETAILED DESCRIPTION OF INVENTION

    [0031] Oral administration is a convenient and effective way to deliver a SARS CoV-2 vaccine and to increase the rate of inoculation. Oral vaccines will be more acceptable because of their oral rather than injectable route of administration with reduced risk of cross-contamination, their avoidance of needle injury, and their increased acceptability to the public in general and to children in particular. Indeed, producing the vaccines in plants could reduce the cost to less than a penny per dose, and simple fast food processing like drying and grinding could create non-perishable preparations without refrigeration.

    [0032] Adaptive immunity is the key for efficacy of vaccine-induced immune response although innate immunity is also an essential component of the human immune system. Vaccination-induced pathogen-specific memory B and T lymphocytes, as well as functional molecules produced such as antibodies and cytokines, play important roles against invading bacterial, fungal and viral pathogens in humans.

    [0033] Although the mechanism underlying the interaction between SARS-CoV-2 and host cells needs further investigation, S protein (134.36 KDa) (in particular the S1 subunit (76.5 KDa) of the S protein, and even more in particular the receptor binding domain (RBD) (35.1 KDa) of the S1 subunit) appears to be a major surface antigenic protein of SARS-CoV-2 and involved in the infection process as an attachment protein. Thus, the S protein (in particular the S1 subunit and even more in particular RBD of the S1 subunit) of SARS-CoV-2 may contain preferred antigens for expression in the yeast surface expression system described herein.

    Nucleic Acid Constructs

    [0034] SARS-CoV-2 Antigens

    [0035] As used herein, a “SARS-CoV-2 antigen” refers to a SARS-CoV-2 protein or fragment thereof that is capable of eliciting an immune response, e.g., an antibody response, when introduced into a subject having an adaptive immune system (e.g., a subject such as a mammal, e.g., a human). SARS-CoV-2 antigens may vary in length ranging from short peptides (e.g., 8-20 amino acids in length) to longer peptides to full proteins.

    [0036] The S (spike) protein of SARS-CoV-2 mediates entry of the virus into cells. The S protein is cleaved into the S1 and S2 subunits. The S1 subunit contains a receptor-binding domain (RBD) that specifically recognizes angiotensin-converting enzyme 2 (ACE2), SARS-CoV-2's receptor on cells.

    [0037] In some embodiments, the SARS-CoV-2 antigen is from (e.g., contained within) the SARS-CoV-2 S protein. In some such embodiments, the SARS-CoV-2 antigen is from the S1 subunit of the S protein. In some embodiments, or from the receptor binding domain (RBD) of the S1 subunit.

    [0038] Yeast Surface Display Polypeptides

    [0039] As used herein, a “yeast surface display polypeptide” is a polypeptide that forms part of a yeast surface display system. Yeast surface display systems generally comprise at least one protein or protein subunit that serves as an anchor on the yeast cell wall. In some embodiments, the anchor is fused directly or indirectly to the SARS-CoV-2 antigen. In some embodiments, the anchor interacts with another protein or protein subunit of the yeast surface display system, and the other protein or protein subunit is fused directly or indirectly to the SARS-CoV-2 antigen. This interaction may be, for example, a covalent interaction (e.g., via one or more disulfide bridges) or non-covalent interaction (e.g., binding).

    [0040] Thus, in many embodiments, the heterologous polynucleotide encodes a polypeptide in which the SARS-CoV-2 antigen is fused to the yeast surface display polypeptide directly or via indirectly (e.g., with one or more intervening elements, such as a linker and/or a tag).

    [0041] Non-limiting examples of yeast surface display systems include proteins that are members of glycosylphosphatidylinositol (GPI)-anchored proteins and members of the proteins with internal repeats (PIR) family. Thus, for example, suitable yeast surface display systems include, but are not limited to, agglutinin systems (e.g., an a-agglutinin (Aga1p/Aga2p)), Dan4p systems, Sed1p systems, flocculin systems (e.g., comprising Flo1p), cell wall protein systems (e.g., comprising Cw1p, Cwp2p, or Tip1p), and PIR-based systems (e.g., comprising Pir1p Pir2p, Pir3p, Pir4p, or Pir5p).

    [0042] In some embodiments, the yeast surface display polypeptide is part of the a-agglutinin system, e.g., the yeast surface display polypeptide may be the Aga2 subunit. FIG. 2 shows a schematic of an exemplary yeast surface display system displaying a SARS-CoV-2 antigen.

    [0043] Fragments of yeast surface polypeptides, e.g., functional fragments, may also be used. By “functional” for the purposes of the yeast display system, it is meant that the fragment either (1) is capable of being anchored into the yeast cell wall or (2) is capable of interacting with a polypeptide or polypeptide fragment that is capable of being anchored into the yeast cell wall. In some embodiments, a fragment comprises a functional subunit of a protein.

    Polypeptides

    [0044] Also disclosed are polypeptides that are expressed by nucleic acid constructs disclosed herein (e.g., after introduction into a yeast cell) or a mature version thereof. For example, a polypeptide may be expressed in an immature form comprising one or more components (e.g., signal peptides) whose removal (e.g., by cleavage) results in a mature form of the polypeptide. Provided polypeptides generally comprise at least a SARS-CoV-2 antigen and a yeast surface display polypeptide. One or more additional elements (e.g., tags, linkers, etc.) may also be included. In some such embodiments, one or more additional elements intervene between the SARS-CoV-2 antigen and the surface display polypeptide. In some embodiments, after maturation (such as cleavage of a signal peptide), the SARS-CoV-2 antigen is located at one terminus (e.g., the N-terminal end or the C-terminal end) of the polypeptide.

    [0045] FIG. 1 shows the schematic of an exemplary polypeptide before maturation (e.g., including a signal peptide).

    Recombinant Yeast

    [0046] Methods of introducing nucleic acid constructs into host yeast strains, thereby generating recombinant yeast strains, are known in the art.

    [0047] Recombinant yeast comprising a nucleic acid construct or polypeptide as disclosed herein may be generated using any of a variety of yeast strains, including, for example, S. cerevisiae strains and methylotropic strains such as Pichia pastoris and Hansenula polymorpha strains. In some embodiments, the yeast strain either naturally expresses or is engineered to express a second yeast surface display polypeptide (that is, in addition to the yeast surface display polypeptide). The second yeast surface display polypeptide may interact (e.g., covalently or non-covalently bind) to a first yeast surface display polypeptide expressed from a nucleic acid construct disclosed herein. In some embodiments, the second yeast surface display polypeptide is inducibly expressed, e.g., by way of being operably linked to an inducible promoter such as a GAL promoter. For example, the yeast strain may be the S. cerevisiae EBY100 strain, which has a genomic insertion of a gene encoding Aga1 (a component of the agglutinin yeast surface display system) regulated by the Gal promoter with a URA3 selectable marker.

    Vaccine Compositions

    [0048] Provided vaccine compositions comprise a recombinant yeast cell as described herein, and/or an extract thereof. Methods of preparing yeast extracts are known in the art, and such methods generally involve causing degrading of the cell wall. For example, some methods comprise heating a suspension of a recombinant yeast cell, which may lead to yeast enzymes degrading the cell wall.

    [0049] Extracts included in a provided vaccine compositions generally comprise a polypeptide comprising a SARS-CoV-2 antigen or a fragment thereof. Polypeptides expressed from nucleic acid constructs disclosed herein may or may not be fragmented, at least partially denatured, or otherwise altered during the process of extraction. Such altered polypeptides may nevertheless function as components of vaccine compositions in that they may nevertheless elicit immune responses.

    [0050] In some embodiments, provided vaccine compositions comprise one or more adjuvants, substances which accelerate, enhance, and/or prolong immune responses triggered by antigens. A variety of adjuvants known in the art are suitable for use in mammals including humans.

    [0051] In some embodiments, the composition lacks an adjuvant.

    Oral Dosage Formulations

    [0052] Provided oral dosage formulations include both solid and non-solid (e.g., liquid or gel) formulations. Generally, in addition to a vaccine composition provided herein, provided formulations include one or more excipients. Suitable excipients for solid oral dosage formulations are known in the art, and include, for example, binders and fillers, coatings, lubricants, matrix formers, and disintegrants.

    [0053] Liquid or gel formulations may be in aqueous or non-aqueous form, and, for example, in monophasic form or biphasic form (e.g., suspensions, emulsions, and mixtures).

    [0054] In some embodiments, oral dosage formulations include one or more flavoring agents.

    Methods of Inducing an Antigen-Specific Immune Response to SARS-CoV-2

    [0055] Provided methods generally comprise a step of administering an effective amount of a vaccine composition or an oral dosage formulation to a subject. By “effective amount” is meant an amount sufficient to effect beneficial or desired results, such as an antigen-specific immune response. An “effective amount” depends upon the context in which it is being applied. An effective amount may be administered by administering a single dose or multiple (e.g., at least two, or at least three) doses.

    [0056] In some embodiments, the step of administering comprises administering a single dose without administering additional doses. In some embodiments, the step of administering comprises administering an initial dose followed by one or more booster doses.

    [0057] The subject may be, e.g., a mammal (such as a human or non-human mammal).

    [0058] In some embodiments, the subject has no existing immunity against SARS-CoV-2 at the time of administration.

    [0059] In some embodiments, the subject has some existing immunity to SARS-CoV-2. In some embodiments, the existing immunity is deemed insufficient.

    [0060] In some embodiments, the status of the subject's immunity to SARS-CoV-2 is unknown.

    [0061] In some embodiments, the subject has not tested positive for SARS-CoV-2 (e.g., the subject has not tested positive in an RNA test intended to identify active infections). In some embodiments, the subject has not tested positive for antibodies against SARS-CoV-2 (e.g., the subject has not tested positive for antibodies against SARS-CoV-2).

    [0062] In some embodiments, the subject has previously tested positive either for SARS-CoV-2 (e.g., SARS-CoV-2 RNA) or for antibodies against SARS-CoV-2. Administration in these contexts may, for example, provide an immune response to SARS-CoV-2 (if such a response was not previously elicited by exposure to SARS-CoV-2) or to boost a weak (or waned) immune response.

    EXEMPLIFICATION

    Construction of COV-2 Antigen Surface-Displayed Yeast Vaccines

    [0063] The S protein gene (NCBI MN908947) is PCR-amplified using specific primers and subcloned into pYD5 in-frame with the endogenous Aga2p signal peptide sequence. The resultant shuttle plasmid pYD5-S is transformed into E. coli DH5a. Plasmid pYD5-S is then extracted from E. coli, purified and electroporated into competent S. cerevisiae EBY100 after being linearized. Recombinant yeast transformants are plated on selective minimal dextrose plates containing amino acids (0.67% yeast nitrogen base without amino acids (YNB), 2% glucose, 0.01% leucine, 2% agar, and 1 M sorbitol). Trp.sup.+ transformants are selected after 3 days of growth on the selective minimal dextrose plates.

    [0064] Positive colonies are confirmed by genomic PCR. Recombinant S. cerevisiae EBY100/pYD5-S is cultured in YNB-CAA-Glu (0.67% YNB, 0.5 casamino acids, 2% Glucose) and induced in YNB-CAA-Gal (0.67% YNB, 0.5 casamino acids, 2% Galactose, 13.61 g/L Na.sub.2HPO.sub.4, 7.48 g/L NaH.sub.2PO.sub.4 and 5 g/L casamino acids) at 20° C. with shaking (250 rpm) for inducing S surface display. S. cerevisiae EBY 100 carrying pYD5 plasmid serve as a negative control for these tests.

    [0065] Two additional types of vaccines are constructed in this section: S. cerevisiae EBY100/pYD5-S1 surface displayed yeast vaccine S. cerevisiae EBY100/pYD5-RBD surface displayed yeast vaccine.

    Determining the Functional Display of SARS CoV-2 Antigen on Yeast Surface

    [0066] These experiments are designed to validate the functional display of the SARS CoV-2 antigen on yeast surface.

    [0067] Western Blotting

    [0068] 1 OD.sub.600(1 OD.sub.600≈10.sup.7 cells) equivalent recombinant yeast are collected at different time points post inducement with 2% galactose. Samples are washed three times with 500 μl of PBS, re-suspended in 50 μl of 6×SDS loading buffer (Bio-Rad, Hercules, Calif.), and boiled for 10 min. Surface-presented S protein are extracted by heating 1 OD.sub.600 of S. cerevisiae EBY100/pYD5-S pellets at 95° C. in a Bromophenol blue sample buffer supplemented with 5%-ME for 5 min. Samples are then resolved on a 4-15% SDS-PAGE gel (Bio-Rad), and transferred to 0.45 um nitrocellulose membranes (Bio-Rad). After blocking with 5% non-fat milk at room temperature for 2 h, membranes are incubated with monoclonal mouse anti-S antibody (Sino Biological, Beijing, China) as primary antibody (1:500 diluted). After incubation overnight at 4° C. and washed three times using PBS buffer, the membranes are reacted to secondary antibodies, horseradish peroxidase (HRP)-conjugated rabbit anti-mouse IgG (1:5,000 diluted) (Sigma-Aldrich Co., St. Louis, Mo.) for 1 hour at room temperature. Signals are generated using West Pico chemiluminescent substrates (Thermo Fisher Scientific Inc., Rockford, Ill.) and detected using a ChemiDoc XRS System (Bio-Rad).

    [0069] Similar methods may be used for the following yeast vaccines S. cerevisiae EBY100/pYD5-S1 and -RBD.

    [0070] Glycosylation Analysis of One or More Yeast Surface Displayed COV-2 Antigens

    [0071] PNGase F is obtained from New England Labs (Beverly, Mass.). Recombinant S. cerevisiae EBY100/pYD5-S, S. cerevisiae EBY100/pYD5-S1, or S. cerevisiae EBY100/pYD5-RBD are cultured at 30° C. in YNB-CAA-Glu overnight and then induced at 20° C. in YNB-CAA-Gal for 72 hours. 1 OD.sub.600 equivalent cells are collected, centrifuged, and washed once in a PBS buffer. Cell pellets are denatured at 100° C. for 10 min in a denaturing buffer included in the PNGase F reagent. A portion of 1 μL of PNGase F (5,000 U) is added to the denatured protein solution, followed by incubation at 37° C. for 1 hour according to the manufacturer's instruction. The treated samples are then be subjected to Western blotting analysis.

    [0072] Immunofluorescence Microscopy

    [0073] To detect S display on yeast surface, recombinant S. cerevisiae EBY100/pYD5-S are collected in a 24-hour interval over a 72-hour time period after inducement with galactose (2%). 1 OD.sub.600 equivalent recombinant yeast is collected and blocked with 5% non-fat milk in PBS for 1 hour, and incubated with monoclonal mouse anti-S antibodies (1:500 diluted) at 4° C. for 1 hour. After washing with PBS, samples are incubated with rabbit anti-mouse IgG FITC conjugates (Sigma) (1:5,000 diluted) at room temperature for 1 h. Samples are kept in the dark until use. FITC-labeled yeast are examined under an inverted phase contrast fluorescence microscope.

    [0074] To detect S1 display on yeast surface, recombinant S. cerevisiae EBY100/pYD5-S1 cells are collected in a 24-hour interval over a 72-hour time period after inducement with galactose (2%). 1 OD.sub.600 equivalent recombinant yeast are collected and blocked with 5% non-fat milk in PBS for 1 hour, and incubated with monoclonal mouse anti-S1 antibodies (1:500 diluted) at 4° C. for 1 hour. After washing with PBS, samples are incubated with rabbit anti-mouse IgG FITC conjugates (Sigma) (1:5,000 diluted) at room temperature for 1 h. Samples are kept in the dark until use. FITC-labeled yeast are examined under an inverted phase contrast fluorescence microscope.

    [0075] To detect RBD displayed on yeast surface, recombinant S. cerevisiae EBY100/pYD5-RBD are collected in a 24-hour interval over a 72-hour time period after inducement with galactose (2%). 1 OD.sub.600 equivalent recombinant yeast are collected and blocked with 5% non-fat milk in PBS for 1 hour, and incubated with monoclonal mouse anti-RBD antibodies (1:500 diluted) at 4° C. for 1 hour. After washing with PBS, samples are incubated with rabbit anti-mouse IgG FITC conjugates (Sigma) (1:5,000 diluted) at room temperature for 1 h. Samples are kept in the dark until use. FITC-labeled yeast are examined under an inverted phase contrast fluorescence microscope.

    [0076] Flow Cytometric Assay

    [0077] After inducement with galactose (2%), 1 OD.sub.600 equivalent recombinant yeast cells are collected over a 72-hour time period, with a 24-hour interval, as described above. Cell samples are washed three times with sterile PBS containing 1% bovine serum albumin (BSA) and incubated with monoclonal mouse anti-S antibodies (1:500 diluted) at 4° C. for 1 hour, followed by reacting with FITC-conjugated goat anti-mouse IgG (1:5,000) at 4° C. for 30 min. Cell samples are re-suspended in 500 μL of sterile PBS and are subject to flow cytometric analysis using a BD FACS Aira II (BD Bioscience, San Jose, Calif.). S. cerevisiae EBY100/pYD5 served as a negative control for the assay. These data are used to ascertain time points that are ideal for collecting yeast vaccines that present the highest level of one or more of the SARS-CoV-2 antigens on their surface.

    [0078] Similar methods are used to determine the functional display for the following yeast vaccines S. cerevisiae EBY100/pYD5-S1 and -RBD.

    Optimization of Oral Immunization

    [0079] Commercial mouse pellet feed weighing 2 g are coated with 3 ml of 1×10.sup.8 pfu/ml of recombinant yeast. The feed is mixed and incubated on ice for 30 min followed by room temperature (RT) incubation for 30 min to allow absorption. The pellets are coated with fish oil to prevent dispersion.

    [0080] Balb/c mice of 25 are divided into 5 groups with 5 in each group. Mice in groups 1-3 are administrated orally with recombinant yeast-S, yeast-S1, or yeast-RBD coated feed, respectively, continuously for 7 days, whereas mice in groups 4-5 are administered orally with PBS or yeast containing empty plasmid coated feed, respectively.

    Assessment of Immune Responses

    [0081] Two weeks after final vaccination, serum of mice are collected, and antibody against S, S1, and RBD are detected by ELISA. Oral vaccination experiments are repeated three times.

    [0082] Based on results from these experiments, the strength and degree of immune protection that can be provided by the yeast vaccines can be evaluated. Further, it can be determined which vaccines provide better immune protection from virus challenge in animal models.

    TABLE-US-00001 SEQUENCES SEQ ID NO: 1 (S gene sequence) 1-atgtttgt ttttcttgtt ttattgccac tagtctctag tcagtgtgtt aatcttacaa ccagaactca attaccccct gcatacacta attctttcac acgtggtgtt tattaccctg acaaagtttt cagatcctca gttttacatt caactcagga cttgttctta cctttctttt ccaatgttac ttggttccat gctatacatg tctctgggac caatggtact aagaggtttg ataaccctgt cctaccattt aatgatggtg tttattttgc ttccactgag aagtctaaca taataagagg ctggattttt ggtactactt tagattcgaa gacccagtcc ctacttattg ttaataacgc tactaatgtt gttattaaag tctgtgaatt tcaattttgt aatgatccat ttttgggtgt ttattaccac aaaaacaaca aaagttggat ggaaagtgag ttcagagttt attctagtgc gaataattgc acttttgaat atgtctctca gccttttctt atggaccttg aaggaaaaca gggtaatttc aaaaatctta gggaatttgt gtttaagaat attgatggtt attttaaaat atattctaag cacacgccta ttaatttagt gcgtgatctc cctcagggtt tttcggcttt agaaccattg gtagatttgc caataggtat taacatcact aggtttcaaa ctttacttgc tttacataga agttatttga ctcctggtga ttcttcttca ggttggacag ctggtgctgc agcttattat gtgggttatc ttcaacctag gacttttcta ttaaaatata atgaaaatgg aaccattaca gatgctgtag actgtgcact tgaccctctc tcagaaacaa agtgtacgtt gaaatccttc actgtagaaa aaggaatcta tcaaacttct aactttagag tccaaccaac agaatctatt gttagatttc ctaatattac aaacttgtgc ccttttggtg aagtttttaa cgccaccaga tttgcatctg tttatgcttg gaacaggaag agaatcagca actgtgttgc tgattattct gtcctatata attccgcatc attttccact tttaagtgtt atggagtgtc tcctactaaa ttaaatgatc tctgctttac taatgtctat gcagattcat ttgtaattag aggtgatgaa gtcagacaaa tcgctccagg gcaaactgga aagattgctg attataatta taaattacca gatgatttta caggctgcgt tatagcttgg aattctaaca atcttgattc taaggttggt ggtaattata attacctgta tagattgttt aggaagtcta atctcaaacc ttttgagaga gatatttcaa ctgaaatcta tcaggccggt agcacacctt gtaatggtgt tgaaggtttt aattgttact ttcctttaca atcatatggt ttccaaccca ctaatggtgt tggttaccaa ccatacagag tagtagtact ttcttttgaa cttctacatg caccagcaac tgtttgtgga cctaaaaagt ctactaattt ggttaaaaac aaatgtgtca atttcaactt caatggttta acaggcacag gtgttcttac tgagtctaac aaaaagtttc tgcctttcca acaatttggc agagacattg ctgacactac tgatgctgtc cgtgatccac agacacttga gattcttgac attacaccat gttcttttgg tggtgtcagt gttataacac caggaacaaa tacttctaac caggttgctg ttctttatca ggatgttaac tgcacagaag tccctgttgc tattcatgca gatcaactta ctcctacttg gcgtgtttat tctacaggtt ctaatgtttt tcaaacacgt gcaggctgtt taataggggc tgaacatgtc aacaactcat atgagtgtga catacccatt ggtgcaggta tatgcgctag ttatcagact cagactaatt ctcctcggcg ggcacgtagt gtagctagtc aatccatcat tgcctacact atgtcacttg gtgcagaaaa ttcagttgct tactctaata actctattgc catacccaca aattttacta ttagtgttac cacagaaatt ctaccagtgt ctatgaccaa gacatcagta gattgtacaa tgtacatttg tggtgattca actgaatgca gcaatctttt gttgcaatat ggcagttttt gtacacaatt aaaccgtgct ttaactggaa tagctgttga acaagacaaa aacacccaag aagtttttgc acaagtcaaa caaatttaca aaacaccacc aattaaagat tttggtggtt ttaatttttc acaaatatta ccagatccat caaaaccaag caagaggtca tttattgaag atctactttt caacaaagtg acacttgcag atgctggctt catcaaacaa tatggtgatt gccttggtga tattgctgct agagacctca tttgtgcaca aaagtttaac ggccttactg ttttgccacc tttgctcaca gatgaaatga ttgctcaata cacttctgca ctgttagcgg gtacaatcac ttctggttgg acctttggtg caggtgctgc attacaaata ccatttgcta tgcaaatggc ttataggttt aatggtattg gagttacaca gaatgttctc tatgagaacc aaaaattgat tgccaaccaa tttaatagtg ctattggcaa aattcaagac tcactttctt ccacagcaag tgcacttgga aaacttcaag atgtggtcaa ccaaaatgca caagctttaa acacgcttgt taaacaactt agctccaatt ttggtgcaat ttcaagtgtt ttaaatgata tcctttcacg tcttgacaaa gttgaggctg aagtgcaaat tgataggttg atcacaggca gacttcaaag tttgcagaca tatgtgactc aacaattaat tagagctgca gaaatcagag cttctgctaa tcttgctgct actaaaatgt cagagtgtgt acttggacaa tcaaaaagag ttgatttttg tggaaagggc tatcatctta tgtccttccc tcagtcagca cctcatggtg tagtcttctt gcatgtgact tatgtccctg cacaagaaaa gaacttcaca actgctcctg ccatttgtca tgatggaaaa gcacactttc ctcgtgaagg tgtctttgtt tcaaatggca cacactggtt tgtaacacaa aggaattttt atgaaccaca aatcattact acagacaaca catttgtgtc tggtaactgt gatgttgtaa taggaattgt caacaacaca gtttatgatc ctttgcaacc tgaattagac tcattcaagg aggagttaga taaatatttt aagaatcata catcaccaga tgttgattta ggtgacatct ctggcattaa tgcttcagtt gtaaacattc aaaaagaaat tgaccgcctc aatgaggttg ccaagaattt aaatgaatct ctcatcgatc tccaagaact tggaaagtat gagcagtata taaaatggcc atggtacatt tggctaggtt ttatagctgg cttgattgcc atagtaatgg tgacaattat gctttgctgt atgaccagtt gctgtagttg tctcaagggc tgttgttctt gtggatcctg ctgcaaattt gatgaagacg actctgagcc agtgctcaaa ggagtcaaat tacattacac ataa-3822 SEQ ID NO: 2 (S1 nucleotide sequence) 1-atgtttgt ttttcttgtt ttattgccac tagtctctag tcagtgtgtt aatcttacaa ccagaactca attaccccct gcatacacta attctttcac acgtggtgtt tattaccctg acaaagtttt cagatcctca gttttacatt caactcagga cttgttctta cctttctttt ccaatgttac ttggttccat gctatacatg tctctgggac caatggtact aagaggtttg ataaccctgt cctaccattt aatgatggtg tttattttgc ttccactgag aagtctaaca taataagagg ctggattttt ggtactactt tagattcgaa gacccagtcc ctacttattg ttaataacgc tactaatgtt gttattaaag tctgtgaatt tcaattttgt aatgatccat ttttgggtgt ttattaccac aaaaacaaca aaagttggat ggaaagtgag ttcagagttt attctagtgc gaataattgc acttttgaat atgtctctca gccttttctt atggaccttg aaggaaaaca gggtaatttc aaaaatctta gggaatttgt gtttaagaat attgatggtt attttaaaat atattctaag cacacgccta ttaatttagt gcgtgatctc cctcagggtt tttcggcttt agaaccattg gtagatttgc caataggtat taacatcact aggtttcaaa ctttacttgc tttacataga agttatttga ctcctggtga ttcttcttca ggttggacag ctggtgctgc agcttattat gtgggttatc ttcaacctag gacttttcta ttaaaatata atgaaaatgg aaccattaca gatgctgtag actgtgcact tgaccctctc tcagaaacaa agtgtacgtt gaaatccttc actgtagaaa aaggaatcta tcaaacttct aactttagag tccaaccaac agaatctatt gttagatttc ctaatattac aaacttgtgc ccttttggtg aagtttttaa cgccaccaga tttgcatctg tttatgcttg gaacaggaag agaatcagca actgtgttgc tgattattct gtcctatata attccgcatc attttccact tttaagtgtt atggagtgtc tcctactaaa ttaaatgatc tctgctttac taatgtctat gcagattcat ttgtaattag aggtgatgaa gtcagacaaa tcgctccagg gcaaactgga aagattgctg attataatta taaattacca gatgatttta caggctgcgt tatagcttgg aattctaaca atcttgattc taaggttggt ggtaattata attacctgta tagattgttt aggaagtcta atctcaaacc ttttgagaga gatatttcaa ctgaaatcta tcaggccggt agcacacctt gtaatggtgt tgaaggtttt aattgttact ttcctttaca atcatatggt ttccaaccca ctaatggtgt tggttaccaa ccatacagag tagtagtact ttcttttgaa cttctacatg caccagcaac tgtttgtgga cctaaaaagt ctactaattt ggttaaaaac aaatgtgtca atttcaactt caatggttta acaggcacag gtgttcttac tgagtctaac aaaaagtttc tgcctttcca acaatttggc agagacattg ctgacactac tgatgctgtc cgtgatccac agacacttga gattcttgac attacaccat gttcttttgg tggtgtcagt gttataacac caggaacaaa tacttctaac caggttgctg ttctttatca ggatgttaac tgcacagaag tccctgttgc tattcatgca gatcaactta ctcctacttg gcgtgtttat tctacaggtt ctaatgtttt tcaaacacgt gcaggctgtt taataggggc tgaacatgtc aacaactcat atgagtgtga catacccatt ggtgcaggta tatgcgctag ttatcagact cagactaatt ctcct-2043 SEQ ID NO: 3 (RBD nucleotide sequence) 988-c ctaatattac aaacttgtgc ccttttggtg aagtttttaa cgccaccaga tttgcatctg tttatgcttg gaacaggaag agaatcagca actgtgttgc tgattattct gtcctatata attccgcatc attttccact tttaagtgtt atggagtgtc tcctactaaa ttaaatgatc tctgctttac taatgtctat gcagattcat ttgtaattag aggtgatgaa gtcagacaaa tcgctccagg gcaaactgga aagattgctg attataatta taaattacca gatgatttta caggctgcgt tatagcttgg aattctaaca atcttgattc taaggttggt ggtaattata attacctgta tagattgttt aggaagtcta atctcaaacc ttttgagaga gatatttcaa ctgaaatcta tcaggccggt agcacacctt gtaatggtgt tgaaggtttt aattgttact ttcctttaca atcatatggt ttccaaccca ctaatggtgt tggttaccaa ccatacagag tagtagtact ttcttttgaa cttctacatg cacca-1563 SEQ ID NO: 4 (S full length protein sequence) MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHA IHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQ FCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYF KIYSKHTKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAY YVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNI TNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADS FVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFER DISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNL VKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITP GTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIG AGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKT SVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFN FSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDE MIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQ DSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQ SLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVP AQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNT VYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQEL GKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKL HYT SEQ ID NO: 5 (S1 full length protein sequence) MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHA IHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQ FCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYF KIYSKHTKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAY YVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNI TNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADS FVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFER DISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNL VKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITP GTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIG AGICASYQTQTNSP SEQ ID NO: 6 (RBD full length protein sequence) PNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVY ADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKP FERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAP SEQ ID NO: 7 (Aga2 mature peptide) QELTTICEQIPSPTLESTPYSLSTTTILANGKAMQGVFEYYKSVTFVSNCGSHPSTTSKGSPINTQY VF SEQ ID NO: 8 (Aga1 protein) MTLSFAHFTYLFTILLGLTNIALASDPETILVTITKTNDANGVVTTTVSPALVSTSTIVQAGTTTLY TTWCPLTVSTSSAAEISPSISYATTLSRFSTLTLSTEVCSHEACPSSSTLPTTTLSVTSKFTSYICP TCHTTAISSLSEVGTTTVVSSSAIEPSSASIISPVTSTLSSTTSSNPTTTSLSSTSTSPSSTSTSPS STSTSSSSTSTSSSSTSTSSSSTSTSPSSTSTSSSLTSTSSSSTSTSQSSTSTSSSSTSTSPSSTST SSSSTSTSPSSKSTSASSTSTSSYSTSTSPSLTSSSPTLASTSPSSTSISSTFTDSTSSLGSSIASS STSVSLYSPSTPVYSVPSTSSNVATPSMTSSTVETTVSSQSSSEYITKSSISTTIPSFSMSTYFTTV SGVTTMYTTWCPYSSESETSTLTSMHETVTTDATVCTHESCMPSQTTSLITSSIKMSTKNVATSVST STVESSYACSTCAETSHSYSSVQTASSSSVTQQTTSTKSWVSSMTTSDEDFNKHATGKYHVTSSGTS TISTSVSEATSTSSIDSESQEQSSHLLSTSVLSSSSLSATLSSDSTILLFSSVSSLSVEQSPVTTLQ ISSTSEILQPTSSTAIATISASTSSLSATSISTPSTSVESTIESSSLTPTVSSIFLSSSSAPSSLQT SVTTTEVSTTSISIQYQTSSMVTISQYMGSGSQTRLPLGKLVFAIMAVACNVIFS SEQ ID NO: 9 (V5 epitope tag) GKPIPNPLLGLDST SEQ ID NO: 10 (Aga2 signal peptide) MQLLTCFSIFSVIASVLA SEQ ID NO: 11 ((G.sub.4S).sub.3 linker) GGGGSGGGGSGGGGS SEQ ID NO: 12 (right flank of pYD5-based construct shown in FIG. 1) EFGKPIPNPLLGLDSTGGGGSGGGGSGGGGSQELTTICEQIPSPTLESTPYSLSTTTILANGKAMQG VFEYYKSVTFVSNCGSHPSTTSKGSPINTQYVF SEQ ID NO: 13 (amino acid sequence encoded by the construct shown in FIG. 1, using full S protein as the SARS-CoV-2 antigen) MQLLTCFSIFSVIASVLAMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLH STQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQS LLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQ GNFKNLREFVFKNIDGYFKIYSKHTKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRS YLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQ TSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYG VSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGN YNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSF ELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTL EILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGC LIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPT NFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFA QVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLI CAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLY ENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRL DKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMS FPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTD NTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDR LNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGS CCKFDEDDSEPVLKGVKLHYTEFGKPIPNPLLGLDSTGGGGSGGGGSGGGGSQELTTICEQIPSPTL ESTPYSLSTTTILANGKAMQGVFEYYKSVTFVSNCGSHPSTTSKGSPINTQYVF SEQ ID NO: 14 (amino acid sequence encoded by the construct shown in FIG. 1, using full S1 subunit as the SARS-CoV-2 antigen) MQLLTCFSIFSVIASVLAMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLH STQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQS LLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQ GNFKNLREFVFKNIDGYFKIYSKHTKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRS YLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQ TSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYG VSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGN YNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSF ELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTL EILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGC LIGAEHVNNSYECDIPIGAGICASYQTQTNSPEFGKPIPNPLLGLDSTGGGGSGGGGSGGGGSQELT TICEQIPSPTLESTPYSLSTTTILANGKAMQGVFEYYKSVTFVSNCGSHPSTTSKGSPINTQYVF SEQ ID NO: 15 (amino acid sequence encoded by the construct shown in FIG. 1, using full RBD subunit as the SARS-CoV-2 antigen) MQLLTCFSIFSVIASVLAPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFK CYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKV GGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVV LSFELLHAPEFGKPIPNPLLGLDSTGGGGSGGGGSGGGGSQELTTICEQIPSPTLESTPYSLSTTTI LANGKAMQGVFEYYKSVTFVSNCGSHPSTTSKGSPINTQYVF SEQ ID NO: 16 (nucleotide sequence for Aga2 signal peptide) ATG CAG TTA CTT CGC TGT TTT TCA ATA TTT TCT GTT ATT GCT TCA GTT TTA GCA SEQ ID NO: 17 (nucleotide sequence for V5 epitope) GGT AAG CCT ATC CCT AAC CCT CTC CTC GGT CTC GAT TCT ACG SEQ ID NO: 18 (nucleotide sequence for linker) GGT GGT GGT GGT TCT GGT GGT GGT GGT TCT GGT GGT GGT GGT TCT SEQ ID NO: 19 (nucleotide sequence for Aga2 mature peptide) CAG GAA CTG ACA ACT ATA TGC GAG CAA ATC CCC TCA CCA ACT TTA GAA TCG ACG CCG TAC TCT TTG TCA ACG ACT ACT ATT TTG GCC AAC GGG AAG GCA ATG CAA GGA GTT TTT SEQ ID NO: 20 (nucleotide sequence for the construct shown in FIG. 1, using the full S protein as the SARS-CoV-2 antigen)    1 ATGCAGTTAC TTCGCTGTTT TTCAATATTT TCTGTTATTG CTTCAGTTTT   51 AGCAatgttt gtttttcttg ttttattgcc actagtctct agtcagtgtg  101 ttaatcttac aaccagaact caattacccc ctgcatacac taattctttc  151 acacgtggtg tttattaccc tgacaaagtt ttcagatcct cagttttaca  201 ttcaactcag gacttgttct tacctttctt ttccaatgtt acttggttcc  251 atgctataca tgtctctggg accaatggta ctaagaggtt tgataaccct  301 gtcctaccat ttaatgatgg tgtttatttt gcttccactg agaagtctaa  351 cataataaga ggctggattt ttggtactac tttagattcg aagacccagt  401 ccctacttat tgttaataac gctactaatg ttgttattaa agtctgtgaa  451 tttcaatttt gtaatgatcc atttttgggt gtttattacc acaaaaacaa  501 caaaagttgg atggaaagtg agttcagagt ttattctagt gcgaataatt  551 gcacttttga atatgtctct cagccttttc ttatggacct tgaaggaaaa  601 cagggtaatt tcaaaaatct tagggaattt gtgtttaaga atattgatgg  651 ttattttaaa atatattcta agcacacgcc tattaattta gtgcgtgatc  701 tccctcaggg tttttcggct ttagaaccat tggtagattt gccaataggt  751 attaacatca ctaggtttca aactttactt gctttacata gaagttattt  801 gactcctggt gattcttctt caggttggac agctggtgct gcagcttatt  851 atgtgggtta tcttcaacct aggacttttc tattaaaata taatgaaaat  901 ggaaccatta cagatgctgt agactgtgca cttgaccctc tctcagaaac  951 aaagtgtacg ttgaaatcct tcactgtaga aaaaggaatc tatcaaactt 1001 ctaactttag agtccaacca acagaatcta ttgttagatt tcctaatatt 1051 acaaacttgt gcccttttgg tgaagttttt aacgccacca gatttgcatc 1101 tgtttatgct tggaacagga agagaatcag caactgtgtt gctgattatt 1151 ctgtcctata taattccgca tcattttcca cttttaagtg ttatggagtg 1201 tctcctacta aattaaatga tctctgcttt actaatgtct atgcagattc 1251 atttgtaatt agaggtgatg aagtcagaca aatcgctcca gggcaaactg 1301 gaaagattgc tgattataat tataaattac cagatgattt tacaggctgc 1351 gttatagctt ggaattctaa caatcttgat tctaaggttg gtggtaatta 1401 taattacctg tatagattgt ttaggaagtc taatctcaaa ccttttgaga 1451 gagatatttc aactgaaatc tatcaggccg gtagcacacc ttgtaatggt 1501 gttgaaggtt ttaattgtta ctttccttta caatcatatg gtttccaacc 1551 cactaatggt gttggttacc aaccatacag agtagtagta ctttcttttg 1601 aacttctaca tgcaccagca actgtttgtg gacctaaaaa gtctactaat 1651 ttggttaaaa acaaatgtgt caatttcaac ttcaatggtt taacaggcac 1701 aggtgttctt actgagtcta acaaaaagtt tctgcctttc caacaatttg 1751 gcagagacat tgctgacact actgatgctg tccgtgatcc acagacactt 1801 gagattcttg acattacacc atgttctttt ggtggtgtca gtgttataac 1851 accaggaaca aatacttcta accaggttgc tgttctttat caggatgtta 1901 actgcacaga agtccctgtt gctattcatg cagatcaact tactcctact 1951 tggcgtgttt attctacagg ttctaatgtt tttcaaacac gtgcaggctg 2001 tttaataggg gctgaacatg tcaacaactc atatgagtgt gacataccca 2051 ttggtgcagg tatatgcgct agttatcaga ctcagactaa ttctcctcgg 2101 cgggcacgta gtgtagctag tcaatccatc attgcctaca ctatgtcact 2151 tggtgcagaa aattcagttg cttactctaa taactctatt gccataccca 2201 caaattttac tattagtgtt accacagaaa ttctaccagt gtctatgacc 2251 aagacatcag tagattgtac aatgtacatt tgtggtgatt caactgaatg 2301 cagcaatctt ttgttgcaat atggcagttt ttgtacacaa ttaaaccgtg 2351 ctttaactgg aatagctgtt gaacaagaca aaaacaccca agaagttttt 2401 gcacaagtca aacaaattta caaaacacca ccaattaaag attttggtgg 2451 ttttaatttt tcacaaatat taccagatcc atcaaaacca agcaagaggt 2501 catttattga agatctactt ttcaacaaag tgacacttgc agatgctggc 2551 ttcatcaaac aatatggtga ttgccttggt gatattgctg ctagagacct 2601 catttgtgca caaaagttta acggccttac tgttttgcca cctttgctca 2651 cagatgaaat gattgctcaa tacacttctg cactgttagc gggtacaatc 2701 acttctggtt ggacctttgg tgcaggtgct gcattacaaa taccatttgc 2751 tatgcaaatg gcttataggt ttaatggtat tggagttaca cagaatgttc 2801 tctatgagaa ccaaaaattg attgccaacc aatttaatag tgctattggc 2851 aaaattcaag actcactttc ttccacagca agtgcacttg gaaaacttca 2901 agatgtggtc aaccaaaatg cacaagcttt aaacacgctt gttaaacaac 2951 ttagctccaa ttttggtgca atttcaagtg ttttaaatga tatcctttca 3001 cgtcttgaca aagttgaggc tgaagtgcaa attgataggt tgatcacagg 3051 cagacttcaa agtttgcaga catatgtgac tcaacaatta attagagctg 3101 cagaaatcag agcttctgct aatcttgctg ctactaaaat gtcagagtgt 3151 gtacttggac aatcaaaaag agttgatttt tgtggaaagg gctatcatct 3201 tatgtccttc cctcagtcag cacctcatgg tgtagtcttc ttgcatgtga 3251 cttatgtccc tgcacaagaa aagaacttca caactgctcc tgccatttgt 3301 catgatggaa aagcacactt tcctcgtgaa ggtgtctttg tttcaaatgg 3351 cacacactgg tttgtaacac aaaggaattt ttatgaacca caaatcatta 3401 ctacagacaa cacatttgtg tctggtaact gtgatgttgt aataggaatt 3451 gtcaacaaca cagtttatga tcctttgcaa cctgaattag actcattcaa 3501 ggaggagtta gataaatatt ttaagaatca tacatcacca gatgttgatt 3551 taggtgacat ctctggcatt aatgcttcag ttgtaaacat tcaaaaagaa 3601 attgaccgcc tcaatgaggt tgccaagaat ttaaatgaat ctctcatcga 3651 tctccaagaa cttggaaagt atgagcagta tataaaatgg ccatggtaca 3701 tttggctagg ttttatagct ggcttgattg ccatagtaat ggtgacaatt 3751 atgctttgct gtatgaccag ttgctgtagt tgtctcaagg gctgttgttc 3801 ttgtggatcc tgctgcaaat ttgatgaaga cgactctgag ccagtgctca 3851 aaggagtcaa attacattac acataaGGTA AGCCTATCCC TAACCCTCTC 3901 CTCGGTCTCG ATTCTACGGG TGGTGGTGGT TCTGGTGGTG GTGGTTCTGG 3951 TGGTGGTGGT TCTCAGGAAC TGACAACTAT ATGCGAGCAA ATCCCCTCAC 4001 CAACTTTAGA ATCGACGCCG TACTCTTTGT CAACGACTAC TATTTTGGCC 4051 AACGGGAAGG CAATGCAAGG AGTTTTT SEQ ID NO: 21 (nucleotide sequence for the construct shown in FIG. 1, using the full S1 subunit as the SARS-CoV-2 antigen)    1 ATGCAGTTAC TTCGCTGTTT TTCAATATTT TCTGTTATTG CTTCAGTTTT   51 AGCAATGTTT GTTTTTCTTG TTTTATTGCC ACTAGTCTCT AGTCAGTGTG  101 TTAATCTTAC AACCAGAACT CAATTACCCC CTGCATACAC TAATTCTTTC  151 ACACGTGGTG TTTATTACCC TGACAAAGTT TTCAGATCCT CAGTTTTACA  201 TTCAACTCAG GACTTGTTCT TACCTTTCTT TTCCAATGTT ACTTGGTTCC  251 ATGCTATACA TGTCTCTGGG ACCAATGGTA CTAAGAGGTT TGATAACCCT  301 GTCCTACCAT TTAATGATGG TGTTTATTTT GCTTCCACTG AGAAGTCTAA  351 CATAATAAGA GGCTGGATTT TTGGTACTAC TTTAGATTCG AAGACCCAGT  401 CCCTACTTAT TGTTAATAAC GCTACTAATG TTGTTATTAA AGTCTGTGAA  451 TTTCAATTTT GTAATGATCC ATTTTTGGGT GTTTATTACC ACAAAAACAA  501 CAAAAGTTGG ATGGAAAGTG AGTTCAGAGT TTATTCTAGT GCGAATAATT  551 GCACTTTTGA ATATGTCTCT CAGCCTTTTC TTATGGACCT TGAAGGAAAA  601 CAGGGTAATT TCAAAAATCT TAGGGAATTT GTGTTTAAGA ATATTGATGG  651 TTATTTTAAA ATATATTCTA AGCACACGCC TATTAATTTA GTGCGTGATC  701 TCCCTCAGGG TTTTTCGGCT TTAGAACCAT TGGTAGATTT GCCAATAGGT  751 ATTAACATCA CTAGGTTTCA AACTTTACTT GCTTTACATA GAAGTTATTT  801 GACTCCTGGT GATTCTTCTT CAGGTTGGAC AGCTGGTGCT GCAGCTTATT  851 ATGTGGGTTA TCTTCAACCT AGGACTTTTC TATTAAAATA TAATGAAAAT  901 GGAACCATTA CAGATGCTGT AGACTGTGCA CTTGACCCTC TCTCAGAAAC  951 AAAGTGTACG TTGAAATCCT TCACTGTAGA AAAAGGAATC TATCAAACTT 1001 CTAACTTTAG AGTCCAACCA ACAGAATCTA TTGTTAGATT TCCTAATATT 1051 ACAAACTTGT GCCCTTTTGG TGAAGTTTTT AACGCCACCA GATTTGCATC 1101 TGTTTATGCT TGGAACAGGA AGAGAATCAG CAACTGTGTT GCTGATTATT 1151 CTGTCCTATA TAATTCCGCA TCATTTTCCA CTTTTAAGTG TTATGGAGTG 1201 TCTCCTACTA AATTAAATGA TCTCTGCTTT ACTAATGTCT ATGCAGATTC 1251 ATTTGTAATT AGAGGTGATG AAGTCAGACA AATCGCTCCA GGGCAAACTG 1301 GAAAGATTGC TGATTATAAT TATAAATTAC CAGATGATTT TACAGGCTGC 1351 GTTATAGCTT GGAATTCTAA CAATCTTGAT TCTAAGGTTG GTGGTAATTA 1401 TAATTACCTG TATAGATTGT TTAGGAAGTC TAATCTCAAA CCTTTTGAGA 1451 GAGATATTTC AACTGAAATC TATCAGGCCG GTAGCACACC TTGTAATGGT 1501 GTTGAAGGTT TTAATTGTTA CTTTCCTTTA CAATCATATG GTTTCCAACC 1551 CACTAATGGT GTTGGTTACC AACCATACAG AGTAGTAGTA CTTTCTTTTG 1601 AACTTCTACA TGCACCAGCA ACTGTTTGTG GACCTAAAAA GTCTACTAAT 1651 TTGGTTAAAA ACAAATGTGT CAATTTCAAC TTCAATGGTT TAACAGGCAC 1701 AGGTGTTCTT ACTGAGTCTA ACAAAAAGTT TCTGCCTTTC CAACAATTTG 1751 GCAGAGACAT TGCTGACACT ACTGATGCTG TCCGTGATCC ACAGACACTT 1801 GAGATTCTTG ACATTACACC ATGTTCTTTT GGTGGTGTCA GTGTTATAAC 1851 ACCAGGAACA AATACTTCTA ACCAGGTTGC TGTTCTTTAT CAGGATGTTA 1901 ACTGCACAGA AGTCCCTGTT GCTATTCATG CAGATCAACT TACTCCTACT 1951 TGGCGTGTTT ATTCTACAGG TTCTAATGTT TTTCAAACAC GTGCAGGCTG 2001 TTTAATAGGG GCTGAACATG TCAACAACTC ATATGAGTGT GACATACCCA 2051 TTGGTGCAGG TATATGCGCT AGTTATCAGA CTCAGACTAA TTCTCCTGGT 2101 AAGCCTATCC CTAACCCTCT CCTCGGTCTC GATTCTACGG GTGGTGGTGG 2151 TTCTGGTGGT GGTGGTTCTG GTGGTGGTGG TTCTCAGGAA CTGACAACTA 2201 TATGCGAGCA AATCCCCTCA CCAACTTTAG AATCGACGCC GTACTCTTTG 2251 TCAACGACTA CTATTTTGGC CAACGGGAAG GCAATGCAAG GAGTTTTT SEQ ID NO: 22 (nucleotide sequence for the construct shown in FIG. 1, using the full RBD as the SARS-CoV-2 antigen)    1 ATGCAGTTAC TTCGCTGTTT TTCAATATTT TCTGTTATTG CTTCAGTTTT   51 AGCACTAATA TTACAAACTT GTGCCCTTTT GGTGAAGTTT TTAACGCCAC  101 CAGATTTGCA TCTGTTTATG CTTGGAACAG GAAGAGAATC AGCAACTGTG  151 TTGCTGATTA TTCTGTCCTA TATAATTCCG CATCATTTTC CACTTTTAAG  201 TGTTATGGAG TGTCTCCTAC TAAATTAAAT GATCTCTGCT TTACTAATGT  251 CTATGCAGAT TCATTTGTAA TTAGAGGTGA TGAAGTCAGA CAAATCGCTC  301 CAGGGCAAAC TGGAAAGATT GCTGATTATA ATTATAAATT ACCAGATGAT  351 TTTACAGGCT GCGTTATAGC TTGGAATTCT AACAATCTTG ATTCTAAGGT  401 TGGTGGTAAT TATAATTACC TGTATAGATT GTTTAGGAAG TCTAATCTCA  451 AACCTTTTGA GAGAGATATT TCAACTGAAA TCTATCAGGC CGGTAGCACA  501 CCTTGTAATG GTGTTGAAGG TTTTAATTGT TACTTTCCTT TACAATCATA  551 TGGTTTCCAA CCCACTAATG GTGTTGGTTA CCAACCATAC AGAGTAGTAG  601 TACTTTCTTT TGAACTTCTA CATGCACCAG GTAAGCCTAT CCCTAACCCT  651 CTCCTCGGTC TCGATTCTAC GGGTGGTGGT GGTTCTGGTG GTGGTGGTTC  701 TGGTGGTGGT GGTTCTCAGG AACTGACAAC TATATGCGAG CAAATCCCCT  751 CACCAACTTT AGAATCGACG CCGTACTCTT TGTCAACGAC TACTATTTTG  801 GCCAACGGGA AGGCAATGCA AGGAGTTTTT

    Numbered Embodiments

    [0083] 1. A nucleic acid construct for heterologous expression of a SARS CoV-2 antigen on the surface of a yeast cell, the nucleic acid construct comprising:

    [0084] (a) a promoter element active in a yeast cell; and

    [0085] (b) one or more heterologous polynucleotides encoding (i) a SARS-CoV-2 antigen; and (ii) a yeast surface display polypeptide or fragment thereof,

    wherein the one or more heterologous polynucleotides are operably linked to the promoter element, and

    [0086] wherein the one or more heterologous polynucleotides encodes a polypeptide comprising, in the N.fwdarw.C direction: [0087] (1) an Aga2 signal peptide having the amino acid sequence of SEQ ID NO: 10; [0088] (2) the SARS-CoV-2 antigen; and [0089] (3) a polypeptide having the amino acid sequence of SEQ ID NO: 12.
    2. The nucleic acid construct of embodiment 1, wherein the one or more heterologous polynucleotides encodes a polypeptide consisting of, in the N.fwdarw.C direction: [0090] (1) an Aga2 signal peptide having the amino acid sequence of SEQ ID NO: 10; [0091] (2) the SARS-CoV-2 antigen; and [0092] (3) a polypeptide having the amino acid sequence of SEQ ID NO: 12.
    3. The nucleic acid construct of embodiment 1, wherein the SARS-CoV-2 antigen comprises a sequence selected from the group consisting of SEQ ID NO: 4, SEQ ID NO: 5, and SEQ ID NO: 6.
    4. A nucleic acid construct for heterologous expression of a SARS CoV-2 antigen on the surface of a yeast cell, the nucleic acid construct comprising: [0093] (a) a promoter element active in a yeast cell; and [0094] (b) one or more heterologous polynucleotides encoding (i) a SARS-CoV-2 antigen; and (ii) a yeast surface display polypeptide or fragment thereof,

    [0095] wherein the one or more heterologous polynucleotides are operably linked to the promoter element, and

    [0096] wherein the one or more heterologous polynucleotides encodes a polypeptide comprising a sequence as set forth in SEQ ID NO: 13.

    5. The nucleic acid sequence of embodiment 4, wherein the one or more heterologous polynucleotides encodes a polypeptide consisting of a sequence as set forth in SEQ ID NO: 13.
    6. The nucleic acid construct of embodiment 5, wherein the one or more heterologous polynucleotides comprises a sequence at least 99% identical to SEQ ID NO: 20.
    7. A nucleic acid construct for heterologous expression of a SARS CoV-2 antigen on the surface of a yeast cell, the nucleic acid construct comprising:

    [0097] (a) a promoter element active in a yeast cell; and

    [0098] (b) one or more heterologous polynucleotides encoding (i) a SARS-CoV-2 antigen; and (ii) a yeast surface display polypeptide or fragment thereof,

    [0099] wherein the one or more heterologous polynucleotides are operably linked to the promoter element, and

    [0100] wherein the one or more heterologous polynucleotides encodes a polypeptide comprising a sequence as set forth in SEQ ID NO: 14.

    8. The nucleic acid sequence of embodiment 7, wherein the one or more heterologous polynucleotides encodes a polypeptide consisting of a sequence as set forth in SEQ ID NO: 14.
    9. The nucleic acid construct of embodiment 8, wherein the one or more heterologous polynucleotides comprises a sequence at least 99% identical to SEQ ID NO: 21.
    10. A nucleic acid construct for heterologous expression of a SARS CoV-2 antigen on the surface of a yeast cell, the nucleic acid construct comprising:

    [0101] (a) a promoter element active in a yeast cell; and

    [0102] (b) one or more heterologous polynucleotides encoding (i) a SARS-CoV-2 antigen; and (ii) a yeast surface display polypeptide or fragment thereof,

    [0103] wherein the one or more heterologous polynucleotides are operably linked to the promoter element, and

    [0104] wherein the one or more heterologous polynucleotides encodes a polypeptide comprising a sequence as set forth in SEQ ID NO: 15.

    11. The nucleic acid sequence of embodiment 10, wherein the one or more heterologous polynucleotides encodes a polypeptide consisting of a sequence as set forth in SEQ ID NO: 15.
    12. The nucleic acid construct of embodiment 11, wherein the one or more heterologous polynucleotides comprises a sequence at least 99% identical to SEQ ID NO: 22.
    13. A nucleic acid construct for heterologous expression of a SARS CoV-2 antigen on the surface of a yeast cell, the nucleic acid construct comprising: [0105] (a) a promoter element active in a yeast cell; and [0106] (b) one or more heterologous polynucleotides encoding (i) one or more SARS-CoV-2 antigens and (ii) a yeast surface display polypeptide or fragment thereof,
    wherein the one or more heterologous polynucleotides are operably linked to the promoter element.
    14. The nucleic acid construct of embodiment 13, wherein the one or more SARS-CoV-2 antigens are from the SARS-CoV-2 S protein.
    15. The nucleic acid construct of embodiment 14, wherein the polynucleotide encodes a polypeptide having at least 75% sequence identity to the amino acid sequence set forth in SEQ ID NO: 4.
    16. The nucleic acid construct of embodiment 15, wherein the polynucleotide encodes a polypeptide having at least 80% sequence identity to the amino acid sequence set forth in SEQ ID NO: 4.
    17. The nucleic acid construct of embodiment 16, wherein the polynucleotide encodes a polypeptide having at least 85% sequence identity to the amino acid sequence set forth in SEQ ID NO: 4.
    18. The nucleic acid construct of embodiment 17, wherein the polynucleotide encodes a polypeptide having at least 90% sequence identity to the amino acid sequence set forth in SEQ ID NO: 4.
    19. The nucleic acid construct of embodiment 18, wherein the polynucleotide encodes a polypeptide having at least 95% sequence identity to the amino acid sequence set forth in SEQ ID NO: 4.
    20. The nucleic acid construct of embodiment 19, wherein the polynucleotide encodes a polypeptide having at least 98% sequence identity to the amino acid sequence set forth in SEQ ID NO: 4.
    21. The nucleic acid construct of embodiment 20, wherein the polypeptide comprises a full-length SARS-CoV-2 S protein having the amino acid sequence set forth in SEQ ID NO: 4.
    22. The nucleic acid construct of embodiment 14, wherein the one or more SARS-CoV-2 antigens are from the SARS-CoV-2 S1 subunit.
    23. The nucleic acid construct of embodiment 22, wherein the polynucleotide encodes a polypeptide having at least 75% sequence identity to the amino acid sequence set forth in SEQ ID NO: 5.
    24. The nucleic acid construct of embodiment 23, wherein the polynucleotide encodes a polypeptide having at least 80% sequence identity to the amino acid sequence set forth in SEQ ID NO: 5.
    25. The nucleic acid construct of embodiment 24, wherein the polynucleotide encodes a polypeptide having at least 85% sequence identity to the amino acid sequence set forth in SEQ ID NO: 5.
    26. The nucleic acid construct of embodiment 25, wherein the polynucleotide encodes a polypeptide having at least 90% sequence identity to the amino acid sequence set forth in SEQ ID NO: 5.
    27. The nucleic acid construct of embodiment 26, wherein the polynucleotide encodes a polypeptide having at least 95% sequence identity to the amino acid sequence set forth in SEQ ID NO: 5.
    28. The nucleic acid construct of embodiment 27, wherein the polynucleotide encodes a polypeptide having at least 98% sequence identity to the amino acid sequence set forth in SEQ ID NO: 5.
    29. The nucleic acid construct of embodiment 28, wherein the polypeptide comprises a full-length SARS-CoV-2 S1 subunit having the amino acid sequence set forth in SEQ ID NO: 5.
    30. The nucleic acid construct of embodiment 22, wherein the one or more SARS-CoV-2 antigens are from the SARS-CoV-2 RBD.
    31. The nucleic acid construct of embodiment 30, wherein the polynucleotide encodes a polypeptide having at least 75% sequence identity to the amino acid sequence set forth in SEQ ID NO: 6.
    32. The nucleic acid construct of embodiment 31, wherein the polynucleotide encodes a polypeptide having at least 80% sequence identity to the amino acid sequence set forth in SEQ ID NO: 6.
    33. The nucleic acid construct of embodiment 32, wherein the polynucleotide encodes a polypeptide having at least 85% sequence identity to the amino acid sequence set forth in SEQ ID NO: 6.
    34. The nucleic acid construct of embodiment 33, wherein the polynucleotide encodes a polypeptide having at least 90% sequence identity to the amino acid sequence set forth in SEQ ID NO: 6.
    35. The nucleic acid construct of embodiment 34, wherein the polynucleotide encodes a polypeptide having at least 95% sequence identity to the amino acid sequence set forth in SEQ ID NO: 6.
    36. The nucleic acid construct of embodiment 35, wherein the polynucleotide encodes a polypeptide having at least 98% sequence identity to the amino acid sequence set forth in SEQ ID NO: 6.
    37. The nucleic acid construct of embodiment 36, wherein the polypeptide comprises a full-length SARS-CoV-2 RBD having the amino acid sequence set forth in SEQ ID NO: 6.
    38. The nucleic acid construct of any one of embodiments 13-37, wherein the nucleotide sequence of one or more heterologous polynucleotides is at least 70% identical to a sequence as set forth in SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
    39. The nucleic acid construct of embodiment 38, wherein the nucleotide sequence of one or more heterologous polynucleotides is at least 80% identical to a sequence as set forth in SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
    40. The nucleic acid construct of embodiment 39, wherein the nucleotide sequence of one or more heterologous polynucleotides is at least 90% identical to a sequence as set forth in SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
    41. The nucleic acid construct of embodiment 40, wherein the nucleotide sequence of one or more heterologous polynucleotides is at least 95% identical to a sequence as set forth in SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
    42. The nucleic acid construct of embodiment 41, wherein the nucleotide sequence of one or more heterologous polynucleotides comprises a sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
    43. The nucleic acid construct of any one of embodiments 13-42, wherein the yeast surface display polypeptide is an a-agglutinin polypeptide or fragment thereof.
    44. The nucleic acid construct of embodiment 43, wherein the a-agglutinin polypeptide or fragment thereof is an Aga2 peptide.
    45. The nucleic acid construct of embodiment 44, wherein the Aga2 peptide has the amino acid sequence set forth in SEQ ID NO: 7.
    46. The nucleic acid construct of any one of embodiments 25-57, wherein the one or more heterologous polynucleotides further encode a signal peptide in-frame with the SARS-CoV-2 antigen.
    47. The nucleic acid construct of embodiment 46, wherein the signal peptide is an Aga2 signal peptide.
    48. The nucleic acid construct of any one of embodiments 13-47, further comprising a coding sequence for a linker peptide.
    49. The nucleic acid construct of embodiment 48, wherein the linker peptide sequence comprises (GGGGS).sub.N, wherein N is between 1 and 10, inclusive.
    50. The nucleic acid construct of embodiment 49, wherein N is 3.
    51. The nucleic acid construct of any one of embodiments 13-50, wherein the one or more heterologous polynucleotides further encode one or more tags.
    52. The nucleic acid construct of embodiment 51, wherein the one or more tags comprises an epitope tag.
    53. The nucleic acid construct of embodiment 52, wherein the epitope tag is a V5 epitope tag.
    54. The nucleotide acid construct of embodiment 53, wherein the V5 epitope tag has the amino acid sequence set forth in SEQ ID NO: 9.
    55. The nucleic acid construct of any one of embodiments 51-54, wherein the one or more tags comprises 6×His tag.
    56. The nucleic acid construct of any one of embodiments 13-55, wherein the one or more heterologous polynucleotides encode a polypeptide having the yeast surface display polypeptide at a first terminus.
    57. The nucleic acid construct of embodiment 56, wherein the polypeptide has, at a second terminus, (i) a tag, (ii) signal peptide, or (iii) the SARS-CoV-2 antigen.
    58. The nucleic acid construct of embodiment 57,

    [0107] wherein the polypeptide has, at the second terminus, a signal peptide, and

    [0108] wherein cleavage of the signal peptide results in a mature polypeptide having the SARS-CoV-2 antigen at the second terminus.

    59. The nucleic acid construct of any one of embodiments 56-58, wherein the first terminus is the C-terminus.
    60. The nucleic acid construct of any one of embodiments 56-58, wherein the first terminus is the N-terminus.
    61. The nucleic acid construct of embodiment 43, wherein the one or more heterologous polynucleotides encodes a polypeptide comprising, in the N.fwdarw.C direction:

    [0109] (a) an Aga2 signal peptide;

    [0110] (b) the one or more SARS-CoV-2 antigens;

    [0111] (c) a linker peptide sequence; and

    [0112] (d) an Aga2 peptide;

    [0113] wherein cleavage of the Aga2 signal peptide results in a mature polypeptide having the SARS-CoV-2 antigen at the N-terminus.

    62. The nucleic acid construct of embodiment 61, wherein the linker peptide sequence comprises (GGGGS).sub.N, wherein N is between 1 and 10.
    63. The nucleic acid construct of embodiment 62, wherein N is 3.
    64. The method of any one of embodiments 61-63, wherein the Aga2 peptide has the amino acid sequence set forth in SEQ ID NO: 7.
    65. The nucleic acid construct of embodiment 43, wherein the one or more heterologous polynucleotides encodes a polypeptide comprising, in the N.fwdarw.C direction:

    [0114] (a) an Aga2 signal peptide,

    [0115] (b) an Aga2 peptide,

    [0116] (c) a linker peptide, and

    [0117] (d) the one or more SARS-CoV-2 antigens, [0118] wherein cleavage of the Aga2 signal peptide results in a mature polypeptide having the Aga2 peptide at the N-terminus.
    66. The nucleic acid construct of embodiment 65, wherein the polypeptide further comprises one or more tags located C-terminal to the one or more SARS-CoV-2 antigens.
    67. The nucleic acid construct of embodiment 66, wherein the one or more tags comprise a V5 epitope tag.
    68. The nucleic acid construct of embodiment 66 or 67, wherein the one or more tags comprise a 6×His epitope tag.
    69. The nucleic acid construct of any one of embodiments 65-68, wherein the linker peptide comprises the sequence (GGGGS).sub.N, wherein N is between 1 and 10.
    70. The nucleic acid construct of embodiment 69, wherein N is 3.
    71. The nucleic acid of any one of embodiments 65-70, wherein the Aga2 peptide has the amino acid sequence set forth in SEQ ID NO: 7.
    72. A polypeptide expressed by the nucleic acid construct of any one of embodiments 1-63, or a mature version thereof.
    73. The polypeptide of embodiment 72, wherein the polypeptide comprises, in the N.fwdarw.C direction, an Aga2 signal peptide, a SARS-CoV-2 antigen, a V5 epitope, a (G.sub.4S).sub.N linker, and an Aga2p subunit, wherein N is between 1 and 10.
    74. The polypeptide of embodiment 72, wherein the polypeptide comprises, in the N.fwdarw.C direction, a SARS-CoV-2 antigen, a V5 epitope, a (G.sub.4S).sub.N linker, and an Aga2p subunit, wherein N is between 1 and 10.
    75. The polypeptide of embodiment 73 or 74, wherein N is 3.
    76. A recombinant yeast comprising the nucleic acid construct of any one of embodiments 1-63 or the polypeptide of any one of embodiments 72-75.
    77. The recombinant yeast of embodiment 76, wherein the recombinant yeast further comprises a nucleic acid encoding a second yeast surface display polypeptide.
    78. The recombinant yeast of embodiment 77, wherein the second yeast surface display polypeptide is operably linked to an inducible promoter.
    79. The recombinant yeast of embodiment 77 or 78, wherein the second yeast surface display polypeptide is an a-agglutinin polypeptide or fragment thereof.
    80. The recombinant yeast of embodiment 79, wherein the a-agglutinin polypeptide or fragment thereof is an Aga1 peptide.
    81. The recombinant yeast of any one of embodiments 76-80, wherein the yeast is S. cerevisiae.
    82. The recombinant yeast of embodiments 81, wherein the S. cerevisiae is strain EBY100.
    83. The recombinant yeast of any one of embodiments 76-82, wherein the recombinant yeast displays the one or more SARS-CoV-2 antigens on its cell surface.
    84. The recombinant yeast of embodiment 83, wherein the one or more SARS-CoV-2 antigens is from the SARS-CoV-2 S protein.
    85. The recombinant yeast of embodiment 84, wherein the one or more SARS-CoV-2 antigens is from the SARS-CoV-2 S1 subunit.
    86. The recombinant yeast of embodiment 85, wherein the one or more SARS-CoV-2 antigens is from the SARS-CoV-2 RBD.
    87. A vaccine composition comprising an effective amount of the recombinant yeast of any one of embodiment 76-86, or an extract thereof.
    88. The vaccine composition of embodiment 87, further comprising an adjuvant.
    89. The vaccine composition of embodiment 87, wherein the composition lacks an adjuvant.
    90. An oral dosage formulation comprising the vaccine composition of embodiment 87, 88, or 89.
    91. The oral dosage formulation of embodiment 90, further comprising an oral solid dosage form excipient.
    92. The oral dosage formulation of embodiment 91, wherein the oral solid dosage form excipient is selected from the group consisting of binders and fillers, coatings, lubricants, matrix formers, and disintegrants.
    93. The oral dosage formulation of embodiment 90, wherein the formulation is a liquid or gel formulation.
    94. The oral dosage formulation of embodiment 93, wherein the liquid or gel formulation is in a monophasic form.
    95. The oral dosage formulation of embodiment 94, wherein the monophasic form is selected from the group consisting of aqueous solutions and non-aqueous solutions.
    96. The oral dosage formulation of embodiment 93, wherein the formulation is in a biphasic form.
    97. The oral dosage formulation of embodiment 96, wherein the biphasic form is selected from the group consisting of suspensions, emulsions, and mixtures.
    98. A method of inducing an antigen-specific immune response to SARS-CoV-2 in a subject, comprising administering to the subject an effective amount of a vaccine composition or oral dosage formulation of any one of embodiments 87-97.
    99. The method of embodiment 98, wherein the subject has not tested positive for SARS-CoV-2.
    100. The method of embodiment 98 or 99, wherein the subject is a human subject.
    101. The method of any one of embodiments 98-100, wherein the administering comprises oral administration.